Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G038102.284ON66166134550.0
NDAI0G006402.284ON62143214430.0
KAFR0H033302.284ON36933013640.0
TDEL0G021502.284ON66131213840.0
Suva_9.1042.284ON80549713790.0
YIL095W (PRK1)2.284ON81049313751e-180
Skud_9.782.284ON80947913681e-179
Smik_9.842.284ON80841913631e-178
NCAS0B062602.284ON72345013181e-173
Kwal_27.115422.284ON79131413221e-172
Skud_14.3092.284ON63936013001e-171
KLTH0G10318g2.284ON79040613131e-171
SAKL0E07722g2.284ON79148013131e-171
Smik_14.3112.284ON63763312921e-170
NDAI0B035602.284ON75632612991e-169
CAGL0G02607g2.284ON68831212911e-169
YNL020C (ARK1)2.284ON63830612871e-169
Suva_14.3272.284ON63243112801e-168
KAFR0J013702.284ON78038512861e-167
KLLA0E08405g2.284ON77742512831e-167
Ecym_33232.284ON74847512761e-166
TBLA0B059302.284ON71732112681e-165
Kpol_1003.352.284ON71331112651e-165
KNAG0H020202.284ON59231412491e-164
TPHA0C033802.284ON69772212571e-164
ZYRO0A01848g2.284ON70447412501e-163
ADL217W2.284ON75031112501e-162
CAGL0J03432g2.284ON62234611631e-151
Kpol_1039.332.284ON70131111671e-150
TBLA0B069402.284ON144331311651e-143
KNAG0A054302.284ON78833311141e-141
TPHA0D015402.284ON70730310391e-131
SAKL0D03234g3.273ON8583158087e-96
KNAG0J008203.273ON10913228207e-96
Kpol_251.43.273ON8383118014e-95
KAFR0A010403.273ON9123258021e-94
KNAG0H012203.273ON9133598003e-94
Kpol_1052.223.273ON11013128041e-93
NCAS0A105903.273ON10953127882e-91
Suva_4.2973.273ON11073197883e-91
NDAI0A057003.273ON11573237893e-91
Skud_2.1793.273ON10903197864e-91
CAGL0H10208g3.273ON10273217819e-91
YBR059C (AKL1)3.273ON11083197822e-90
TBLA0E025903.273ON10613167802e-90
KLTH0C07260g3.273ON9013197722e-90
TPHA0A040303.273ON10543327751e-89
Ecym_26503.273ON8943107661e-89
Smik_2.1913.273ON11083197752e-89
Kwal_27.109453.273ON9353127663e-89
KLLA0F18612g3.273ON8143177569e-89
KAFR0C004303.273ON9494017612e-88
ZYRO0E06864g3.273ON11153387673e-88
AGR027C3.273ON9613137577e-88
TDEL0D035203.273ON10493177618e-88
CAGL0K11990g3.273ON9913227552e-87
TPHA0M011203.273ON7883387382e-86
TBLA0I019303.273ON13613187522e-85
Suva_16.706.262ON3643472451e-21
Skud_16.426.262ON3643352398e-21
YPL236C (ENV7)6.262ON3643332388e-21
KNAG0F001701.24ON5432952431e-20
SAKL0A03344g6.262ON3643552301e-19
SAKL0H06754g8.668ON8842072371e-19
KNAG0F002901.52ON11253002352e-19
TDEL0A067506.262ON3723482263e-19
Smik_6.4416.262ON3643362246e-19
Kpol_1023.266.31ON7392712307e-19
KAFR0A050906.31ON6682422271e-18
ZYRO0E07876g6.262ON3693372221e-18
TPHA0F024306.31ON7982712272e-18
Ecym_21536.262ON3633512193e-18
NDAI0F045201.24ON4892002205e-18
Kwal_56.242746.262ON3463372157e-18
KLTH0D11044g8.668ON8492092201e-17
SAKL0C01716g1.52ON12153002192e-17
NCAS0C016708.668ON8962092182e-17
Kpol_1072.198.668ON8962032172e-17
KLLA0F14190g1.271ON13382382173e-17
ZYRO0F07194g8.668ON9381952163e-17
KLTH0F16676g5.406ON8782572154e-17
CAGL0K02673g2.496ON9152252155e-17
Kpol_431.92.479ON15522032156e-17
KAFR0G026906.31ON7133112136e-17
CAGL0K08514g2.479ON14892012147e-17
Suva_16.1608.668ON9182072129e-17
Smik_13.1596.31ON7052982111e-16
TDEL0G043806.31ON7222742111e-16
TDEL0A061408.668ON8611982111e-16
Kpol_1072.318.652ON5262552091e-16
TBLA0A071501.52ON13912982112e-16
Smik_8.422.496ON9392712102e-16
KAFR0A037108.652ON4932542072e-16
NDAI0H024707.86ON14111832102e-16
TPHA0G032002.479ON15342042103e-16
Smik_4.7891.52ON11362982093e-16
TBLA0E022907.86ON13001832093e-16
KLLA0C01650g1.52ON11122932083e-16
Suva_2.6871.52ON11282962083e-16
Skud_8.392.496ON9232712084e-16
Kwal_26.87518.668ON8482002074e-16
ZYRO0D05500g7.86ON12621742084e-16
KNAG0E008506.31ON7112902064e-16
Smik_3.541.52ON10323242074e-16
Kpol_1037.206.31ON7042742064e-16
KAFR0D041001.52ON11172992074e-16
Suva_7.838.140ON5693002055e-16
Kpol_2002.241.24ON4872722045e-16
Skud_13.1546.31ON7052962065e-16
Kwal_55.215455.406ON8652732065e-16
Kwal_26.78612.496ON9552712065e-16
YCL024W (KCC4)1.52ON10373222065e-16
Skud_4.7831.52ON11352962066e-16
TBLA0I011502.479ON17452042076e-16
TPHA0G016308.668ON8711992057e-16
KAFR0D033902.496ON7983022057e-16
Ecym_10581.52ON11642942057e-16
TDEL0A025502.479ON13692032057e-16
YMR001C (CDC5)6.31ON7052752048e-16
TPHA0E038501.24ON4821962029e-16
KAFR0G012001.24ON5073062021e-15
Smik_10.1471.271ON14782392041e-15
CAGL0F00913g7.86ON12061832041e-15
KLTH0H03080g6.262ON3463401981e-15
YDR507C (GIN4)1.52ON11422982041e-15
TPHA0J004206.31ON7072742031e-15
Suva_6.1691.271ON14842392041e-15
Skud_10.1191.271ON14812242041e-15
Suva_13.1636.31ON7052772021e-15
YHL007C (STE20)2.496ON9392712031e-15
ZYRO0F18062g1.24ON4712002001e-15
KLLA0C06138g6.31ON7082742021e-15
Skud_1.723.177ON9742712031e-15
CAGL0M11396g8.279ON11922142031e-15
KLTH0D03454g1.271ON14332542031e-15
CAGL0J11638g6.31ON7462902021e-15
YPL150W8.668ON9012102031e-15
CAGL0M02299g8.668ON8932092021e-15
NCAS0B086001.52ON11172932032e-15
Skud_16.1328.668ON9242102022e-15
Smik_1.793.177ON9742622022e-15
YAR019C (CDC15)3.177ON9742712022e-15
AFR696C1.52ON11422942022e-15
Ecym_83378.652ON5382702002e-15
Suva_11.1232.479ON15262202022e-15
KNAG0B053502.496ON8362742012e-15
Skud_4.7971.24ON4852021992e-15
YDR523C (SPS1)1.24ON4902021992e-15
Ecym_30356.31ON7402752002e-15
Suva_2.7031.24ON4852021992e-15
ABL034W2.479ON14252022022e-15
KAFR0F011506.262ON3663431962e-15
Skud_16.1418.652ON5132321983e-15
YJL095W (BCK1)1.271ON14782392013e-15
NCAS0A094701.271ON15152242013e-15
KLTH0D06006g2.496ON9542712003e-15
ZYRO0B01166g2.496ON9632712003e-15
Smik_4.8031.24ON4902021983e-15
NDAI0G034508.141ON9483212003e-15
ACL006W6.31ON7082751993e-15
NDAI0C026806.31ON7502911993e-15
TPHA0G017308.652ON5922591983e-15
Suva_8.472.496ON9802712003e-15
Ecym_10301.24ON4402781963e-15
Kpol_1031.105.406ON11271941994e-15
Suva_3.1901.52ON10242621994e-15
KLLA0F11319g8.668ON8431951994e-15
NCAS0D021006.31ON7262901984e-15
KAFR0B028008.279ON10952151994e-15
KLLA0A07403g3.60ON8792641985e-15
KNAG0B017801.271ON15802241995e-15
Kwal_26.87038.652ON4442321955e-15
KLTH0G05214g5.591ON6532471975e-15
NDAI0A038702.496ON8952681985e-15
TBLA0H016605.406ON9962331985e-15
TPHA0G032902.496ON9732791985e-15
NCAS0C041008.141ON9053291985e-15
NCAS0A057702.479ON14612011986e-15
KLTH0F01672g1.52ON11642991986e-15
Smik_6.3478.668ON9172101977e-15
TDEL0C067801.24ON4682081947e-15
ZYRO0G03366g2.479ON16162031977e-15
NDAI0K021002.496ON9092751977e-15
Ecym_60406.371ON8962931967e-15
KAFR0A014201.271ON13982241978e-15
TBLA0A035705.406ON9751961968e-15
ZYRO0D06776g8.279ON12042131968e-15
YKL101W (HSL1)2.479ON15183111979e-15
TBLA0B004906.31ON7873571969e-15
NDAI0G054701.271ON15552241979e-15
TBLA0B039908.652ON7132251959e-15
TPHA0E036401.52ON11372341969e-15
KNAG0D048107.86ON14401751969e-15
KLTH0D05566g2.479ON11281941969e-15
Skud_11.1262.479ON15182191961e-14
CAGL0K05709g1.52ON11032341961e-14
ACR133C8.668ON8511991951e-14
KLLA0C08525g6.341ON15513051961e-14
Sklu_YGOB_Anc_2.4962.496ON6192691941e-14
Skud_3.391.52ON10171961951e-14
KAFR0D049505.406ON10082021951e-14
Kpol_463.81.271ON14472371951e-14
KLLA0E21693g5.406ON10162301951e-14
Kwal_26.73551.271ON14462361951e-14
TDEL0F040608.279ON11262151951e-14
NCAS0F015807.86ON13821841951e-14
ACR117W8.652ON5242241921e-14
NDAI0D027502.479ON15152011942e-14
CAGL0C03509g6.371ON8952931942e-14
NCAS0A002801.24ON5352841922e-14
Kpol_1044.37.86ON9322741932e-14
Suva_15.2975.406ON10742051942e-14
TDEL0A027202.496ON9152721932e-14
TPHA0I009201.271ON14342641942e-14
Skud_3.1656.371ON7161981922e-14
KNAG0A030608.652ON5002531912e-14
Ecym_73922.479ON14342011932e-14
Kwal_26.77882.479ON12672011932e-14
NCAS0A055706.371ON9182881922e-14
TBLA0A074601.24ON5161881903e-14
Kwal_47.183075.591ON6212471913e-14
KLLA0F13552g2.479ON12673071923e-14
Smik_11.1392.479ON15342081923e-14
SAKL0G01848g5.406ON8851941913e-14
NDAI0A006601.52ON10222361913e-14
SAKL0H16632g8.279ON10622161913e-14
TBLA0C046008.279ON13152001913e-14
Kwal_33.131121.24ON5052971894e-14
KAFR0D032002.479ON14481941914e-14
KNAG0J016708.668ON10091991914e-14
TDEL0D053203.92ON10573021904e-14
SAKL0H07128g8.652ON4862531884e-14
KNAG0D002106.371ON8332031904e-14
KLLA0B13607g2.496ON9892711904e-14
KAFR0C014403.92ON10952581904e-14
Skud_8.1635.406ON10762031905e-14
Smik_6.3388.652ON5112321885e-14
Kpol_1065.36.222ON3762791865e-14
TDEL0H036407.86ON12371841905e-14
TBLA0A047207.86ON12621821905e-14
Kwal_26.71547.86ON12131761905e-14
CAGL0L11550g5.406ON10722041905e-14
Smik_14.3776.371ON8952901896e-14
AFR724C1.24ON4402791866e-14
TBLA0B038608.668ON9882121896e-14
CAGL0L03520g1.271ON14472851906e-14
TPHA0H026307.86ON13671831896e-14
Skud_1.447.86ON13561751896e-14
SAKL0C00946g1.24ON5642511877e-14
Skud_14.3796.371ON8972901887e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G03810
         (661 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...  1335   0.0  
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    560   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   530   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   537   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   535   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   534   e-180
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   531   e-179
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   529   e-178
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   512   e-173
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   513   e-172
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   505   e-171
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   510   e-171
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   510   e-171
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   502   e-170
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   504   e-169
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   501   e-169
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   500   e-169
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   497   e-168
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   499   e-167
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   498   e-167
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   496   e-166
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   493   e-165
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   491   e-165
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   485   e-164
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   488   e-164
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   486   e-163
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   486   e-162
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   452   e-151
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   454   e-150
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   453   e-143
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   433   e-141
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   404   e-131
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   315   7e-96
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   320   7e-96
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   313   4e-95
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   313   1e-94
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   312   3e-94
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   314   1e-93
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   308   2e-91
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   308   3e-91
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   308   3e-91
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   307   4e-91
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   305   9e-91
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   305   2e-90
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   305   2e-90
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   301   2e-90
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   303   1e-89
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   299   1e-89
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   303   2e-89
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   299   3e-89
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   295   9e-89
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   297   2e-88
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   300   3e-88
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   296   7e-88
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   297   8e-88
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   295   2e-87
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   288   2e-86
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   294   2e-85
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    99   1e-21
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    97   8e-21
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    96   8e-21
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    98   1e-20
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    93   1e-19
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    96   1e-19
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    95   2e-19
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    92   3e-19
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    91   6e-19
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    93   7e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             92   1e-18
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    90   1e-18
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    92   2e-18
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    89   3e-18
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    89   5e-18
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    87   7e-18
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    89   1e-17
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    89   2e-17
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    89   2e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    88   2e-17
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    88   3e-17
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    88   3e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    87   4e-17
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    87   5e-17
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    87   6e-17
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    87   6e-17
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    87   7e-17
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    86   9e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    86   1e-16
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    86   1e-16
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    86   1e-16
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    85   1e-16
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    86   2e-16
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    86   2e-16
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    84   2e-16
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    86   2e-16
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    86   3e-16
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    85   3e-16
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    85   3e-16
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    85   3e-16
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    85   3e-16
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    85   4e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    84   4e-16
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    85   4e-16
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    84   4e-16
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    84   4e-16
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    84   4e-16
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    84   4e-16
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    84   5e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    83   5e-16
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    84   5e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    84   5e-16
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    84   5e-16
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    84   5e-16
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    84   6e-16
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    84   6e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    84   7e-16
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    84   7e-16
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    84   7e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    84   7e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    83   8e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    82   9e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    82   1e-15
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    83   1e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    83   1e-15
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    81   1e-15
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    83   1e-15
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    83   1e-15
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    83   1e-15
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    83   1e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    82   1e-15
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    83   1e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    82   1e-15
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    82   1e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    83   1e-15
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    83   1e-15
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    83   1e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    82   1e-15
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    83   1e-15
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    82   1e-15
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    83   2e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    82   2e-15
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    82   2e-15
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    82   2e-15
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    82   2e-15
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    82   2e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    82   2e-15
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    82   2e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    81   2e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    81   2e-15
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    82   2e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    81   2e-15
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    82   2e-15
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    80   2e-15
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    81   3e-15
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    82   3e-15
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    82   3e-15
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    82   3e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    82   3e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    81   3e-15
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     82   3e-15
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    81   3e-15
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    81   3e-15
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    81   3e-15
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    82   3e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    80   3e-15
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    81   4e-15
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    81   4e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    81   4e-15
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      81   4e-15
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    81   4e-15
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    81   5e-15
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    81   5e-15
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    80   5e-15
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    80   5e-15
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     81   5e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    81   5e-15
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    81   5e-15
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     81   5e-15
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    81   6e-15
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    81   6e-15
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    80   7e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    79   7e-15
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    80   7e-15
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    80   7e-15
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    80   7e-15
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    80   8e-15
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    80   8e-15
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    80   8e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    80   9e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    80   9e-15
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    80   9e-15
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    80   9e-15
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    80   9e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    80   9e-15
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    80   9e-15
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    80   1e-14
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    80   1e-14
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    80   1e-14
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    80   1e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    79   1e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    80   1e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    80   1e-14
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    80   1e-14
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    80   1e-14
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    80   1e-14
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    80   1e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    80   1e-14
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    79   1e-14
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    79   2e-14
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    79   2e-14
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        79   2e-14
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    79   2e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    79   2e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    79   2e-14
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    79   2e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    79   2e-14
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    78   2e-14
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    79   2e-14
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    79   2e-14
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    79   2e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    78   3e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    78   3e-14
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    79   3e-14
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    79   3e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    78   3e-14
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     78   3e-14
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    78   3e-14
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    78   3e-14
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    77   4e-14
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    78   4e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    78   4e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    78   4e-14
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    77   4e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    78   4e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    78   4e-14
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    78   4e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    78   5e-14
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    77   5e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    76   5e-14
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    78   5e-14
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    78   5e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    78   5e-14
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    78   5e-14
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    77   6e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    76   6e-14
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    77   6e-14
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    78   6e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    77   6e-14
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    77   6e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    77   7e-14
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    77   7e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    77   8e-14
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    77   8e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    77   8e-14
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    77   8e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    77   8e-14
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    77   8e-14
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    77   9e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   9e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    77   1e-13
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    76   1e-13
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    77   1e-13
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    77   1e-13
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    77   1e-13
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    77   1e-13
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    77   1e-13
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    76   1e-13
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    76   1e-13
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    76   1e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    77   1e-13
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    76   1e-13
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    76   1e-13
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    77   1e-13
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    76   1e-13
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              77   1e-13
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    75   1e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    76   1e-13
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    77   1e-13
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    77   1e-13
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     76   1e-13
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    76   1e-13
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    76   1e-13
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    76   1e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    76   1e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    76   2e-13
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    76   2e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    76   2e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    76   2e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    76   2e-13
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    76   2e-13
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    76   2e-13
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    76   2e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    76   2e-13
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    75   2e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    75   2e-13
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    76   2e-13
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    75   2e-13
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    75   3e-13
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    75   3e-13
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    75   3e-13
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    75   3e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    75   3e-13
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     74   3e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    75   3e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    75   3e-13
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    75   3e-13
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    75   3e-13
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    74   3e-13
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    74   3e-13
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    74   3e-13
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    75   3e-13
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    74   4e-13
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    75   4e-13
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    75   4e-13
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    74   4e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    75   4e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    75   4e-13
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    75   4e-13
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    75   4e-13
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    75   5e-13
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    74   5e-13
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               74   5e-13
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    74   5e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    74   5e-13
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    74   5e-13
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    74   6e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    74   6e-13
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    73   6e-13
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    74   6e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    74   7e-13
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    74   7e-13
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    74   7e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    74   7e-13
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    74   7e-13
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    74   7e-13
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    73   7e-13
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    73   7e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       74   7e-13
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    74   7e-13
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    74   7e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    74   8e-13
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    74   8e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    72   8e-13
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    74   8e-13
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    74   8e-13
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    74   8e-13
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    74   8e-13
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    74   9e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    74   9e-13
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    73   9e-13
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    74   9e-13
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    73   1e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    74   1e-12
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    72   1e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    74   1e-12
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    74   1e-12
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    74   1e-12
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    73   1e-12
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    74   1e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     73   1e-12
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    73   1e-12
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    73   1e-12
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    73   1e-12
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    73   1e-12
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    72   1e-12
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    73   1e-12
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    73   1e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    71   1e-12
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              73   1e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    73   1e-12
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    73   2e-12
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    73   2e-12
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    73   2e-12
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    72   2e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    72   2e-12
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    72   2e-12
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    73   2e-12
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    73   2e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    72   2e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    73   2e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    73   2e-12
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    71   2e-12
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    73   2e-12
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    72   2e-12
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    72   2e-12
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    72   2e-12
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    72   2e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    72   3e-12
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    72   3e-12
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     70   3e-12
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               71   3e-12
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    72   3e-12
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     71   3e-12
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    72   3e-12
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    72   4e-12
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    72   4e-12
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    72   4e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    72   4e-12
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    71   4e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    72   4e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    70   4e-12
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    70   4e-12
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    72   4e-12
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    70   4e-12
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    72   4e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    71   5e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    71   5e-12
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    70   5e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    71   5e-12
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    71   5e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    71   5e-12
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    71   5e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    71   5e-12
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    70   5e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    71   6e-12
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      71   6e-12
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    70   6e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    71   6e-12
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    71   6e-12
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    70   6e-12
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    71   6e-12
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    70   6e-12
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    71   6e-12
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    71   6e-12
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    71   6e-12
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    71   7e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    71   7e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    71   7e-12
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    70   7e-12
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    71   7e-12
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    70   7e-12
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    70   8e-12
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    70   8e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    69   8e-12
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    70   8e-12
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    70   8e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    70   9e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    70   9e-12
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    70   1e-11
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    70   1e-11
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    69   1e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    70   1e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    70   1e-11
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    68   1e-11
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    70   1e-11
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    70   1e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    70   1e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    70   1e-11
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    70   1e-11
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    70   1e-11
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    69   1e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    69   1e-11
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    70   1e-11
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    70   1e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    69   1e-11
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    70   2e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    69   2e-11
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    69   2e-11
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    69   2e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    69   2e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     68   2e-11
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    69   2e-11
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    69   2e-11
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    69   2e-11
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    68   2e-11
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    69   2e-11
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    69   2e-11
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    68   2e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    69   2e-11
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    68   2e-11
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    68   2e-11
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    69   2e-11
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    69   2e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    69   3e-11
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    68   3e-11
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    69   3e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     69   3e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    69   3e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    69   3e-11
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    69   3e-11
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     67   3e-11
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    67   3e-11
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    68   4e-11
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    69   4e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    67   4e-11
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    69   4e-11
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    68   4e-11
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    69   4e-11
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    67   4e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    68   4e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    68   4e-11
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    68   5e-11
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    68   5e-11
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    68   5e-11
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    67   5e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    68   5e-11
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    68   5e-11
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    68   5e-11
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    68   5e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    67   5e-11
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    67   5e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    67   5e-11
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    67   5e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    68   5e-11
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    67   5e-11
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    68   6e-11
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    67   6e-11
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    67   6e-11
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    67   6e-11
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    67   6e-11
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    67   6e-11
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    68   6e-11
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    67   6e-11
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    67   6e-11
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    67   7e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    67   7e-11
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    66   7e-11
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    67   7e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    67   7e-11
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    67   7e-11
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    67   8e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    66   8e-11
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    66   8e-11
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    67   8e-11
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    67   8e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    67   8e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    67   9e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    66   9e-11
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    67   9e-11
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    67   9e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    67   9e-11
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    67   9e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    67   1e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    67   1e-10
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    67   1e-10
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    65   1e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               67   1e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    67   1e-10
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    67   1e-10
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    66   1e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    66   1e-10
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    66   1e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    67   1e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    67   1e-10
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    66   1e-10
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    65   1e-10
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    67   1e-10
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    66   1e-10
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    66   1e-10
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    66   1e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    66   1e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    65   2e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    66   2e-10
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               65   2e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    66   2e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    66   2e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    66   2e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    65   2e-10
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    66   2e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    66   2e-10
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    65   2e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    66   2e-10
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    65   2e-10
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    66   2e-10
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    66   3e-10
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    66   3e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    65   3e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    65   3e-10
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    65   3e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    65   3e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    65   3e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    65   3e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    65   3e-10
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    65   3e-10
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    65   3e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    65   3e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    65   3e-10
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    65   3e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    65   3e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    64   3e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    65   3e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    64   3e-10
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    65   3e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    65   3e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   3e-10
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    64   3e-10
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    65   3e-10
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    65   3e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    64   3e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    65   3e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   4e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    64   4e-10
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    65   4e-10
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    65   4e-10
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    64   4e-10
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    65   4e-10
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    65   4e-10
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    64   4e-10
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    65   4e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    64   4e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    64   4e-10
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    64   5e-10
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    64   5e-10
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    65   5e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    64   5e-10
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    64   5e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    64   5e-10
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    65   5e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     65   5e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    65   5e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    64   5e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    65   5e-10
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    65   5e-10
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    65   5e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    64   5e-10
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    64   5e-10
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    65   5e-10
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    64   5e-10
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    65   6e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    64   6e-10
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    65   6e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    65   6e-10
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    64   6e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    64   6e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    64   7e-10
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    64   7e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    64   7e-10
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              63   7e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    64   7e-10
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    64   7e-10
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    64   7e-10
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    64   7e-10
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    64   8e-10
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    64   8e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    63   8e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    64   8e-10
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    64   8e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    63   8e-10
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    64   8e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    63   8e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    63   8e-10
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    64   9e-10
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    64   9e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    64   9e-10
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    63   9e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    63   1e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    64   1e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    63   1e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    64   1e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    62   1e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    63   1e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    64   1e-09
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    64   1e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               63   1e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    64   1e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    64   1e-09
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    62   1e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    63   1e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    63   1e-09
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     64   1e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    63   1e-09
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    63   1e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    63   1e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               63   1e-09
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    62   1e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    62   1e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    62   1e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   2e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    63   2e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    63   2e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    62   2e-09
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    63   2e-09
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    63   2e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    63   2e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    63   2e-09
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    63   2e-09
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    62   2e-09
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    62   2e-09
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              62   2e-09
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    62   2e-09
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    62   2e-09
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    62   2e-09
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    63   2e-09
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    63   2e-09
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    63   2e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    62   2e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    62   2e-09
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    62   2e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     62   2e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    63   2e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   2e-09
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    62   2e-09
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    62   3e-09
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    61   3e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    62   3e-09
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    62   3e-09
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    62   3e-09
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    62   3e-09
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    62   3e-09
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    61   3e-09
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    62   3e-09
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    62   3e-09
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    62   3e-09
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    62   3e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    62   3e-09
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    62   3e-09
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    62   3e-09
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    62   3e-09
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    61   4e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    62   4e-09
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    62   4e-09
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    62   4e-09
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    62   4e-09
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    61   4e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    61   4e-09
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    62   4e-09
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    62   4e-09
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    61   4e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    61   4e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    62   4e-09
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    61   5e-09
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    62   5e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    61   5e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    61   5e-09
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    61   5e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    62   5e-09
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    61   5e-09
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    62   5e-09
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    61   5e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    62   5e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    61   6e-09
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    61   6e-09
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    61   6e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    61   6e-09
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              61   6e-09
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    61   6e-09
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     61   6e-09
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    61   6e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    61   6e-09
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    61   6e-09
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    61   7e-09
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    61   7e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    61   7e-09
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    61   7e-09
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    60   7e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    61   7e-09
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    58   8e-09
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    60   8e-09
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    60   8e-09
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    60   8e-09
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    59   8e-09
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    59   9e-09
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    60   9e-09
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    60   9e-09
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    61   9e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    60   9e-09
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    60   9e-09
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    60   9e-09
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    61   9e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    60   9e-09
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    61   1e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    61   1e-08
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    61   1e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    59   1e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    60   1e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    60   1e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              60   1e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    60   1e-08
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    60   1e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    60   1e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    60   1e-08
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    60   1e-08
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    60   1e-08
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    60   1e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    59   1e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   1e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    60   1e-08
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    59   1e-08
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    60   1e-08
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    60   1e-08
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    60   1e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    59   1e-08
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    60   1e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    60   1e-08
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    60   1e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    60   1e-08
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    59   2e-08
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    59   2e-08
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    59   2e-08
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    59   2e-08
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    60   2e-08
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    59   2e-08
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       59   2e-08
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    59   2e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    59   2e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              60   2e-08
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    60   2e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    60   2e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    60   2e-08
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    59   2e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     59   2e-08
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    60   2e-08
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    60   2e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    59   2e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    59   2e-08
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    58   2e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    59   2e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    59   2e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    59   2e-08
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    59   2e-08
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    58   2e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               59   2e-08
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    60   2e-08
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    59   2e-08
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    59   2e-08
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    59   2e-08
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    59   2e-08
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    59   2e-08
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    59   2e-08
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    58   2e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    59   2e-08
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    59   2e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    58   2e-08
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    59   2e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    59   2e-08
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    59   2e-08
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    58   2e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    58   3e-08
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    59   3e-08
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    59   3e-08
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    59   3e-08
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    59   3e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    59   3e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    59   3e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    59   3e-08
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    59   3e-08
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    59   3e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    59   3e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    59   3e-08
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    58   3e-08
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    59   3e-08
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    59   3e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    59   3e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    59   3e-08
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    58   3e-08
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    57   3e-08
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    58   3e-08
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    59   4e-08
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    58   4e-08
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    59   4e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    59   4e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    58   4e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    58   4e-08
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    58   4e-08
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    58   4e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    58   4e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    58   4e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    58   4e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    59   4e-08
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    59   4e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    58   4e-08
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    59   4e-08
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    59   4e-08
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    58   4e-08
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    57   4e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    57   4e-08
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    58   4e-08
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     57   5e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    58   5e-08
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    58   5e-08
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    58   5e-08
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    58   5e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    58   5e-08
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    58   5e-08
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    57   5e-08
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               58   5e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    58   5e-08
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    58   5e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    58   5e-08
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    58   5e-08
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    58   5e-08
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    58   5e-08
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    59   5e-08
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    58   5e-08
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    58   5e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    57   5e-08
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    58   5e-08
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       58   5e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    58   6e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    57   6e-08
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    58   6e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    57   6e-08
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    57   6e-08
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    56   6e-08
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              58   6e-08
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    58   6e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    57   6e-08
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    58   7e-08
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    58   7e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    58   7e-08
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     57   7e-08
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    57   7e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    58   7e-08
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    58   7e-08
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    58   7e-08
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    57   7e-08
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    57   8e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    57   8e-08
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    57   8e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    57   8e-08
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    57   8e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    57   8e-08
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    57   8e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    57   8e-08
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    57   8e-08
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    57   8e-08
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    57   9e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    57   9e-08
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    57   9e-08
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    57   9e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    57   9e-08
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    57   9e-08
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    58   9e-08
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    57   9e-08
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    56   9e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    57   9e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    57   9e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    57   1e-07
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    57   1e-07
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    57   1e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    56   1e-07
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    57   1e-07
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    57   1e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    57   1e-07
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    57   1e-07
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    57   1e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    57   1e-07
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    57   1e-07
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    57   1e-07
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    56   1e-07
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    57   1e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    57   1e-07
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    57   1e-07
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    57   1e-07
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    57   1e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    57   1e-07
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    57   1e-07
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    57   1e-07
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    57   1e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    57   1e-07
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    56   1e-07
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    57   1e-07
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    56   1e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    56   1e-07
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    57   1e-07
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    56   1e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    57   1e-07
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    57   1e-07
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    57   1e-07
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    56   1e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    55   1e-07
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    57   1e-07
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    57   1e-07
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    56   1e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    57   1e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    57   1e-07
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    57   1e-07
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    57   2e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    57   2e-07
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    55   2e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    55   2e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    57   2e-07
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    57   2e-07
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    55   2e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    56   2e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    57   2e-07
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    55   2e-07
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             57   2e-07
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    56   2e-07
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    55   2e-07
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    57   2e-07
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    56   2e-07
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    55   2e-07
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    56   2e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    56   2e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              56   2e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    55   2e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    55   2e-07
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    56   2e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    56   2e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    56   2e-07
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    56   2e-07
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    56   2e-07
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    55   2e-07
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    55   2e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    56   2e-07
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    56   2e-07
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    55   2e-07
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    55   2e-07
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              56   2e-07
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    56   2e-07
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    55   2e-07
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    56   2e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    56   2e-07
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    56   3e-07
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     55   3e-07
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    55   3e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    56   3e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    56   3e-07
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    55   3e-07
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    55   3e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    55   3e-07
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    55   3e-07
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    56   3e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    56   3e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    55   3e-07
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    55   3e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    55   3e-07
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    55   3e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    55   3e-07
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    54   3e-07
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    56   3e-07
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    55   3e-07
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    54   4e-07
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    55   4e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    55   4e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    54   4e-07
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    55   4e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    55   4e-07
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               55   4e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    55   4e-07
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    54   4e-07
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    55   4e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    54   4e-07
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    55   4e-07
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    55   4e-07
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    55   4e-07
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    55   4e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    55   4e-07
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    55   4e-07
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    54   4e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    55   5e-07
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    55   5e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    55   5e-07
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    54   5e-07
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    55   5e-07
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    54   5e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    55   5e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    55   5e-07
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    55   5e-07
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    55   5e-07
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    54   5e-07
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    55   5e-07
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    54   5e-07
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    55   5e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    55   5e-07
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    54   5e-07
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    55   6e-07
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    54   6e-07
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    55   6e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    55   6e-07
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    55   6e-07
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    55   6e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    54   6e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    54   6e-07
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    55   6e-07
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    55   6e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    55   6e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    55   6e-07
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     54   6e-07
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    54   7e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   7e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    55   7e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    54   7e-07
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    55   7e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    54   7e-07
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    54   7e-07
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    55   7e-07
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               55   7e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    54   7e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    54   7e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    54   8e-07
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    54   8e-07
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    54   8e-07
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    54   8e-07
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    54   8e-07
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    54   8e-07
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    54   8e-07
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    54   8e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    54   8e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    54   8e-07
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    54   9e-07
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    54   9e-07
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    54   9e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    54   9e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    54   9e-07
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    54   9e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    54   9e-07
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    54   9e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    54   9e-07
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    54   9e-07
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    54   9e-07
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    54   9e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    54   9e-07
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    54   9e-07
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    54   9e-07
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    54   9e-07
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    54   1e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    54   1e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    54   1e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    54   1e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    54   1e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    54   1e-06
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    54   1e-06
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    54   1e-06
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    54   1e-06
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      54   1e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    53   1e-06
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    53   1e-06
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    54   1e-06
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    54   1e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    54   1e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    53   1e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    53   1e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    53   1e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    53   1e-06
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    53   1e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    54   1e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    54   1e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    54   1e-06
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    53   1e-06
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    54   1e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    53   1e-06
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    53   1e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   1e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    53   1e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    54   1e-06
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    53   1e-06
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    53   1e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    53   1e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    53   2e-06
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    53   2e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    53   2e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    53   2e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    53   2e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    53   2e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    53   2e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    53   2e-06
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    53   2e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    53   2e-06
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    52   2e-06
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    53   2e-06
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    53   2e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    53   2e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    53   2e-06
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    53   2e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    53   2e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    53   2e-06
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    52   2e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    53   2e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    53   2e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    53   2e-06
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    53   2e-06
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    53   2e-06
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    52   2e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     53   2e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     53   2e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     53   2e-06
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    53   2e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    50   2e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    53   2e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    52   2e-06
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    53   2e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    52   2e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    53   2e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    53   2e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    53   2e-06
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    53   2e-06
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    52   2e-06
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    52   2e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    53   2e-06
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    53   2e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    53   2e-06
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    53   2e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    52   2e-06
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    53   2e-06
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    53   3e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    53   3e-06
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    53   3e-06
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    52   3e-06
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    53   3e-06
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    52   3e-06
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    53   3e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    52   3e-06
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    52   3e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    53   3e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    52   3e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    52   3e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               52   3e-06
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    52   3e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    52   3e-06
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    52   3e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    52   3e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    52   3e-06
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    52   3e-06
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    52   3e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    52   3e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    53   3e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    52   3e-06
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    52   3e-06
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    52   3e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    52   3e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   3e-06
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    52   3e-06
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    52   3e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    52   3e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    52   3e-06
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    52   3e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   4e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    52   4e-06
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               52   4e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   4e-06
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    52   4e-06
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    52   4e-06
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    52   4e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    52   4e-06
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    52   4e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    52   4e-06
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    52   4e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    52   4e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    52   4e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    52   4e-06
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    51   4e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   4e-06
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    52   4e-06
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    52   4e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    52   4e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    52   4e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    52   4e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    52   4e-06
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    52   4e-06
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    51   4e-06
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    52   4e-06
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    52   5e-06
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    52   5e-06
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    51   5e-06
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    52   5e-06
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    52   5e-06
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    52   5e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    51   5e-06
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    52   5e-06
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    52   5e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    52   5e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     52   5e-06
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    51   5e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    52   5e-06
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    51   5e-06
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    51   6e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    51   6e-06
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    51   6e-06
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    50   6e-06
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    51   6e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    51   6e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    52   6e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    51   6e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    51   6e-06
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    51   6e-06
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    51   6e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    51   7e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    51   7e-06
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               51   7e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    51   7e-06
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    51   7e-06
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    51   7e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    52   7e-06
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    51   7e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    51   7e-06
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    51   7e-06
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    51   7e-06
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    51   7e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    50   7e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    51   7e-06
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    51   7e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    51   7e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    51   8e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    51   8e-06
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    51   8e-06
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    51   8e-06
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    51   8e-06
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    50   8e-06
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    50   8e-06
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    51   8e-06
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    51   8e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    51   8e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    51   8e-06
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    51   8e-06
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    51   8e-06
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               51   8e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    51   8e-06
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    51   8e-06
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    50   8e-06
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    50   9e-06
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    51   9e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    51   9e-06
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    50   9e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    50   1e-05
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    51   1e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    51   1e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    50   1e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    51   1e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    51   1e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    50   1e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    50   1e-05
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    50   1e-05
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    50   1e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    50   1e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    50   1e-05
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    50   1e-05
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    50   1e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    50   1e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    51   1e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    50   1e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    49   1e-05
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    50   1e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    50   1e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   1e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    50   1e-05
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    50   1e-05
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    50   1e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    50   1e-05
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    50   2e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    50   2e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    50   2e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    50   2e-05
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    50   2e-05
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    50   2e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    50   2e-05
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    50   2e-05
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    49   2e-05
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    50   2e-05
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    50   2e-05
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    50   2e-05
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    50   2e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    49   2e-05
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    50   2e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    50   2e-05
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    50   2e-05
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    50   2e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    49   2e-05
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    50   2e-05
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    50   2e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    50   2e-05
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    50   2e-05
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       50   2e-05
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    50   2e-05
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    49   2e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    49   2e-05
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    49   2e-05
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    49   2e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    50   2e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    49   2e-05
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    49   2e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    49   2e-05
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    49   2e-05
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    49   2e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    50   2e-05
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    49   2e-05
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    49   2e-05
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    49   2e-05
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    50   2e-05
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    49   2e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    50   2e-05
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    49   2e-05
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    49   2e-05
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    49   2e-05
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    49   2e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    50   2e-05
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    50   2e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    49   2e-05
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    49   2e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    49   3e-05
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    49   3e-05
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    49   3e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    49   3e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    49   3e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    49   3e-05
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    49   3e-05
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    49   3e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    49   3e-05
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    49   3e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    50   3e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    49   3e-05
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    49   3e-05
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    49   3e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    49   3e-05
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    49   3e-05
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    49   3e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    49   3e-05
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    49   3e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    49   3e-05
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    49   3e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    49   3e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    49   3e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    49   3e-05
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    49   3e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    49   3e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    49   3e-05
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    48   4e-05
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    49   4e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    49   4e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    49   4e-05
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    48   4e-05
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    49   4e-05
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    49   4e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    49   4e-05
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    49   4e-05
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    48   4e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   4e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    49   4e-05
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    49   4e-05
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    49   4e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    49   4e-05
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      49   4e-05
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    49   4e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    49   4e-05
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    49   4e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    48   4e-05
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               48   5e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    49   5e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    48   5e-05
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    49   5e-05
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      49   5e-05
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    49   5e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    49   5e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    48   5e-05
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    49   5e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    49   6e-05
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    49   6e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    48   6e-05
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    48   6e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    48   6e-05
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    48   6e-05
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    48   6e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    48   6e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    49   6e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    48   6e-05
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    47   6e-05
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    48   6e-05
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    48   6e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    49   6e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    48   6e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    48   6e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    48   7e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    48   7e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    48   7e-05
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    47   7e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    48   7e-05
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    47   7e-05
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    47   8e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    47   8e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    48   8e-05
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    48   8e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    47   8e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    47   8e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    47   8e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    47   8e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    48   8e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    48   8e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    48   8e-05
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    48   8e-05
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    48   8e-05
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    47   8e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    48   8e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    48   8e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    48   9e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    48   9e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    47   9e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    47   1e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    48   1e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    47   1e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    47   1e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    47   1e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     47   1e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    47   1e-04
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    47   1e-04
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    47   1e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    47   1e-04
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    47   1e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   1e-04
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    47   1e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    47   1e-04
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    47   1e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    47   1e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    46   1e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    47   1e-04
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    47   1e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    46   1e-04
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    47   1e-04
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    47   1e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    47   1e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    47   1e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    46   1e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    47   2e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    47   2e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    47   2e-04
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    47   2e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    47   2e-04
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    47   2e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    47   2e-04
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    47   2e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    47   2e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    47   2e-04
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    47   2e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    46   2e-04
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    46   2e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    47   2e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    46   2e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    46   2e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    46   2e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    45   2e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    45   2e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    46   2e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    46   2e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    46   2e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    45   2e-04
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    46   2e-04
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    46   2e-04
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    45   2e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    46   2e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    46   2e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    46   2e-04
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    46   3e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    46   3e-04
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    46   3e-04
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    46   3e-04
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    46   3e-04
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    46   3e-04
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    46   3e-04
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    46   3e-04
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    46   3e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    46   3e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    46   3e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    46   3e-04
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    45   3e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    46   3e-04
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    46   3e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    46   4e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    45   4e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    45   4e-04
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    45   4e-04
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    45   4e-04
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    46   4e-04
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    45   4e-04
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    45   4e-04
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    45   5e-04
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    45   5e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     45   5e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    45   5e-04
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    45   5e-04
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    45   5e-04
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    45   5e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    45   5e-04
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    44   5e-04
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    45   6e-04
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    45   6e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    45   6e-04
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    45   6e-04
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    45   6e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    45   7e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    45   7e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    45   7e-04
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    45   7e-04
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    44   7e-04
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    44   8e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    45   8e-04
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    45   8e-04
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    45   8e-04
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    44   8e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    44   8e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    44   8e-04
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    44   8e-04
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    44   9e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    45   0.001
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    44   0.001
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    44   0.001
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    44   0.001
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    44   0.001
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    44   0.001
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    44   0.001
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    44   0.001
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    44   0.001
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    44   0.001
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    44   0.001
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    44   0.001
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    44   0.001
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    44   0.001
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    44   0.001
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    44   0.001
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    44   0.001
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    44   0.001
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    44   0.001
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    43   0.001
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    44   0.001
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      44   0.001
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    44   0.001
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    44   0.001
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    44   0.002
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    43   0.002
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    43   0.002
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    43   0.002
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    43   0.002
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    43   0.002
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               43   0.002
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    43   0.002
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    43   0.002
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    43   0.002
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    43   0.002
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    43   0.002
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    43   0.002
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    43   0.003
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    43   0.003
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    43   0.003
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    43   0.003
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    43   0.003
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    42   0.003
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    43   0.003
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    42   0.003
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    43   0.003
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 42   0.003
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    42   0.004
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    42   0.004
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    42   0.004
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    42   0.004
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    42   0.004
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.004
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    42   0.004
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    42   0.004
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    42   0.005
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    42   0.005
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    42   0.005
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    42   0.005
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    42   0.005
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    42   0.005
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    42   0.005
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    42   0.006
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    42   0.006
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    42   0.006
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    42   0.006
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    42   0.007
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    41   0.007
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    41   0.007
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    42   0.007
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    42   0.007
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    42   0.007
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    42   0.007
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    41   0.008
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    41   0.008
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    41   0.008
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    41   0.008
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    41   0.009
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    41   0.009
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    41   0.010
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    41   0.010
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    41   0.011
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    41   0.011
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    41   0.011
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    41   0.011
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    41   0.012
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    40   0.012
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    41   0.012
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    40   0.013
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    40   0.014
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    41   0.014
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    40   0.015
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    40   0.015
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    40   0.015
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    40   0.016
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    40   0.016
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    40   0.017
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    40   0.017
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    40   0.018
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      40   0.020
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    40   0.022
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    40   0.022
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    40   0.023
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    40   0.023
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    40   0.024
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    39   0.024
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    39   0.025
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    40   0.025
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    40   0.026
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    40   0.027
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.027
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    40   0.028
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    39   0.028
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    39   0.028
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    40   0.030
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    40   0.030
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    39   0.030
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    39   0.033
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    39   0.033
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    39   0.033
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    39   0.034
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    39   0.035
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    39   0.036
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               39   0.036
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    39   0.037
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    39   0.041
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    39   0.042
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    39   0.043
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    39   0.044
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    39   0.044
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    39   0.045
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    39   0.046
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    39   0.048
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    39   0.048
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    39   0.049
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    39   0.049
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    38   0.054
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    38   0.062
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    39   0.062
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    39   0.067
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    39   0.067
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    38   0.067
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    39   0.071
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    38   0.072
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    38   0.080
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    38   0.080
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    38   0.086
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    38   0.10 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    37   0.10 
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    37   0.11 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    38   0.12 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    37   0.13 
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    37   0.14 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    37   0.16 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    37   0.17 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    37   0.18 
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    37   0.18 
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    37   0.20 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    37   0.21 
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    37   0.21 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    37   0.22 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    36   0.22 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    37   0.22 
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    37   0.24 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    36   0.25 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    36   0.26 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    37   0.26 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    36   0.29 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    36   0.29 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    36   0.33 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    36   0.35 
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    36   0.37 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    36   0.39 
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    36   0.40 
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    36   0.43 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    35   0.45 
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    35   0.48 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    35   0.50 
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    35   0.51 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    35   0.53 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    35   0.62 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    35   0.64 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.64 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    35   0.64 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    35   0.79 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    35   0.82 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    34   0.89 
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    35   0.90 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    34   0.93 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    34   0.96 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    35   1.0  
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    34   1.1  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.1  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    35   1.1  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    34   1.4  
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               33   1.5  
Skud_2.300 Chr2 complement(546556..548811) [2256 bp, 751 aa] {ON...    34   1.6  
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    34   1.6  
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    33   1.8  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    34   1.9  
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    33   1.9  
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    33   2.0  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    33   2.1  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    33   2.3  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    33   2.5  
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             33   2.5  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    33   2.6  
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    33   3.2  
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    33   3.2  
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    33   3.2  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    32   4.8  
KAFR0K00340 Chr11 complement(75394..76536) [1143 bp, 380 aa] {ON...    31   8.1  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    32   8.5  
Kpol_1036.100 s1036 (259603..261150,261154..262107) [2502 bp, 83...    32   8.7  

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score = 1335 bits (3455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/661 (98%), Positives = 648/661 (98%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360
           NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND
Sbjct: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360

Query: 361 IQMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQPVQKSQTLPVSSIPTNLQNTNKSSP 420
           IQMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQPVQKSQTLPVSSIPTNLQNTNKSSP
Sbjct: 361 IQMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQPVQKSQTLPVSSIPTNLQNTNKSSP 420

Query: 421 FNLKSTTTYVDSETQTETPKQTLNKAISSNTEGFSLINEKNPNSVPMLXXXXXXXXXXXX 480
           FNLKSTTTYVDSETQTETPKQTLNKAISSNTEGFSLINEKNPNSVPML            
Sbjct: 421 FNLKSTTTYVDSETQTETPKQTLNKAISSNTEGFSLINEKNPNSVPMLSPSFSTSSSSSS 480

Query: 481 XDENDSVDLRNKAYSPIRTPLKSQLQDNDERIKKVIQVAKEGLSRSRTSLESEPTFKKEK 540
            DENDSVDLRNKAYSPIRTPLKSQLQDNDERIKKVIQVAKEGLSRSRTSLESEPTFKKEK
Sbjct: 481 SDENDSVDLRNKAYSPIRTPLKSQLQDNDERIKKVIQVAKEGLSRSRTSLESEPTFKKEK 540

Query: 541 KNKVYNATLEKAKKHRSLPVMETTIKPDSTKPIASKSEISFAEPAVKSNSKSNEETKILI 600
           KNKVYNATLEKAKKHRSLPVMETTIKPDSTKPIASKSEISFAEPAVKSNSKSNEETKILI
Sbjct: 541 KNKVYNATLEKAKKHRSLPVMETTIKPDSTKPIASKSEISFAEPAVKSNSKSNEETKILI 600

Query: 601 KQKMLEKLNASQNQFKKKSIPDGDSIHKNDQTPKPKVPSKPAHLRPKVPKKPAFLSSQKI 660
           KQKMLEKLNASQNQFKKKSIPDGDSIHKNDQTPKPKVPSKPAHLRPKVPKKPAFLSSQKI
Sbjct: 601 KQKMLEKLNASQNQFKKKSIPDGDSIHKNDQTPKPKVPSKPAHLRPKVPKKPAFLSSQKI 660

Query: 661 K 661
           K
Sbjct: 661 K 661

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/432 (64%), Positives = 326/432 (75%), Gaps = 19/432 (4%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQPQ+ +Y PGTLL+VGSH+ +++KYLTSGGFAQ+YT +ISP D F N+++ CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD MKLLRNN HVVSYIDSHAAKF+ N GSYEVFLLMEYCD GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E+EIL+IMSQV+QG+AAMHAL PPLLHRDIKIENVLLTS+G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCGIIRPP+N QE +YVQHDIMKNTTAQYR+PEMI+L +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AILHA+FQFPN+P YSDR+K LI   L  QPSQRPN YQ+LEEVS +Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360
           NV CPIP+FYL                  N  + + P   P + NNN  YN   +++   
Sbjct: 301 NVPCPIPDFYLQRKLAQAQAQTQAQDVVMNVPIPSYPVAIPAITNNNGSYNYNMSIASAT 360

Query: 361 IQMMNAIN-------LKVNSTHNTGMIPPTMATNMARTIPMQP----------VQKSQTL 403
           I   NA N         V S + TG++    A  +   +P+QP          +QKSQT+
Sbjct: 361 INPQNANNNNTNNNPYTVASNNVTGILQSINAPLL--NVPLQPNRPISSQKKHIQKSQTM 418

Query: 404 PVSSIPTNLQNT 415
           P+ S+  NL+ +
Sbjct: 419 PMPSMDANLKKS 430

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/330 (74%), Positives = 279/330 (84%), Gaps = 1/330 (0%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP+I  Y PGT+L VGSH+V+++KY+TSGGFAQIYTV+ISPPD F ++N+ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD MKLLRNN HVVSYIDSHA+K N N GSYEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E E+L+I SQV QGIAAMHAL PPLLHRDIKIENVL++   +YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V GIIRPP N QE+ YVQHD++KNTTAQYR+PEMID YRGLPIDEKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKN-GEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSM 299
           YYTTPFEKN GEAAIL A +++PN+P YS+RLK LI  MLME P QRPN YQV+EE+S M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QNVQCPIPNFYLMNNNVTQGQMAMQTQPQN 329
           QNV CPI NFYL+        + +Q  P N
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVN 330

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/312 (78%), Positives = 269/312 (86%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP+IP Y PGT+LTVGSH  +V+ YLTSGGFAQ+Y+ +I P D F ++NVACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD MKLLRNN HVVSYIDSHAAK +   GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E EILNIMSQVTQGIAAMHAL PPL+HRDIKIENVL++  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP N QE +YVQHD++KNTTAQYR+PEMIDLYRG PIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AILH+ FQFP  P YSDRLK LI  MLME P QRPN  QVLE+VS MQ
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NVQCPIPNFYLM 312
            +QCP+ NFYL+
Sbjct: 301 GIQCPVRNFYLL 312

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 22/111 (19%)

Query: 567 PDSTKPIASKSEISFAEPAVKSNSKSNEETKILIKQKMLEKLNASQNQFKKKSIPDGD-- 624
           P   + +  +SEI     +V+S      E K  I++++ + LN+S++    KS P  D  
Sbjct: 524 PTGRQSLRQESEIEIPLTSVRSR-----EAKESIQRRVRDLLNSSEDLPLSKSEPKKDEP 578

Query: 625 -----SIHKNDQTP----------KPKVPSKPAHLRPKVPKKPAFLSSQKI 660
                S   +D+ P          +P+ P KPAHLRPK P KPAFLS +K+
Sbjct: 579 KRGQLSKTHHDEKPSVKEKSKQKVRPRAPPKPAHLRPKPPPKPAFLSGKKM 629

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/497 (57%), Positives = 336/497 (67%), Gaps = 46/497 (9%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MN PQI LY+PGT+LTVGSH  +++KYLTSGGFAQ+Y+ +ISPPD +++ N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK  LNTLRAEVD MKLL+NN HVVSYIDSHAAK + N  +YEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRL+ RL+E EIL+IM Q  QGIAAMHAL PPL+HRDIKIENVL++ +G YKVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP N QE +YVQHDI+ NTTAQYR+PEMIDLYRGLPIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GEAAILHA +Q+P++PQYSDRLK LI  MLME PSQRPN  QVLEEVS +Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVQCPIPNFYL---MNNNVTQGQMAMQ---------TQPQNNGAMMASPNMQPY-----V 343
           N  CPI NFYL   MN N   G  +             PQ+   + A PN+ P       
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLSNIKTT 359

Query: 344 PN----NNFVYNTPNAVSMNDIQ---MMNAINLKVNSTHNTGMIPPTMATNMARTIPMQP 396
           PN    +NFV N     +M  ++   +    N  +  T  T  +P +          + P
Sbjct: 360 PNLDSASNFVNNNNKMEAMLQLRTQKLETGPNFSIPLT-KTKSVPLSDDFTSLYYKELHP 418

Query: 397 VQKSQT--------------LPVSSIPTNLQNTNKSSPFNLKSTTTYVDSETQTETPKQT 442
            QK  T              +P S  P N  N ++ S  N      YVDSETQT     T
Sbjct: 419 FQKPHTFKSVEGSQSPQRKSIPFSPTPVNSNNYDRVSTIN--RPNNYVDSETQTLDSIAT 476

Query: 443 L----NKAISSNTEGFS 455
           L    +  IS+ T GFS
Sbjct: 477 LKLKPSPTISNKTTGFS 493

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  534 bits (1375), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 280/493 (56%), Positives = 326/493 (66%), Gaps = 78/493 (15%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MN PQI LY+PGT+LTVGSH  +++KYLTSGGFAQ+YT +ISPPD ++N N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           P K  LNTLRAEVD MKLLRNN HVVSYIDSHAA+ + N  +YEVF+LME+C+ GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAAR-SVNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E EIL IMSQ  QGI AMHAL PPL+HRDIKIENVL++  G YKVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP N QE +YVQHDI+ NTTAQYR+PEMIDLYRGLPIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK+GEA ILHA +Q+P++PQYSDRLK LI  MLME PSQRPN  QVLEEVS +Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVQCPIPNFYL---MNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNF--------- 348
           N  CPI NFYL   MN N              N  +   P+   YVP   F         
Sbjct: 300 NKPCPIRNFYLLRAMNQNA-------------NTQLAGEPSSTTYVPTQKFIPVQSLQSI 346

Query: 349 -----------VYNTPNA----VSMND---IQMMNAINLKVNSTHNTGMIPPTMATNMAR 390
                      V  TPN     +S+ND    ++     L+V S  N  +  P M T   +
Sbjct: 347 NQPPNMMPVTHVSTTPNLGTFPISINDNNKTEVTAHAGLQVGSHSN--LTSPLMKT---K 401

Query: 391 TIP------------MQPVQKSQTL---------------PVSSIPTNLQNTNKSSPFNL 423
           ++P            + P QKSQT                P+S  P N    ++ S  N 
Sbjct: 402 SVPLSDEFASLYYKELHPFQKSQTFKSVESFQSPQRKSMPPLSLTPVNNDIFDRVSAIN- 460

Query: 424 KSTTTYVDSETQT 436
                YVDSETQT
Sbjct: 461 -RPNNYVDSETQT 472

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  531 bits (1368), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 273/479 (56%), Positives = 327/479 (68%), Gaps = 50/479 (10%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MN PQI LY PGT+LTVGSH  +++KYLTSGGFAQ+YT +ISPPD ++N N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK  LNTLRAEVD MKLL+NN HVVSYIDSHAAK + N  +YEVF+LME+C+ GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RLRE EIL IMSQ  QGIAAMH L PPL+HRDIKIENVL++  G YKVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP N+QE +YVQHDI+ NTTAQYR+PEMIDLYR  PIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK+GEAAILH+ +Q+P++PQYSDRLK LI  MLME PSQRPN  QVLEEVS +Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 NVQCPIPNFYLMNNNVTQGQM-----------AMQTQPQNNGAMMASPNMQPYVPNNNFV 349
           N  CPI NFYL+       Q+           A Q  P     +    ++Q  VP  + V
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQ--TLQGIKHLQSMVPVTH-V 356

Query: 350 YNTPNAVSM-----NDIQMMNAINLKVNSTHNTGMIPPTMATNMARTIP----------- 393
             TPN  ++     N+ Q  + + ++     +  +  P M T   +++P           
Sbjct: 357 RTTPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKT---KSVPLSDDFASLYYR 413

Query: 394 -MQPVQKSQTL---------------PVSSIPTNLQNTNKSSPFNLKSTTTYVDSETQT 436
            + P QKSQT                P SS P N +N +++S   +     YVDS TQT
Sbjct: 414 ELHPFQKSQTFKSVESFQSPQRKLSTPSSSSPVNSKNNDRASTSTVDRPNNYVDSVTQT 472

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  529 bits (1363), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 315/419 (75%), Gaps = 28/419 (6%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MN PQI LY+PGT+LTVGSH  +++KYLTSGGFAQ+YT +ISPPD +TN N+ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK  LNTLRAEVD MKLL+NN HVVSYIDSHAAK + N  +YEVF+LME+C+ GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RLRE EIL IMSQ  QGIAAMHAL PPL+HRDIKIENVL++  G YKVCDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP N QE +YVQHDI+ NTTAQYR+PEMIDLYRGLPIDEKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK+GEA ILHA +Q+P +PQYSDRLK LI  MLME PS+RPN  QVLEEVS +Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360
              CPI NFYL+       Q+A  ++P         P+M+ YVP   F+       SM  
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLA--SEP---------PSMK-YVPTQKFL-PAQGLQSMKP 346

Query: 361 IQMMNAINLKVNSTHNTGMIPPTM----ATNMARTIPMQ---------PVQKSQTLPVS 406
           I  M  ++  V +T N   +P ++     T++ + I +Q         P++K++++P+S
Sbjct: 347 ISNMIPVS-HVRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLS 404

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  512 bits (1318), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 262/450 (58%), Positives = 314/450 (69%), Gaps = 28/450 (6%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP IP Y PGTLLTVGSH  +++KYLTSGGFAQIYT +ISP + + N+  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK  LNTLRAEVD MKLL+NN HVVSYIDSHAA+     G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E EILNI+SQ  QG++AMHAL P L+HRDIKIENVL+++KGE+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VC  IRPP N QE++YVQHD++KNTTAQYRAPEM+DLYRGLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GEAAILH+ +Q+P +P Y+D+LK LI   LME PS+RPN  Q+LEE+S +Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NVQCPIPNFYLMNN-NVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMN 359
            + CPI NFYL    NV    M     P    A+  S   Q     ++  Y  P A S +
Sbjct: 301 GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHS---QSSATISDQSYAVPLASSRS 357

Query: 360 DIQMMNAINLKVNSTHNTGMIPPTMATNMARTIP-----MQPVQKSQTL--------PVS 406
                        +T N  ++  T   +M++        + P QKSQTL        P+ 
Sbjct: 358 S-----------TTTGNKPILIETEIPDMSQGSDDVYSRIHPFQKSQTLRTPSRSSSPIK 406

Query: 407 SIPTNLQNTNKSSPFNLKSTTTYVDSETQT 436
              T LQ +  S+     + + YVDSETQT
Sbjct: 407 YTGTLLQKSTSSNSNTSGNKSHYVDSETQT 436

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  513 bits (1322), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/314 (74%), Positives = 264/314 (84%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP   +Y  GT LTVGSH+ +++KYLTSGGFA IY+ +ISP D  +  NVACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK SLN LRAEVD MKLLR N HVVSYIDSHAAK    +GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E+E+L IMS +TQGIAAMHAL PPL+HRDIKIENVL++    +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP NAQE SYVQ+DI+KNTTAQYR+PEMIDLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK G+AAILH+ FQFP YPQYSDRLK LI+ ML E P+QRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NVQCPIPNFYLMNN 314
           NV CP+ NFYL+ +
Sbjct: 301 NVPCPLRNFYLLRS 314

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  505 bits (1300), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 233/360 (64%), Positives = 288/360 (80%), Gaps = 3/360 (0%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQPQI  Y  GT LTVGSH+V++VKYLTSGGFAQ+Y+  ISPPD  +++N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD M+LLRNN +VVSYIDSHAAK   + GSYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E EIL IMSQVTQG+AAMHAL PPL+HRDIKIENVL+++  EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP N QE+SYVQ DI KNTTAQYR+PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AIL   F+FP YP YS++L+ LI  +L++ P QRPN YQ+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NVQCPIPNFYL---MNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVS 357
           NV CPI +  +    ++++   ++   +  QN  ++ +   ++  +PN  F  + P+A +
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSHSTIERPIPNAAFQSSMPDAAT 360

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  510 bits (1313), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/406 (62%), Positives = 293/406 (72%), Gaps = 19/406 (4%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQ    +YQPGT LTVGSH+ +++KYLTSGGFA IYT +I P D  +   +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLN LRAEVD MKLLR N HVVSYIDSHAAK   ++GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E E+L I S +TQGIAAMHAL PPL+HRDIKIENVL++    +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP N QE +YVQHDI+KNTTAQYRAPEMIDLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GEAAILH+ FQFP+YPQYSD LK LI++ML E P+QRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360
              CP+ NFY+        Q     QP+      AS   QP + + N + N P  +S N 
Sbjct: 301 GTPCPLRNFYVTR---AMQQQQQHQQPKIKFDHSAS---QPKLDSANNIINVPFKMSHNQ 354

Query: 361 IQMMNAINLKVNSTHNTGMIPPTMATN----MARTIPMQPVQKSQT 402
                     + ST      P   A+N      + +P+QPV  S T
Sbjct: 355 ---------PLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFT 391

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  510 bits (1313), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 264/480 (55%), Positives = 321/480 (66%), Gaps = 55/480 (11%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           M+QP +  Y  GT+LTVGSHK +++KYLTSGGFA IY+ +ISPPD   ++++ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLN+LRAEVD MKLL+ +  VVSYIDSHAAK + N GSYEVFLLMEYC  GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E E+L IMSQV+QG+AAMHAL PPL+HRDIKIENVL++  G +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP N QE++YVQHDI+KNTTAQYR+PEMIDLYRGLP+DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AILH+ FQFP YPQYSD+LK LI+ +L E P QRPN  Q+L EVS +Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NVQCPIPNFYL------------------MNNNVTQGQM-------AMQTQPQN------ 329
            V CP+ NFYL                  + ++V+Q QM        +Q  PQ       
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQ 359

Query: 330 ----NGAMMASPNMQ---------PYVPNNNFVYNTPNAVSMNDIQMMNAINLKVNSTHN 376
               N  + ASP  Q         P    N+   N   +  +     +    LK N    
Sbjct: 360 VSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYNKEQL 419

Query: 377 TGMIPPTMATNMARTIPMQPVQKSQTLPVSSIPTNLQNTNKSSPFNLKSTTTYVDSETQT 436
            G IP T              Q+    PV +   ++    KS+P ++   ++YVDSETQT
Sbjct: 420 NG-IPATTP---------YATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQT 469

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  502 bits (1292), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 294/633 (46%), Positives = 382/633 (60%), Gaps = 69/633 (10%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQPQI  Y  GT LTVGSH+V+++KYLTSGGFAQ+Y+V ISPPD  TNTNVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD M+LL+NN +VVSYIDSHAAK     GSYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E EIL I+SQVTQG+AAMHAL PPL+HRDIKIENVL+++  EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCGIIR P N+QE+SYVQ DI+KNTTAQYR+PEMID++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AIL   F+FP YP YS++LK LI  +L++ P  RP+ +Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NVQCPIPNFYLM---NNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVS 357
           NV CPI +   +   ++++   ++   +  QN  ++ +   M   +P   F ++TP    
Sbjct: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTP---- 356

Query: 358 MNDIQMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQPVQKSQTLPVSSIPTNLQNTNK 417
              + M  A  L +    N    P   + N A+         SQ        + L N   
Sbjct: 357 ---VNMATAQTLPIKEESNIFYDP--TSCNFAK--------DSQ--------SRLNNALS 395

Query: 418 SSPFNLKSTTTY--VDSETQTETPKQTLNKAISSNTEGFSLINEKN---PNSVPMLXXXX 472
            SPF L++ +    V  E  + T    L + I S    F   N  N   PN +P      
Sbjct: 396 RSPFELEAVSDLNNVKDEANSTT---RLKQTIVSEAHNFRQNNSLNLSLPNMIP------ 446

Query: 473 XXXXXXXXXDENDSVDLRNKAYSPIRTPLKSQLQDNDERIKKVIQVAKEGLSRSRTSLES 532
                      ND     +    P          D DE +KK   ++    +RS T    
Sbjct: 447 ----------HNDDSSSSSDESYP---------GDTDE-LKKTQSLSSYS-TRSNTK-RD 484

Query: 533 EPTFKKEKKNKVYNATLEKAKKHRSLPVMETTIKPDSTKPIAS--KSEISFAE---PAVK 587
           +P  +    + +  ++        +L    ++ KP ST  +     + +S ++   PA  
Sbjct: 485 QPVEEYLTSSSLPGSSFTAVHTKVNLDHKSSSFKPTSTNTVDGLKNNTLSLSKNNLPAYD 544

Query: 588 SNSKSNEETKILIKQKMLEKLNASQNQFKKKSI 620
               S ++ K  I+Q+MLEKLN+S+  F  + I
Sbjct: 545 YVGGSKQDLKNSIQQRMLEKLNSSEESFNARKI 577

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  504 bits (1299), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/326 (71%), Positives = 265/326 (81%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP IPLY  GTLLTVG+H+  + KYLTSGGFAQIY V+I+P D ++ +NVACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           P K  LNTLRAEVD MKLL+NN HVVSYIDS+A K   N GSYEV LLMEYC+ GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MN+RLQ RL E EILNI+SQ  QG+A MHAL P LLHRDIKIENVL +  GE+K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP N QE+SYVQHDI+KNTTAQYR PEM+DLYRGLPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AILH+ FQ+P +P YSDRLK LI  ML E P++RPN  ++LEE+SS+Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQ 326
            V CPI NFYL+       Q+ +Q Q
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQ 326

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 16/22 (72%)

Query: 635 PKVPSKPAHLRPKVPKKPAFLS 656
           P +P KP HLRPK P KP +LS
Sbjct: 696 PPLPFKPHHLRPKPPPKPTYLS 717

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  501 bits (1291), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 236/312 (75%), Positives = 257/312 (82%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP++     GT LTVG+H V+++KYLTSGGFAQIY V+I     F  +NVACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK SLN LRAEVD MKLL NN HVVSYIDSHA +   N+G+YEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E EIL+IMSQ TQGIA MHAL PPLLHRDIKIENVLL+  G YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP N QE+ YVQHDIMKNTTAQYR PEM+DLYRGLPIDEK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AILHA FQFP++P YSDRLK LI  ML E PS RPN  QVLEEVS MQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NVQCPIPNFYLM 312
           NV CPI NFYL+
Sbjct: 301 NVPCPIRNFYLL 312

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  500 bits (1287), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/306 (73%), Positives = 263/306 (85%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQPQI  Y  GT LTVGSH+V+++KYLTSGGFAQ+Y+  I+PPD  +N++VACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD M+LL+NN +VVSYIDSHAAK   + GSYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E EIL IMSQVTQG+AAMHAL PPL+HRDIKIENVL+++  EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCGIIRPP N+QE+SYVQ DI+KNTTAQYR+PEMID +RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK G+ AIL   F+FP YP YS++LK LI  +L++ P  RPN YQ+L+ +S MQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NVQCPI 306
           NV CPI
Sbjct: 301 NVPCPI 306

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  497 bits (1280), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 314/431 (72%), Gaps = 9/431 (2%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQPQI  Y  GT LTVGSH+V+++KYLTSGGFAQ+Y+  ISPPD  TN+NVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK SLNTLRAEVD MKLLRNN +VVSYIDSHAAK   + GSYEVF+LMEYC+ GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E EIL IM QVTQG+AAMHAL PPL+HRDIKIENVL+++K EYK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP N QE+SYV+ D++KNTTAQYR+PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AIL+  F+F  YP YS++L+ LI  +L++ PSQRPN +Q+L+++++MQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NVQCPIPNFYLM---NNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTP-NAV 356
           N   PI +   +   +N++   ++   +  QN  ++ +    +  + N NF +  P N +
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360

Query: 357 SMNDIQMMNAINLKVNSTHN--TGMIPPTMATNMARTIPM--QPVQKSQTLPVSSIPTNL 412
           +   +         +N+T +  TG  P    T +  T+ +  QP     T    +I +  
Sbjct: 361 TAQSLPTRENSQAFINATSSSLTGS-PSIFETGVCNTLNIFNQPNTNPTTKLKQAIDSEA 419

Query: 413 QNTNKSSPFNL 423
            +  KS P NL
Sbjct: 420 HSFRKSDPINL 430

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  499 bits (1286), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 248/385 (64%), Positives = 286/385 (74%), Gaps = 20/385 (5%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MN PQI  +  G +LTVGSH  +V+KYLTSGG+AQ+Y V+ISP D + N+N+ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD MKLL+NN HVVSYIDSHA+K     G+YEVF+LME+C+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MN+RLQ RL E EIL IMS  +QGIAAMH L P LLHRDIKIENVL++   EYKVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCGI+RPP N QE ++V HDIMKNTTAQYR+PEM+DL +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKN-GEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSM 299
           YYTTPFEKN GEAAIL A FQ+P+YP YSDRLK LI  ML + PS RPN  QVLEEVS +
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QNVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTP-NAVSM 358
           Q + CPI NFYL+         AM    +NN   +  P    Y+P      +T  N  S+
Sbjct: 301 QGIPCPIRNFYLLR--------AM----ENNKRTIEQPVQNVYMPTTLSQPSTQMNLASL 348

Query: 359 NDIQMMNAINLKVNSTHNTGMIPPT 383
           ND     A  LK N T     IPPT
Sbjct: 349 NDTLPTAA--LKFNQT----TIPPT 367

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  498 bits (1283), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 253/425 (59%), Positives = 301/425 (70%), Gaps = 19/425 (4%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQPQI  Y  GT+L VGSH+V+V+KYL SGGFA +Y+V+ISPPD     NVACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK SLNTLRAEVD+MK LR N  +VSYIDSHA K   N G YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E EILNIMSQV+QG+AAMHAL PPL+HRDIKIENVLL+   E+K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G+IR P N +E +YVQ+DIMKNTTAQYR PEMIDLYRGLPIDEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEKNGE+AIL + F+FP YP+YSDR+K LI+ ML   P +RPN  QV+EEVS +Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360
            + CPI NFYL+        M  Q QP+       SP   P+VP        P +VS   
Sbjct: 301 GIPCPIKNFYLLR------MMDKQEQPR------VSP--PPHVPQMTVPATVPTSVSTQH 346

Query: 361 IQMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQPVQK--SQTLPVS-SIPTNLQNTNK 417
           +      N++  S   T  I      +++++ PM   Q   SQ  P   ++P  + N   
Sbjct: 347 LPPQVVSNVQTPS--KTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTS 404

Query: 418 SSPFN 422
           S PF+
Sbjct: 405 SDPFS 409

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  496 bits (1276), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 267/475 (56%), Positives = 314/475 (66%), Gaps = 32/475 (6%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQ     +QPGT+LTVGSHKV+VVKYLTSGGFAQIY  ++  PD     +VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK SLNTLRAEVD MKLLR N H+VSYIDSHA+K   N GSYEV LLMEYC  GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ+RL+E E+L IM+QV QGI AMHAL PPL+HRDIKIENVL+   G+ KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP N  E+SYVQHDI+KNTTAQYRAPEMIDLYRG  +DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AIL A FQFP+YPQYS+RLK LIT ML E P  RPNS QVLEEV  +Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 NVQCPIPNFYL-----------MNNNVTQGQMAMQTQ--------PQNNGAMMASPNMQ- 340
              CP+ NFYL           + ++V+Q  +AM  Q        PQ   +++ S  M  
Sbjct: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNM 359

Query: 341 PYVPNNNFVYNTPNAVSMND---IQMMNAINLKVNSTHNTGMIPPTMATNMART----IP 393
            YV       + PN V  +    +     ++   +       +P +   + A      +P
Sbjct: 360 GYVTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSKASVESGHLP 419

Query: 394 MQ--PVQKSQTLPVSSIPTNLQNTNKSSPFNLKSTTTYVDSETQTETPKQTLNKA 446
               P  +S   PV S   N+     ++P N+K    YVDSE QT T   +L KA
Sbjct: 420 TSSLPTPRSSVSPVRSGRGNINKIIAANPINIK-RPVYVDSEMQT-TDLASLKKA 472

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  493 bits (1268), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/321 (70%), Positives = 260/321 (80%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP I  Y PGT L VG H+V ++KYLTSGGFAQIY VQ++PP+     N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           P+K  LNTLRAEV+ M+LL+   HVV YIDS+AA+   N+G+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E E+LNIM+QVTQGI AMH+L+PPL+HRDIKIENVL++S GEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V GIIRPP N +E ++VQ DIMKNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFE  GE AILHA +Q+P YP YS RLK LI  MLME+P QRPN  QVLEEVSSMQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NVQCPIPNFYLMNNNVTQGQM 321
            + CP+PNFYL     TQ  M
Sbjct: 301 GIPCPLPNFYLQRQQATQLMM 321

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  491 bits (1265), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 257/311 (82%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP IP Y  G  L VG H   ++KYLTSGG+AQ+Y  +ISPPD  T +++ CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK SLNT RAEVD MKLLRN  HVVSYIDS+AAK   + G+YEV LLME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E EILNIMSQVTQG+AAMH+L PPLLHRDIKIENVL+++ GEYK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP++ QE ++VQHDI+KNTTAQYRAPEMIDL R LPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GEAAILH+ +++  YP YSD LK LI  ML  QPSQRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NVQCPIPNFYL 311
            + CPI NFYL
Sbjct: 301 GIPCPIKNFYL 311

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  485 bits (1249), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 262/314 (83%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP I  Y  GT LTVGSH+VQ++KYLT+GGFAQIY   ISP D F+ TN+ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLN LRAEVD MKLLRNN  VVSYIDSHAAK +   G+YEVFLLMEYC+ GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           +N+RLQ RL+E E++NIM  V+QG+AAMHAL PPL+HRDIKIENVLL+   E+K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPPSN QE++ VQ+DIM+NTTAQYR+PEMID+ RG PIDEKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK+GEA IL + ++FP +P YSDRL+ LI+ +L  QP+ RPN Y V++E+S M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NVQCPIPNFYLMNN 314
           N+ CPI NFYL  N
Sbjct: 301 NISCPIINFYLKPN 314

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (50%), Gaps = 18/112 (16%)

Query: 567 PDSTKPIASKSEISFAEPA--------VKSNSKSNEET-------KILIKQKMLEKLNAS 611
           P++ K +  +  +S   P          K+N KS E +       K  ++++M+EKL   
Sbjct: 473 PNANKRLGGRRSVSIFNPKNDTDLKHITKANEKSKESSGPKKVFSKEEVRKRMMEKLK-E 531

Query: 612 QNQFKKKSIPDGDSIHKN-DQTPK-PKVPSKPAHLRPKVPKKPAFLSSQKIK 661
           +++ K  + P   SI     + PK P VP KP  LRP +P KPAFLS ++++
Sbjct: 532 KDKGKNTTEPVSRSISTTPRKAPKGPPVPHKPDRLRPVLPSKPAFLSGKRVQ 583

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  488 bits (1257), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 308/722 (42%), Positives = 414/722 (57%), Gaps = 88/722 (12%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP+IPLY PG +L VGSH+ +++KYLTSGGFAQ+Y V+ISP D  + +N+ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPN----EGSYEVFLLMEYCDMGG 116
           PDK SLN  RAEV+ MKLLRNN +VVSYIDSHAAK  P      GSYEVFLLMEYC   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVC 176
           LIDFMNTRLQ RL+E EILNIMS V+QG+AAMHAL PPLLHRDIKIENVL+++K E+K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFL 236
           DFGSVCG+IRPP+N  E+ +VQHDI+KNTTAQYR+PEM+ L + +PI+EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
           YK+CYYTTPFEK GE AILH+ +Q+P YPQYSD LK LI  MLM  PS+RPN  QV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SSMQNVQCPIPNFYL--------MNNNVTQGQMA----MQTQPQNNGAMMASPNMQPYVP 344
           S +Q V CP+ NFYL        + +N    QM     +  Q   +   +++ N    + 
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360

Query: 345 NNNFVYNTPNAVSMNDIQMMNA---INLKVNSTHNTGMI---PPTMATNMARTIPMQP-- 396
           N NF+ N  N+     IQ  N    IN    S HN+  +   P T+A +    +   P  
Sbjct: 361 NINFLQNVNNSA----IQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQ 416

Query: 397 ---------------VQKSQTLPVSSIPTNLQNTNKSSPFN-------LKSTTTYVDSET 434
                          +QKS +  ++  P +  N + ++ F+       L+ + T ++++ 
Sbjct: 417 QHNIPAYNNQINDITLQKSLSATMADAPVSTINISDNA-FDRGLHLSELQKSVTALNND- 474

Query: 435 QTETPKQTLNKAISSNTEG----FSLINEKNPNSV---PMLXXXXXXXXXXXXXDENDSV 487
                   +N   S   EG     S I   NPNS+   P               D +   
Sbjct: 475 --------MNHIYSQKQEGGRGKISSILNSNPNSLDQSPTRAENNALSTKSSRVDLSVFN 526

Query: 488 DLRNKAYSPIRTPLKSQLQDNDERIK----KVIQVAKEGLSRSRTSLESEPTFKKEKKNK 543
           D     Y     P++    D+    K    K+  ++   L +  T L+ E + K + KN 
Sbjct: 527 DNDQPPYIKNVLPVEDDADDDIYTTKPFNSKLTDISLTSLQKEITELKMELS-KNDSKNA 585

Query: 544 VYNATLEKAKKHRSLPVMETTIKPDSTKPIASKSEISFAEPAVKSNSKSNEE----TKIL 599
           V + +   +    S  +   T+K +S   I  +   S  +  V S  K+ E     TK+ 
Sbjct: 586 VDSRSSFNSNAEPSSELTNKTVKKNS---ITDRYLNSVGDNGVTSVKKTAEGYGKYTKVS 642

Query: 600 IKQKMLEKLNASQNQFKKKSIPDGDSIHKNDQTPKPKVPSKPAHLRPKVPKKPAFLSSQK 659
            K+  L  +N +      K +  G   HK++ T K    +    + PK+P KP++L  ++
Sbjct: 643 DKEGSLTSVNTA------KPLESG---HKSENTNKYIKGNTKQKVPPKLPTKPSYLGGKR 693

Query: 660 IK 661
           I+
Sbjct: 694 IE 695

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  486 bits (1250), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 254/474 (53%), Positives = 311/474 (65%), Gaps = 44/474 (9%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MN P+IP Y PGT+L+VG+H  +++KY+ SGGFAQ+Y+ ++ P D  T TN  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           P+K  LN LRAEV+ MKLL+ + HVV YIDSHAA+     G+YEVFLLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL+E EILNIMSQVTQGIAAMHAL PPL+HRDIKIENVL+++ GEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPP N QE ++VQHDI+KNTTAQYR+PEMIDLYR   IDEKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK G+ AILH+ +QF  +P YSDRLK LI++ML +QP QRPN  QVLEEVS MQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NVQCPIPNFYLM----NNNVTQGQMAMQTQPQNNGAMMASP-NMQPYVPNNNFVYNT-PN 354
            V  P+ NFYL+    + N +   +       N    MA P  + P  P  +   N  P 
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360

Query: 355 AVSMNDIQMMNAINLKVNSTHNT------GMIPPTMA--TNMARTIPMQ----------P 396
            V+   + +M      +++  N        M+ PT      +A  +PM           P
Sbjct: 361 GVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILPP 420

Query: 397 VQKSQTLPV----------SSIPTNLQNTN----KSSPFNLKSTTTYVDSETQT 436
             ++ TLP             + T+  NT     K  PFN      YVDSETQT
Sbjct: 421 FNRASTLPTDGFSTGPGKDGGVITSAVNTGPETIKDRPFN------YVDSETQT 468

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  486 bits (1250), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/311 (71%), Positives = 257/311 (82%), Gaps = 1/311 (0%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQ      QPG +LTVGSH+V++++YLTSGGFAQIY+ ++  P     + +ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDKPSLNTLRAEVD MK+L+ + HVVSYIDSHAAK   ++G+YEV+LLMEYC  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MN+RLQ RL E E+L IMS V QGI AMHAL PPL+HRDIKIENVL++  G++KVCDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP NA E +YVQHDI+KNTTAQYRAPEMIDLYR LP+DEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           Y+TTPFEK GE AIL A FQFP+YPQY+DRLK LI+ ML E P QRPN  QVLEEVS +Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NVQCPIPNFYL 311
            V CP+PNFYL
Sbjct: 300 GVPCPLPNFYL 310

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  452 bits (1163), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 206/346 (59%), Positives = 261/346 (75%), Gaps = 8/346 (2%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MN P IP Y+PGT +TVGSH V ++KYLTSGG+AQIY+ QI P D+F  TN+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK  LNTLRAEVD MK L+++ ++VSYIDSHAAK    +G+YEVFL+MEYC  GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNTRLQ RL E EIL I   ++QG+AAMH L PPL+HRDIKIENVL+++  +YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPP   +E++YV+HDIM +TTAQYRAPEM+DL +G  +++KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFE+ GEA IL+   +FP YP YSD +K+LI  ML + P  RPN +Q+++ VS + 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NVQCPIPNFY--------LMNNNVTQGQMAMQTQPQNNGAMMASPN 338
           NV CPIPN +        + NNN     +    +P N  + +++P+
Sbjct: 301 NVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPH 346

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  454 bits (1167), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 201/311 (64%), Positives = 250/311 (80%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQ Q+PLY P T++TVGSH  ++VKYL SGG+AQ+Y+  ++P D    TN+ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           PDK SLN LRAEVD +K+LRN  +VVSYIDSHA+K + + GSYEVF+LMEYC  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           +NTRL+ RLRE EIL+IM+QV  G+A MH L P L+HRDIKIEN+L++  GEYKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP + +E+ Y+QHDIMKNTTAQYR+PEM+DL +G  I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           YYTTPFEK GE AIL + FQ+P YP YSD LK +I  +L   P +RPN  Q++EE+S +Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NVQCPIPNFYL 311
            +  P+ NFYL
Sbjct: 301 GIVPPMKNFYL 311

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  453 bits (1165), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/313 (64%), Positives = 243/313 (77%), Gaps = 2/313 (0%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTN--TNVACLKRV 58
           MNQP+IP Y+ G +L +G+H+V + KYL  GGFAQ+Y+V++       N    +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLI 118
           IVPDK  LNTLRAEVD MKLL+ N ++VSYIDSHA +    +G YEVFLLMEYC  GG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF 178
           DF+NTRL  RL+E EIL IMS V QG+AAMH L PPL+HRDIKIENVL++  G+YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYK 238
           GS C ++RPP   QE +++ HDIM NTTAQYR+PEMID Y G PIDEKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSS 298
           LCYYTTPFEK GE AIL+  FQFP+YPQYSD ++ +IT ML + P +RPN  QVLE+VS 
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 MQNVQCPIPNFYL 311
           +Q V CPI NF L
Sbjct: 301 LQGVPCPIENFML 313

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  433 bits (1114), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/333 (61%), Positives = 255/333 (76%), Gaps = 11/333 (3%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           MNQP IP Y PG ++ VGSH+ +++KYLTSGGFAQIY+V+ISP D++TN+N+ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
           P+K  LN LR EVD MKLL+NN HVVSYIDS+AAK     GSYEVFLLMEYC+ G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MNT+L+ERL+E E+LNIM+QV QGIAAMH L PPL+HRDIKIENVL++  G +KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYK-- 238
           VCGIIRPP N QE+ YVQHD+MKNTTAQYR+PEMIDL +G PI+ K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 239 --LCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
             L +YT  F ++ E AIL+  +Q+P YP YSDRLK ++  +L   P +RPN  Q+LEE+
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 297 SSMQNVQCPIPNFYLMNNNVTQGQMAMQTQPQN 329
           S +QN+ CPI NFYL     ++ Q A+   P N
Sbjct: 297 SKIQNIPCPIDNFYLER---SRHQGAVSVMPVN 326

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/26 (76%), Positives = 20/26 (76%)

Query: 635 PKVPSKPAHLRPKVPKKPAFLSSQKI 660
           P VP KP HLRPK PKKPA LSS KI
Sbjct: 726 PVVPKKPDHLRPKPPKKPAHLSSLKI 751

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  404 bits (1039), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/303 (59%), Positives = 232/303 (76%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNT 68
           Y+ GT L V SH+V +  YLTSGGFAQ+YT +I+   K     + CLKRVIVP+K SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128
           LRAEVD MK+L+NN ++VSYIDSHA +   +E SY V LLMEYC   GL+DFMN RL+ER
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP 188
           L+E+EIL IM+ V+QG+  MH L PPLLHRDIKIENVLL+  G +K+CDFGSV G++R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 SNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK 248
           ++++E  Y+Q+DI+KNTTAQYR+PEM++L  G PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 NGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPN 308
           +G  AI+   F +P YPQY+D LK +I  +L   P QRPN  Q+LEE+  +Q+   P+PN
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 FYL 311
           FY+
Sbjct: 309 FYV 311

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  315 bits (808), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 205/315 (65%), Gaps = 9/315 (2%)

Query: 4   PQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQI--------SPPDKFTNTNVACL 55
           P +    PGTL+ VGSHKV++VKYL  GGFA IY V+         +P       ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMG 115
           KRV+V D+  LN LR EV+ MK L+N+ ++V Y DS+A++       YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKV 175
            L+D+MN RL  +L E E+L IM  VT+ +A MH L  PL+HRDIKIENVL+ S+  +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVF 235
           CDFGS        +  Q+++ + ++I  +TT QYRAPEMIDLYR LPIDEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
           LYKL +YTTPFE  G+ AILH+ +  P    YS +L  LI  ML E P+ RPN YQV+ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 VSSMQNVQCPIPNFY 310
           V ++  V  P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  320 bits (820), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 160/322 (49%), Positives = 213/322 (66%), Gaps = 20/322 (6%)

Query: 6   IPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISP-PDKFTNTNV------------ 52
           I  +  G  + VGSH V++VKYLT GGFAQIY V+++   ++F   ++            
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 53  --ACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLME 110
              CLKRV+V D+  L+ ++ EV+ MK LR   +VV Y DS+A +     G +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSK 170
           YC    L+D+MN RL  +L E EILNIM  +T G++ +H L  PL+HRDIKIENVL+   
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 GEYKVCDFGSVCGIIRPP--SNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSD 228
             +K+CDFGS    I PP  +  Q++S + HDI  +TT QYR+PEMIDL+R LP++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPN 288
           IWALGVFLYKL +YTTPFE  G+ AILH+ ++ P    YS+RL  LI  ML E P+ RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 SYQVLEEVSSMQNVQCPIPNFY 310
            YQVL E+ S+ NV+ PIP+ Y
Sbjct: 323 IYQVLSEICSILNVEVPIPDIY 344

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  313 bits (801), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 205/311 (65%), Gaps = 10/311 (3%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-------ISPPDK--FTNTNVACLKRVI 59
           Y PGT++ VG HKV+VVKYL  GGFA+IY V+       + P  K    N +  CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLID 119
           V D   LN +R EV+ M+ L+    VV Y DS+A++       YEV LLME C    L+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 120 FMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFG 179
           +MN RL  +L EDEIL IM  VT  +A MH L  PL+HRDIKIENVL+ SK  +K+CDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 180 SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKL 239
           S    +   S+ Q+++ +  +I  +TT QYR+PEMIDLYR LP++EKSDIWALGVFLYKL
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 240 CYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSM 299
            +YTTPFE+ G+ AILH+ ++FP    YS +L  LI  ML E P+ RPN YQVL ++  +
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 300 QNVQCPIPNFY 310
             ++ P+ + Y
Sbjct: 328 SGIKNPMDDAY 338

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  313 bits (802), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 207/325 (63%), Gaps = 22/325 (6%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQI--------SPPDKFTNTNV-------- 52
           + PG ++ VG HKV+++KYL  GGFAQIY+V          + PD   ++N+        
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 53  -----ACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFL 107
                ACLKRV+VPD+  LN LR EV+ M+ L+   ++V Y DS+A++ +     +EV L
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLL 167
           LME C    L+D+MN RL  +L E EIL IM  VT GI+ MH L  PL+HRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 TSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKS 227
            S   +K+CDFGS        ++ QE++ +  +I  +TT QYR+PEMIDLYR LPIDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRP 287
           DIWALGVFLYKL +YTTPFE  G+ AILH+ ++ P    YS RL  LI  ML E P+ RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLRP 317

Query: 288 NSYQVLEEVSSMQNVQCPIPNFYLM 312
           N YQV+ +V     ++ PI + Y M
Sbjct: 318 NIYQVMHQVCITIGIEPPIKDKYEM 342

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  312 bits (800), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 164/359 (45%), Positives = 223/359 (62%), Gaps = 35/359 (9%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQI-----------SPP--DKFTNTNVACL 55
           YQPG ++ VGSH+V++++Y+  GGFAQIY+V+            SP   D+    ++ACL
Sbjct: 18  YQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLACL 77

Query: 56  KRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFN------PNEGSYEVFLLM 109
           KRVIV D+  LN LR EV+ MK L    ++V Y DS+A++        P E  +EV LLM
Sbjct: 78  KRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVLLLM 137

Query: 110 EYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTS 169
           E C    L+D+MN RL  +L E EIL +M  V+  IA MH L  PL+HRDIKIENVL+  
Sbjct: 138 ELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVLVDQ 197

Query: 170 KGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDI 229
           K  +K+CDFGS           ++++Y+  +I  +TT QYR+PEMIDLYR LPIDEKSDI
Sbjct: 198 KNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 257

Query: 230 WALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNS 289
           WALG+FLYKL ++TTPFE+ G+ AILH+ F+FP    YS +L  LI  ML E P+ RPN 
Sbjct: 258 WALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLRPNI 316

Query: 290 YQVLEEVSSMQNVQCPIPNFY-----------LMNNNVTQGQMAM----QTQPQNNGAM 333
           YQVL ++  ++ V  PI + Y           L  NN+ + Q+ M    + Q ++NG +
Sbjct: 317 YQVLHQICQLKQVPIPIADKYGLGAYNFDYYMLFQNNLQKVQVDMFNIKRKQFEHNGQL 375

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  314 bits (804), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 155/312 (49%), Positives = 203/312 (65%), Gaps = 11/312 (3%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNTN---------VACLKRV 58
           +  G+ + VG+ KV++VKYLT GGFAQIY V+ +   ++F + N         +ACLKRV
Sbjct: 25  FANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRV 84

Query: 59  IVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLI 118
           +V D+  LN +R EV+ MKLL+   ++V Y DS+A++       +EV LLME C    L+
Sbjct: 85  LVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLL 144

Query: 119 DFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF 178
           DFMN RL  +L E EIL IM  VT  +A MH L PPL+HRDIKIENVL+ S+  +K+ DF
Sbjct: 145 DFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADF 204

Query: 179 GSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYK 238
           GS        S  Q+++ +  DI  +TT QYR+PEMIDLY+ LPIDEKSDIWALG+FLYK
Sbjct: 205 GSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYK 264

Query: 239 LCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSS 298
           L +Y TPFE  G+ AILH+ + FP    YS RL  LI  ML E P+ RPN YQVL E+ S
Sbjct: 265 LLFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIYQVLHEICS 323

Query: 299 MQNVQCPIPNFY 310
           +   +  I + Y
Sbjct: 324 ISGTRLEITDKY 335

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  308 bits (788), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 207/312 (66%), Gaps = 11/312 (3%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT---------NVACLKRV 58
           Y PGT + VG+HKV+++KY+  GGFAQIY V+ I   ++F N          +VACLKRV
Sbjct: 22  YTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV 81

Query: 59  IVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLI 118
           +V D+  LN +R EV+ MK L+   ++V Y DS+A++ +     +EV LLME C    L+
Sbjct: 82  LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLL 141

Query: 119 DFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF 178
           D+MN RL  +L E EIL IM  VT  ++ MH L  PLLHRDIKIENVL+ ++  +K+CDF
Sbjct: 142 DYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201

Query: 179 GSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYK 238
           GS        +  Q+++ +  +I  +TT QYR+PEMIDLYR LPIDEKSDIWALG+FLYK
Sbjct: 202 GSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYK 261

Query: 239 LCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSS 298
           L ++TTPFE  G+ AILH+ ++FP    YS +L  LI  ML E P+ RPN YQVL  + S
Sbjct: 262 LLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVLHNICS 320

Query: 299 MQNVQCPIPNFY 310
           +  ++ PI + Y
Sbjct: 321 ISGMKVPIEDQY 332

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  308 bits (788), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 208/319 (65%), Gaps = 10/319 (3%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT--------N 51
           M  P +  Y PG ++ VG+HKV++V YL  GGFAQIY V+ +   ++F NT        +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+  A+VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PL+HRDIKIENVL+ ++ 
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWA 231
            +K+ DFGS        +  Q+++ +  +I  +TT QYR+PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQ 291
           LG+FLYKL ++TTPFE  G+ AILH+ ++FP   +YS +L  LI  ML E P+ RPN YQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQNVQCPIPNFY 310
           VL  +  + N + PI + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  308 bits (789), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 208/323 (64%), Gaps = 25/323 (7%)

Query: 12  GTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNTN------------------- 51
           GT + VGSHKV+++KY+  GGFAQIY V+ +   ++F ++N                   
Sbjct: 27  GTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNPMIL 86

Query: 52  ----VACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFL 107
               +ACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++ +     +EV L
Sbjct: 87  KLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFEVLL 146

Query: 108 LMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLL 167
           LME C    L+D+MN RL  +L E EIL IM  +T  ++ MH L  PLLHRDIKIENVL+
Sbjct: 147 LMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIENVLV 206

Query: 168 TSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKS 227
            ++  +K+CDFGS    +   +  Q+++ +  +I  +TT QYR+PEMIDLYR LPIDEKS
Sbjct: 207 DAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS 266

Query: 228 DIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRP 287
           DIWALG+FLYKL ++ TPFE  G+ AILH+ ++FP    YS +L  LI  ML E P+ RP
Sbjct: 267 DIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRP 325

Query: 288 NSYQVLEEVSSMQNVQCPIPNFY 310
           N YQVL+ + SM NV+ PI + Y
Sbjct: 326 NIYQVLDNICSMMNVEVPIEDIY 348

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  307 bits (786), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 208/319 (65%), Gaps = 10/319 (3%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT--------N 51
           M  P +  Y PG ++ VG+HKV++V YL  GGFAQIY V+ +   ++F N         +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+  A+VV Y DS+A++       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PL+HRDIKIENVL+ +K 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWA 231
            +K+ DFGS        +  Q+++ +  +I  +TT QYR+PEMIDLYR LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQ 291
           LG+FLYKL ++TTPFE  G+ AILH+ ++FP   +YS +L  LI  ML E P+ RPN YQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQNVQCPIPNFY 310
           VL  +  + NV+ PI + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  305 bits (781), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 210/321 (65%), Gaps = 13/321 (4%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ----------ISPPDKFTNT 50
           +N P    Y  G +++VG+H+V++V YL  GGFAQIY V+          +      T  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLME 110
           ++ACLKRVIV D+  LN +R EV+ MK L+++ ++V Y DS+A++    +  +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSK 170
            C    L+D+MN RL+ +L E EIL IM  V+ GI+ MH L  PL+HRDIKIENVL+ + 
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIW 230
             +K+CD GS      P  + Q+++ +  +I  +TT QYRAPEMIDLYR LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP-QYSDRLKKLITYMLMEQPSQRPNS 289
           ALG+FLYKL +YTTPFE  G+ AILH+ + FP  P +YS ++  LI  ML E P+ RPN 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309

Query: 290 YQVLEEVSSMQNVQCPIPNFY 310
           +QV+  + S+ N+  PI + Y
Sbjct: 310 FQVVYHICSIMNLPVPIEDRY 330

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  305 bits (782), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 207/319 (64%), Gaps = 10/319 (3%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT--------N 51
           M  P +  Y PG ++ VG+HKV+VV YL  GGFAQIY V+ +   ++F NT        +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L   L+HRDIKIENVL+ +K 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWA 231
            +K+ DFGS        +  Q+++ +  +I  +TT QYR+PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQ 291
           LGVFLYKL ++TTPFE  G+ AILH+ ++FP   +YS +L  LI  ML E P+ RPN YQ
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQNVQCPIPNFY 310
           VL  +  + NV+ PI + Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  305 bits (780), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 203/316 (64%), Gaps = 15/316 (4%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQI--------SPPDKFTN------TNVAC 54
           Y  GT + VGSHKV+V+KY+  GGFAQIYTV+         S P    N       ++AC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDM 114
           LKRV+V D   LN +R EV+ M+ L+    VV Y DS+A+  + +   YEV LLME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
             L+D+MN RL  RL E EI+ IM   T GIA +H L  PL+HRDIKIENVL+  +  +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGV 234
           +CDFGS        +N ++++    +I  NTT QYR+PEMIDLYR  PIDEKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           FLYKL ++TTPFE+ G+ AILH+ ++FP    YS +L  LI  ML E PS RPN YQVL+
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 EVSSMQNVQCPIPNFY 310
            + S+   + P+ + Y
Sbjct: 398 YLCSINGWKVPLNDKY 413

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  301 bits (772), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 202/319 (63%), Gaps = 10/319 (3%)

Query: 4   PQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQI---------SPPDKFTNTNVAC 54
           P +   + G+ + VG+H+V++VKYL  GGFA IY V+          +P         AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDM 114
           LKRV+V D+  LN +R EV  MK L    ++V Y DSHA++       +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
             L+D+MN RL  +L E EIL IM  VT+ +A MH L  PL+HRD+KIENVL+     +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGV 234
           +CDFGS    +   +  QE++ + ++I  +TT QYR+PEMIDLYR LPIDEKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           FLYKL +YTTPFE  G+ AILH+ ++FP    YS +L  LI  ML E P+ RPN YQ+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 EVSSMQNVQCPIPNFYLMN 313
            + S+  V+ PI + Y M 
Sbjct: 323 NLCSIMKVENPIEDKYGMG 341

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  303 bits (775), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 159/332 (47%), Positives = 208/332 (62%), Gaps = 32/332 (9%)

Query: 2   NQP-QIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT--------- 50
           N+P  I  Y+ GT+LTVG  +++++KYLT GGFAQIYTV+ I   ++F N          
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 51  -----NVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEG---- 101
                +VACLKRV+VPD+  L+ +R EVD MK L N  ++V Y DS+A+K   N      
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTT 151

Query: 102 -----------SYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHA 150
                       +E+ LLMEYC    L+DFMN RL  +L E+EIL  M+ +T  +  MH 
Sbjct: 152 NNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHY 211

Query: 151 LHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYR 210
           L  PL+HRDIKIENVL+ S   +K+ DFGS   I  P +  Q+++ +  DI  NTT QYR
Sbjct: 212 LAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYR 271

Query: 211 APEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDR 270
           +PEMIDLY+ LPIDEKSDIWALGV LYKL +YTTPFE  G+ AILH+ ++FP    YS +
Sbjct: 272 SPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFP-ANNYSSK 330

Query: 271 LKKLITYMLMEQPSQRPNSYQVLEEVSSMQNV 302
              LI  ML E P+ RPN +QVL  + S+ N 
Sbjct: 331 FINLIIIMLAENPNLRPNIFQVLYYLKSISNT 362

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  299 bits (766), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 148/310 (47%), Positives = 198/310 (63%), Gaps = 15/310 (4%)

Query: 12  GTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTN-----------TNVACLKRVIV 60
           G++L VG H+V++++YL  GGFA IY V      ++TN            ++ACLKRV V
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFI---EYTNELDRHHSVLQRGDIACLKRVQV 87

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120
            D+  LN LR EV+ MK L+   +VV Y DS+A++       +EV LLME C  G L+D+
Sbjct: 88  NDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDY 147

Query: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180
           MN RL  +L E E+L IM  +T+GI+ MH L  PL+HRDIKIENVL+ S   +K+CDFGS
Sbjct: 148 MNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGS 207

Query: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
               +   S  QE++ + ++I  +TT QYR+PEMIDLYR L I+EKSDIWALG+FLYKL 
Sbjct: 208 TSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLL 267

Query: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           +YTTPFE  G+ AILH+ +  P    +S +L  LI  ML E P  RPN YQ+L  + S+ 
Sbjct: 268 FYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIM 326

Query: 301 NVQCPIPNFY 310
               PI + Y
Sbjct: 327 ECDVPIEDHY 336

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  303 bits (775), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 206/319 (64%), Gaps = 10/319 (3%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT--------N 51
           M  P +  + PG ++ VG+HKV+V+ YL  GGFAQIY V+ +   ++F N         +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PL+HRDIKIENVL+ +  
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWA 231
            +K+ DFGS        +  Q+++ +  +I  +TT QYR+PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQ 291
           LG+FLYKL ++TTPFE  G+ AILH+ ++FP   +YS +L  LI  ML E P+ RPN YQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQNVQCPIPNFY 310
           VL  +  + N++ PI + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  299 bits (766), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 202/312 (64%), Gaps = 10/312 (3%)

Query: 12  GTLLTVGSHKVQVVKYLTSGGFAQIYTVQI---------SPPDKFTNTNVACLKRVIVPD 62
           G+ + VG+H+V++VKYL  GGFA IY V+           P  K    ++ACLKRV+V D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMN 122
           +  LN +R EV  MK L    ++V Y DSHA++       +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVC 182
            RL  +L E EIL IM  VT+ +A MH L  PL+HRD+KIENVL+ +   +K+CDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYY 242
                 +  QE++ + ++I  +TT QYR+PEMIDLYR LPI+EKSDIWALG+FLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQNV 302
           TTPFE  G+ AILH+ ++FP    YS +L  LI  ML E P+ RPN YQV++ + S+  V
Sbjct: 314 TTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 QCPIPNFYLMNN 314
           + P+ + Y + +
Sbjct: 373 KNPLEDKYQLGS 384

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  295 bits (756), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 202/317 (63%), Gaps = 19/317 (5%)

Query: 4   PQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNT------------- 50
           P   L  P T + VG+H+ +++++L  GGFA IY V+     + TN              
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFL---ELTNEMDAGIDSKLLKAG 80

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLME 110
           ++ACLKRVIVPD+  LN LR EV+TMK LR + ++V Y DS+A++       +E+ LLME
Sbjct: 81  DIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLME 140

Query: 111 YCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSK 170
            C    L+D+MN +L  +L E EIL IM  V+  IA MH L  PL+HRDIKIENVL+   
Sbjct: 141 LCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKD 200

Query: 171 GEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIW 230
             +K+CDFGS        S  Q+++ + ++I  +TT QYR+PEMIDLYR LPI+EKSDIW
Sbjct: 201 DNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 260

Query: 231 ALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSY 290
           ALG+FLYKL +YTTPFE  G+ AILH+ ++ P    YS +L  LI  ML E PS RPN Y
Sbjct: 261 ALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIY 319

Query: 291 QVLEEVSSMQNVQCPIP 307
           QV+  V S+  ++C +P
Sbjct: 320 QVMHHVCSI--LKCDVP 334

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  297 bits (761), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 170/401 (42%), Positives = 234/401 (58%), Gaps = 33/401 (8%)

Query: 6   IPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTN--------------- 49
           I  ++ G  L VG+HKV++V YLT GGFAQIY V+ I   ++F N               
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 50  -TNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLL 108
             +VACLKRV+V D+  LN +R EV+ MK LR   ++V Y DS+A + +     YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLT 168
           ME C    L+++MN RL  +L E E+L IM  VT G+A MH L  PL+HRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 SKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSD 228
           S   +K+CDFGS        +  Q+++ +  ++  +TT QYR+PEMIDLYR LPI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPN 288
           IWALGVFLYKL +YTTPFE  G+ A+LH+ F  P   +YS ++  L+  ML E  + RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIP-ANKYSSKIINLVIIMLSENLNLRPN 326

Query: 289 SYQVLEEVSSMQNVQCPIPNFYLMN-------NNVTQGQMAMQTQ----PQNNGAMMA-S 336
            YQV+  +  +  V  PI + Y          ++  +   A+Q Q     QNN  +M  +
Sbjct: 327 IYQVMHYICQLIQVDTPILDIYGRGPYNFSKYSDYQKKAQAIQNQLFASGQNNSNVMKQT 386

Query: 337 PNMQPYVPNNNFVYNTPNAVSMNDIQMMNAINLKVNSTHNT 377
            ++  ++  N+F   T  A S  DI+     N  VN+ H T
Sbjct: 387 DSVDDFL--NDFFLATFEAASKLDIERSPPTN-AVNTVHGT 424

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  300 bits (767), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 214/338 (63%), Gaps = 10/338 (2%)

Query: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT--------N 51
           + +P +  Y PGT++ VG+ +V+++ ++  GGFAQIY+V+ I    +F N         +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  VACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEY 111
           +ACLKRV+VPD+  L+ +R EV+ MK LR    ++ Y DS+A++    +  YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKG 171
           C    L+D+MN RL  RL E EIL +M   T  I+ MH L  PL+HRDIKIENVL+ ++ 
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWA 231
            +K+CDFGS        +  Q+++ +  +I  NTT QYR+PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQ 291
           LG+FLYKL ++ TPFE  G+ +ILH+ ++FP   +YS +L  LI  ML E P  RPN YQ
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 VLEEVSSMQNVQCPIPNFYLMNNNVTQGQMAMQTQPQN 329
           V+  + S+   + PI + Y +     +     QT+ QN
Sbjct: 313 VMHHICSVIGCEVPIEDKYGLGPYNFEKYTEFQTKLQN 350

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  296 bits (757), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 202/313 (64%), Gaps = 9/313 (2%)

Query: 6   IPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTV-------QISPPDKFTN-TNVACLKR 57
           + + Q G+ + VG H+V+V++YL  GGFA IY V       ++   D+     +  CLKR
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85

Query: 58  VIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGL 117
           V V D+  LN LR EV+ MK LRN +++V Y DS+A++    +  YEV LLME C  G L
Sbjct: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145

Query: 118 IDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCD 177
           +D+MN RL  +L E E+L IM  +T G++ MH    PL+HRDIKIENVL+ +   +K+CD
Sbjct: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205

Query: 178 FGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLY 237
           FGS    +   ++ QE++ + ++I  +TT QYR+PEMIDLYR LPI+EKSDIWALG+FLY
Sbjct: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265

Query: 238 KLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVS 297
           KL +YTTPFE  G+ AILH+ ++ P    +S +L  L+  ML E P  RPN YQV+  + 
Sbjct: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324

Query: 298 SMQNVQCPIPNFY 310
           SM   +  I + Y
Sbjct: 325 SMMECEVKIDDLY 337

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  297 bits (761), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 205/317 (64%), Gaps = 12/317 (3%)

Query: 4   PQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTN--------TNVAC 54
           P +  + PG ++ VG+H+V+VV YL  GGFAQIY V+ +   ++F N         +VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDM 114
           LKRV+V D+  L+ +R EV+ MK L    ++V Y DS+A + +     +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
             L+D+MN RL  +L E EIL IM  V+  ++ MH L  PL+HRDIKIENVL+ ++  +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGV 234
           +CDFGS        +  QE++ +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKNGEAAILHATFQF-PNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
           FLYKL ++ TPFE  G+ AILH+ ++F PN+  YS +L  LI  ML E P  RPN YQVL
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPNH--YSSQLINLIIIMLAENPFVRPNIYQVL 314

Query: 294 EEVSSMQNVQCPIPNFY 310
             + +M  V+ PI + Y
Sbjct: 315 NHICTMIGVEVPIEDKY 331

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  295 bits (755), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 207/322 (64%), Gaps = 21/322 (6%)

Query: 3   QPQIPLYQP-GTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNTNV-------- 52
           QPQI    P G ++TVGSH+V+VV YL  GGFAQIY V+ +   ++F   N         
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 53  ----ACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEG----SYE 104
               ACLKRV+V D+  LN +R+EV+ MK L+   ++V Y DS+A++     G     +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E EI  IM  +T  +A MH L  PL+HRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPID 224
           VL+ +   +K+CDFGS        ++ Q+++ +  D+  +TT QYR+PEMIDL++ +PI+
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP-QYSDRLKKLITYMLMEQP 283
           EKSDIWALGVFLYKL ++TTPFE+ G+ A+LH+ F+FP  P  YS +L  LI  ML E P
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP--PNSYSSKLINLIIVMLAENP 386

Query: 284 SQRPNSYQVLEEVSSMQNVQCP 305
           S RPN YQVL  +S + N + P
Sbjct: 387 SLRPNIYQVLYYLSEVTNREVP 408

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  288 bits (738), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 206/338 (60%), Gaps = 10/338 (2%)

Query: 6   IPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTN---------VACLK 56
           I  Y PG ++ VG HKV+++KYL  GGFA+IY  +     K  + N         + CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGG 116
           RV+V D   LN +R EV  MK L    ++V   DS+A++       YEV LLME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVC 176
           L+D+MN RL  +L E EIL IM  VT  +A MH L  PL+HRDIKIENVL+ S+  +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFL 236
           DFGS    +   +  ++++ +  ++  +TT QYR+PEMID+YR + I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
           YKL +Y TPFE+ G+ AILH+ ++FP +  YS +L  LI  ML E P+ RPN YQVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SSMQNVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMM 334
             + N++ PI + Y +     Q     QT  QN+   M
Sbjct: 395 CKIINIKTPIDDIYGLGPYDFQKYTNYQTALQNSQNQM 432

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  294 bits (752), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 146/318 (45%), Positives = 203/318 (63%), Gaps = 12/318 (3%)

Query: 6   IPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTN----------TNVAC 54
           I  Y+PG L++VG+H+V++  YL  GGFAQIY V+ I   ++F N           ++AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDM 114
           LKRV+V D+  LN +R EV+ MKLL+   ++V Y DS+A + N     YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
             L+D+MN RL+ +L E EI+ IM   T  ++ MH L  PL+H+DIK+EN+L+ S   +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGV 234
           +CDFGS        ++  +++ +  +I  +TT QYR+PEMIDLYR LPI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           FLYKL ++ TPFE+ G+ +ILHA F  P    Y  +L  LI  ML E  + RPN YQV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 EVSSMQNVQCPIPNFYLM 312
           E+ S+ N   PI + Y M
Sbjct: 331 EICSITNTPLPIEDKYGM 348

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 85/347 (24%), Positives = 149/347 (42%), Gaps = 61/347 (17%)

Query: 13  TLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVAC-----LKRVIVPDKPSLN 67
           T + V   + ++ + L  GG + +Y VQ+          VA      LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
               E++  K  ++  +V+  IDS   +    +GS  +++++ +  +G L D +N RL E
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQ--EKDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 128 R--LREDEILNIMSQVTQGIAAMHA---------------------------------LH 152
              + E E + IM  V +G+  +H                                  L 
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDI 201
             +L           HRDI   N+L +S G   + D GS         N  ++  +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 MKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGE---AAILHAT 258
             N T  Y APE++ L     +D K DIW+LG   Y L +  +PFE+  +   A+I +A 
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 259 ----FQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQN 301
               + FP   ++S+ L  +I   +   P QRP + Q+L  +  +++
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLES 364

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 96.7 bits (239), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 82/335 (24%), Positives = 145/335 (43%), Gaps = 61/335 (18%)

Query: 13  TLLTVGSHKVQVVKYLTSGGFAQIYTVQI-----SPPDKFTNTNVACLKRVIVPDKPSLN 67
           T + V   + ++ + L  GG + +Y VQ+     S  +      +  LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
               E++  K  ++  +V+  IDS   +    +GS  +++++ Y  +G L D +N RL E
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQ--EKDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 R--LREDEILNIMSQVTQGIAAMHA---------------------------------LH 152
              + E E + IM  VT+G+  +H                                  L 
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDI 201
             +L           HRDI   N+L +S G   + D GS         N  ++S +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 MKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGE---AAILHAT 258
             N T  Y APE+++L     +  K DIW++G   Y L +  +PFE+  +   A++ +A 
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 259 ----FQFPNYPQYSDRLKKLITYMLMEQPSQRPNS 289
               + FP   ++S+RL  +I   +   P QRP +
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRPTT 352

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 138/333 (41%), Gaps = 61/333 (18%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVA-----CLKRVIVPDKPSLNTL 69
           + V   + ++ + L  GG + +Y VQ+S      +  +A      LK++I P   S++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER- 128
             E++  K  ++  +V+  IDS   +    +GS  +++++ Y  +G L D +N RL E  
Sbjct: 83  MREIENYKRFQS-PYVIKSIDSQVMQ--EKDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 129 -LREDEILNIMSQVTQGIAAMH-------------------------------------- 149
            + E E + IM  VT+G+  +H                                      
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 150 ------ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMK 203
                 A      HRDI   N+L +S G   + D GS         N  ++S +Q  +  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEA-------AILH 256
           N T  Y  PE+++L     +  K DIW+LG   Y L +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 ATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNS 289
             + FP   ++S+ L  +I   +   P QRP +
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRPTT 352

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 136/295 (46%), Gaps = 51/295 (17%)

Query: 11  PGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLR 70
           P TL T+        K +  G F  ++       +  T   VA   ++I  D     T  
Sbjct: 12  PSTLFTID-------KCVGKGNFGDVFKAM----NNVTKEVVAI--KIINLDDSEEETFE 58

Query: 71  --AEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128
              E+  M LL++      YI  +    N +   Y ++++MEYC  G   D + T  +E 
Sbjct: 59  IIKEMRLMSLLKS-----PYIARYITTINED---YLMWIVMEYCGGGSARDLIKTCYREG 110

Query: 129 LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP 188
           L E+++  ++  V  G+  +HA H   +HRDIK  N+LLT  G  KV DFG V   +R  
Sbjct: 111 LAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRST 167

Query: 189 SNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK 248
             A+  ++V        T  + APE++ +  G+  +EKSDIW+LG+  Y+L     P  K
Sbjct: 168 MKAK--TFV-------GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAK 217

Query: 249 NGEAAILHATFQFPNYPQ---------YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
                ++       N P+         Y++ +K  I   L++ P +RP++ ++LE
Sbjct: 218 YDAIRVMR------NIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLE 266

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 150/355 (42%), Gaps = 77/355 (21%)

Query: 13  TLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVP--DKPSLNTLR 70
           ++L  G H   + + L  GGF+ +Y VQ        N ++  LK++  P  +  S++   
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDTMKLLRN--NAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE- 127
            EV++ K  R+    H VS     +      +GS  VF+L+ Y   G L+D +NT L + 
Sbjct: 74  REVNSYKKFRSPYITHCVS-----SQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDG 128

Query: 128 -RLREDEILNIMSQVTQGIAAMH-------------ALHPPLLHRD-------------- 159
             + E+EI+ I+  V +G+  MH             +++  L +RD              
Sbjct: 129 TTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLN 188

Query: 160 --------------------------IKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQE 193
                                     IK  N++ +S G   +CD GS        S+  +
Sbjct: 189 DSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQ 248

Query: 194 VSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEA- 252
           +   Q    ++ T  +R+PE++++     IDEK DIW+LG  LY +C+  +PFE+  +  
Sbjct: 249 LVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLS 308

Query: 253 ------AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQN 301
                 AI    F  P    YS  L K+I   +     +RP+  ++L  +  +Q 
Sbjct: 309 GASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 95/207 (45%), Gaps = 47/207 (22%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L +++   +Q R+  +E   + +Q+   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           N+LL  KG  K+ DFG            +VCG                      T  Y A
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMIDL--YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQ---FPNYPQ 266
           PE+I+   Y G  I    DIW+LGV LY + + T PF++  E            F N   
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDV 251

Query: 267 YSDRLKKLITYMLMEQPSQRPNSYQVL 293
            S   K LI+ +L + PSQRP   QVL
Sbjct: 252 VSKDAKDLISQLLCKDPSQRPQLSQVL 278

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 87/300 (29%), Positives = 139/300 (46%), Gaps = 41/300 (13%)

Query: 5   QIPLYQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDK 63
           QI  ++ G  L +GS  KVQ+    T+G  A I  +  +    F ++NV  +     PD 
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI---FQDSNVTSMVDNTTPDA 70

Query: 64  PSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNT 123
                 R E+  MKLL N+A+V+   D      N       +++++EY + G L +    
Sbjct: 71  LPYGIER-EIVIMKLL-NHANVLRLYDVWETNSN-------LYMVLEYAEKGELFNL--- 118

Query: 124 RLQER--LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSV 181
            L ER  L E+E +    Q+  GI+  HAL   ++HRD+K EN+LL +K   K+ DFG  
Sbjct: 119 -LVERGPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDTKYNIKIADFGMA 175

Query: 182 CGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLC 240
              +       E S          +  Y APE++    G+P     SD+W+ GV LY L 
Sbjct: 176 A--LETEDKLLETSC--------GSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALL 222

Query: 241 YYTTPF-EKNGEA-----AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
               PF E++G        +    F+ P   + S   + LI+ +L+  P++R  +  +L+
Sbjct: 223 TGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/348 (22%), Positives = 150/348 (43%), Gaps = 65/348 (18%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNT-------NVACLKRVIVP--DKPS 65
           +++   +  + + L  G  + +Y VQ       T +        +  LKR+  P  +  S
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 66  LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
           ++    EVD  K  ++  ++++ +DS   +    +GS  + +L+ Y  +G L D +N  L
Sbjct: 86  ISAAMKEVDNYKRFQS-PYIITLVDSQVVQ--EKDGSKTLCILLPYFPLGSLQDMVNRNL 142

Query: 126 QER--LREDEILNIMSQVTQGIAAMH-------------------------AL---HPPL 155
            +   + E E + IM  + +G+  +H                         A      PL
Sbjct: 143 LKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPL 202

Query: 156 ----------------LHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQH 199
                           +HRDI++ N+L +S+G   V D GS C      S   +++ +Q 
Sbjct: 203 ELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQD 262

Query: 200 DIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEA------- 252
            +  N +  Y APE++++     ID K+DIW++G   Y + +  +PFE+  +        
Sbjct: 263 WVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTY 322

Query: 253 AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300
           AI    + FP   +YS+ L  +I   L   P+ RP+  ++L+ +  +Q
Sbjct: 323 AIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 142/336 (42%), Gaps = 63/336 (18%)

Query: 13  TLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVA-----CLKRVIVPDKPSLN 67
           T + V   + ++ + L  GG + +Y VQ+          +       LK++I P   S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
               E++  K  ++  +V+  IDS   +     GS  +++++ Y  +G L D +N RL E
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVTQ--EKNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 R--LREDEILNIMSQVTQGIAAMH------------------------------------ 149
              + E E + IM  VT+G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 150 --------ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVC-GIIRPPSNAQEVSYVQHD 200
                   A      HRDI   N+L +S+G   + D GS     IR  S  Q +S +Q  
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQ-LSELQEW 256

Query: 201 IMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGE---AAILHA 257
           +  N T  Y APE+++L     +  K DIW++G   Y L +  +PFE+  +   A+I +A
Sbjct: 257 VNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYA 316

Query: 258 T----FQFPNYPQYSDRLKKLITYMLMEQPSQRPNS 289
                + FP   ++S+ L  +I   +   P QRP +
Sbjct: 317 INTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRPTT 352

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 126/271 (46%), Gaps = 28/271 (10%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++      F    VA   ++ +  + + N L +E+   K +R+  ++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            +ID      N       V++L+E C  G L+D +  R  + L E E+    +Q+   + 
Sbjct: 159 HFIDCFEDDIN-------VYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+        K+ DFG +  II   +N  E  Y         T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYTI-----CGT 258

Query: 207 AQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFP 262
             Y APE+I   + +    + DIW+LGV ++ +     PF+    + I     H  + FP
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 NYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
                S  +KKLI  +L   P +RP   ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 118/242 (48%), Gaps = 38/242 (15%)

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
           T+  E++  KL+  + +++S ID         E    +++++E C  G L D +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHF-------EIDATMYMVLELCGAGSLYDII-CRSKR 146

Query: 128 RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            LRE E   +M Q+   +  +H     ++H D+K+ N+L+ S    ++CDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 188 PSNAQEVSYVQHDIMKNT-----TAQYRAPEMIDLY-----RGLPIDEKSDIWALGVFLY 237
                  S+V  DI  N+     T  Y +PE+I  +     + L   ++SDIW++G+ LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 238 KLCYYTTPFE----KNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
            + +  TPFE    ++    I+   + F    + S+++KKLI  +L  QP +R    +++
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

Query: 294 EE 295
            +
Sbjct: 311 SD 312

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/337 (24%), Positives = 141/337 (41%), Gaps = 70/337 (20%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQ-------ISPPDKFTNTNVACLKRVIVP--DKPS 65
           L++   +  + K L    F+ IY VQ        S P     TN+  LKR+  P  +  S
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTP----RTNLYALKRIRCPFGNIES 81

Query: 66  LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
           ++    EVD  K  ++  +++  +DS  A+    +GS  V++L+ Y  +G L D  +  L
Sbjct: 82  ISGAMKEVDNYKRFQS-PYIIHLVDSQVAQ--QRDGSKTVYILLPYFPLGSLQDSTSRNL 138

Query: 126 --QERLREDEILNIMSQVTQGIAAMHA--------------------------------- 150
                + E E + I+  + +G+  +H                                  
Sbjct: 139 LNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTP 198

Query: 151 LHPPLL------------HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQ 198
           L   +L            HRDIK  N+L +S G   + + GS        +   +++ +Q
Sbjct: 199 LELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQ 258

Query: 199 HDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEA------ 252
             +  + T  Y APE++ +     +D K DIW+LG   Y + +  +PFE+  +       
Sbjct: 259 AWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLK 318

Query: 253 -AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPN 288
            AI    F FP+  +YS+ L KLIT  L   P+ RP+
Sbjct: 319 YAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPD 355

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 126/271 (46%), Gaps = 29/271 (10%)

Query: 28  LTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVS 87
           L  GGFA+ + ++      F    V+  K+ I  ++     L +E+   + LR  +H+V 
Sbjct: 99  LGEGGFARCFHIKDDVGISFACKIVS--KKSIKTERTKFKLL-SEIQIHQNLRY-SHIVK 154

Query: 88  YIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAA 147
           ++D    + N       V++L+E C  G L+D +  R  + L E E+  + +QV   I  
Sbjct: 155 FMDCFEDELN-------VYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGAINY 205

Query: 148 MHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA 207
           MH+    ++HRD+K+ NV        K+ DFG    +    SN  E  Y         T 
Sbjct: 206 MHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-----TP 254

Query: 208 QYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH----ATFQFPN 263
            Y APE+I L + +    ++DIW+LG+ +Y +     PF+      I        ++FP 
Sbjct: 255 NYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEFPP 313

Query: 264 YPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
               ++ +K LI  +L+  PSQRP    +L+
Sbjct: 314 DKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/351 (22%), Positives = 145/351 (41%), Gaps = 67/351 (19%)

Query: 8   LYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
            +  G  +++      V   L  G    +Y  Q+  P +  +  V  LK+V  P   +  
Sbjct: 17  FWFDGVRISINGKSYLVTTLLREGELTALY--QVKCPKRSHSGGVYALKKVTCPIGRADF 74

Query: 68  TLRAEVDTMKLLRNNA-HVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL- 125
             RA  +     R N+ ++ + +D   A+ +   G+  +++L+ Y   G L D +N  + 
Sbjct: 75  VTRAMTEISNYQRFNSPYITNILDFQVAQHD--NGTKIIYMLLPYFPAGSLQDLINNMII 132

Query: 126 -QERLREDEILNIMSQVTQGIAAMH----------------------------------- 149
             + L E  ++ +M  + +G+  MH                                   
Sbjct: 133 RGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAME 192

Query: 150 --ALHPPL--------LHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP----SNAQEVS 195
              L PPL        +H  +  EN++L+S+G   + +  S    +R P    SN++ + 
Sbjct: 193 LDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLG 249

Query: 196 YVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAA-- 253
            +Q  + +N+   Y  PE++DL+    I  + DIW+LG   Y L Y  + F +  +    
Sbjct: 250 -LQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGT 308

Query: 254 -----ILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSM 299
                I    F FP+ P+YS  LK+++   L+  P +RP+ Y+ L +   +
Sbjct: 309 PIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 89.4 bits (220), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 100/200 (50%), Gaps = 28/200 (14%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +     E L ED++  I   V +G+  +H      +HRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPID 224
           VLLT  G  K+ DFG V G +R  S A+  ++V        T  + APE+I        +
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLR--STAKRNTFV-------GTPYWMAPEIIS-NSSHGYN 198

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQ---------YSDRLKKLI 275
           EK+DIW+LG+ +Y+L     P+ K     ++       N P+         +SD  K  I
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMR------NIPKKNLQDCMVSFSDAAKLFI 252

Query: 276 TYMLMEQPSQRPNSYQVLEE 295
           +  L++ P +RP + ++L++
Sbjct: 253 SACLIKDPDERPTATELLQQ 272

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 81/337 (24%), Positives = 142/337 (42%), Gaps = 54/337 (16%)

Query: 13  TLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAE 72
           + +++   K ++ K L  GG + +Y V+    + F      C    I    P++     E
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFALKKTRCPFGSIGSISPAMK----E 72

Query: 73  VDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE--RLR 130
           V   +   ++ ++   +DS   +    +GS  V++L+ Y   G L D +N  L +  ++ 
Sbjct: 73  VANYQRF-SSPYIAQIVDSQVVQ--EKDGSKTVYVLLPYFAKGSLQDLINRHLLDCTQMS 129

Query: 131 EDEILNIMSQVTQGIAAMHALHP-------------------PLL--------------- 156
           E +IL +   + +G+  +H  +P                    LL               
Sbjct: 130 ELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQSY 189

Query: 157 -HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNA-QEVSYVQHDIMKNTTAQYRAPEM 214
            HRD+K  N++++ +    + D GS C   R   N+ Q +   Q     N T  Y APE+
Sbjct: 190 AHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAAPEI 248

Query: 215 IDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEA-------AILHATFQFPNYPQY 267
           +D+     I EK DIW+ G  +Y +C+  +PFE+  +        AI    +  P    Y
Sbjct: 249 LDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSY 308

Query: 268 SDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQNVQC 304
           S  L +LI   L   P QRP+  +++  +  +Q  QC
Sbjct: 309 SSSLIELIGKCLSVNPEQRPSVNELIALLMELQG-QC 344

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 98/209 (46%), Gaps = 51/209 (24%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           V++ +EYC    L +++   +++R+  DE  ++ SQ+   +   H++    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAP 212
           +LL  KG+ K+ DFG            +VCG                      T  Y AP
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMIDL--YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDR 270
           E+I+   Y G  I    D W+LG+ LY + +   PF++  +    +      N P Y D 
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGAMPFDEEDDIKTKYRIVN--NEPFYDDN 250

Query: 271 L-----KKLITYMLMEQPSQRPNSYQVLE 294
                 K LI  +L + PSQRP+  QVL+
Sbjct: 251 FIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 136/300 (45%), Gaps = 38/300 (12%)

Query: 5   QIPLYQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDK 63
           +I  ++ G++L  GS  KV + ++ T+G  A +  V  S        N +    ++  + 
Sbjct: 22  KIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSST---IVGSND 78

Query: 64  PSL--NTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFM 121
           P L    +  E+  MKLL N+ +V+   D    K N       +++++EY + G L + +
Sbjct: 79  PDLLPYGIEREIIIMKLL-NHTNVLRLYDVWETKSN-------LYMVLEYVEKGELFNLL 130

Query: 122 NTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSV 181
             R    L E+E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG  
Sbjct: 131 VERGP--LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA 186

Query: 182 CGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLC 240
              +       E S          +  Y APE++    GLP    +SD+W+ GV LY L 
Sbjct: 187 A--LESKDKLLETSC--------GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 233

Query: 241 YYTTPF-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
               PF E NG    L        ++ P   + S   + LI  +L   P +R  + ++L+
Sbjct: 234 TGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 99/209 (47%), Gaps = 49/209 (23%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L D + +    R+  DE + + +Q+  G+   H+L+   +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           N+LL   G+ K+ DFG            ++CG                      T  Y A
Sbjct: 159 NILLDKSGDAKLTDFGFTRECMTKTTLETICG----------------------TTVYMA 196

Query: 212 PEMIDL--YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEA----AILHATFQFPNYP 265
           PE+I+   Y G  I    DIW+LGV LY +   + PF+++ E      I+H T Q     
Sbjct: 197 PELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENI 252

Query: 266 QYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
             +D  K LI  +L + P+ RP   Q+L+
Sbjct: 253 VTAD-AKDLILRLLAKNPNDRPTVEQILK 280

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 97/203 (47%), Gaps = 39/203 (19%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++++EYC    L D++ ++  +R+  DE   I +Q+   +   H+L    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSL--SCVHRDLKLE 159

Query: 164 NVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNT-------TAQYRAPEMI- 215
           N+LL      K+ DFG                    D  KNT       T  Y APE++ 
Sbjct: 160 NILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPELLR 202

Query: 216 -DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFE----KNGEAAILHATFQFPNYPQYSDR 270
            + Y G  I    DIWALG+ LY +   T PF+    K  E  I+ A+  + N   ++D 
Sbjct: 203 REKYDGYKI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDN-KYFNDD 257

Query: 271 LKKLITYMLMEQPSQRPNSYQVL 293
              L+  +L + PS RP   Q+L
Sbjct: 258 SIDLVNRLLSKDPSMRPTIEQIL 280

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 112/238 (47%), Gaps = 38/238 (15%)

Query: 31   GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS--------LNTLRAEVDTMKLLRNN 82
            G F  +Y          T   +  +K+V VP+  S        +  L++EV T+K L N+
Sbjct: 1047 GSFGAVYLAL-----NVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
             ++V Y+      F    G Y +FL  EY   G +   +  R+  R  +  I ++  QV 
Sbjct: 1101 VNIVQYLG-----FEEKNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL + G  K+ DF    GI R  +N     Y   D+ 
Sbjct: 1152 EGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNNI----YSNSDMT 1201

Query: 203  KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQ 260
               T  + APEM+D   G     K DIW+LG  + ++     P+  N E  ++ A FQ
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWS-NFE--VVAAMFQ 1254

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L + +   +  R+  DE   + +Q+   +   H+L+   +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGL 221
           N+LL   G  K+ DFG            + VS    + +  TT  Y APE+I    Y G 
Sbjct: 158 NILLDKNGNAKLTDFGFT---------RECVSKSSLETICGTTV-YMAPELIQRQAYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAI-LHATFQFPNYPQ--YSDRLKKLITYM 278
            I    DIW+LGV LY +   T PF+++ E          FPN+     S   K LI  +
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIKRL 263

Query: 279 LMEQPSQRPNSYQVL 293
           L + PS+RP   Q+L
Sbjct: 264 LAKCPSERPTMEQIL 278

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 121/257 (47%), Gaps = 35/257 (13%)

Query: 47  FTNTNVACLKRVIVPDKPS--LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYE 104
           +  TN  C  +V+  D     +  ++ EV  +  L+   ++  Y  S+         + E
Sbjct: 38  YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHYYGSYL-------NNTE 90

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G L   +      ++ E  I  IM ++   IA MH     ++HRDIK  N
Sbjct: 91  LWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAAN 145

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQ---YRAPEMIDLYRGL 221
           VL+T+ G  K+CDFG           A ++S  Q  I + T A    + APE+I    G+
Sbjct: 146 VLITNDGHIKLCDFGV----------AAQLS--QTKIRRQTMAGTPYWMAPEVI--MEGV 191

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPF-EKNGEAAILHATFQFP---NYPQYSDRLKKLITY 277
             D K DIW+LG+  Y++     P+ +     A+   T   P      Q+S  LK+ I  
Sbjct: 192 YYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSSALKEFIAL 251

Query: 278 MLMEQPSQRPNSYQVLE 294
            L E P +RP++ ++L+
Sbjct: 252 CLDEDPKERPSAEELLK 268

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 113/225 (50%), Gaps = 31/225 (13%)

Query: 78  LLRNNAH--VVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEIL 135
           ++R + H  +V++IDS+ AK        +++++MEY + G L D +   L   L E +I 
Sbjct: 668 VMRESKHSNIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHCL---LSEGQIG 717

Query: 136 NIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVS 195
            +  +  +G+  +H+    +LHRDIK +N+LL+ KG  K+ DFG  C  I   +N +  +
Sbjct: 718 AVCRETLKGLQFLHSKG--VLHRDIKSDNILLSLKGNIKLTDFG-FCAQIN-ENNLKRTT 773

Query: 196 YVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAA 253
            V        T  + APE++      P   K DIW+LG+ + ++     P+  E    A 
Sbjct: 774 MVG-------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRAL 823

Query: 254 ILHATFQFPNYPQ---YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
            L AT   P   +    SD L K + + L   PS+R  + ++L++
Sbjct: 824 YLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDD 868

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 105/203 (51%), Gaps = 31/203 (15%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E + E++L++EY D G L D++ ++   +L E E ++   Q+  GI+  H+ +  + HRD
Sbjct: 205 ENNNELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRD 260

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA--QYRAPEMI- 215
           +K EN+LL  K    K+ DFG           A +VS   + +++ +     Y +PE++ 
Sbjct: 261 LKPENLLLDKKRRIIKIADFGMA---------ALQVS---NRLLQTSCGSPHYASPEIVM 308

Query: 216 -DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDR 270
              Y G P    SDIW+ G+ L+ L     PF  +    +L    +  +Q P+Y   S  
Sbjct: 309 GKCYNGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQE 362

Query: 271 LKKLITYMLMEQPSQRPNSYQVL 293
            K LI+ +L+  PS+R ++ Q+L
Sbjct: 363 AKNLISRILVVDPSKRISTEQIL 385

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 136/311 (43%), Gaps = 37/311 (11%)

Query: 11  PGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLR 70
           P +L+           +L  GGFA+ + ++      F    VA   ++ +  + +   L 
Sbjct: 84  PPSLIKTRGRDYHRGHFLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLL 140

Query: 71  AEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLR 130
           +E+   K +++  ++V +ID         E    V++L+E C  G L+D +  R  + L 
Sbjct: 141 SEIQIHKSMKH-VNIVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KSLT 190

Query: 131 EDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSN 190
           E E+    +Q+   I  MH+    ++HRD+K+ N+    K   K+ DFG    +    +N
Sbjct: 191 EPEVRFFTTQICGAIKYMHS--RKVIHRDLKLGNIFFDRKYNLKIGDFGLAATL----AN 244

Query: 191 AQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG 250
            +E  Y         T  Y APE++ + +      + DIW++GV +Y L     PF+   
Sbjct: 245 DRERKYTV-----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKD 298

Query: 251 EAAILHAT----FQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV--------SS 298
              I        F FP     S   K LI  +L   P +RP+  ++++ +        S+
Sbjct: 299 VNTIYERIKCRDFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPST 358

Query: 299 MQNVQCPIPNF 309
            ++V   +PN+
Sbjct: 359 KESVMVEVPNY 369

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 100/201 (49%), Gaps = 27/201 (13%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY D G L D++ ++   +L E E ++  +Q+ QG++  H+ +  + HRD
Sbjct: 196 ENKSELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRD 251

Query: 160 IKIENVLLTSKGEY-KVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--D 216
           +K EN+LL  K +  K+ DFG     +  P+   E S          +  Y +PE++   
Sbjct: 252 LKPENLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGK 301

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF  +    +L       FQ P  P  ++  K
Sbjct: 302 PYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTNDAK 355

Query: 273 KLITYMLMEQPSQRPNSYQVL 293
            LIT +L+  P +R    ++L
Sbjct: 356 DLITRILVTNPEKRLTINEIL 376

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 94/207 (45%), Gaps = 47/207 (22%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L D + +    R+   E   + +Q++  +   H++H   +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           N+LL   G  K+ DFG            +VCG                      T  Y A
Sbjct: 162 NILLDKNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMID--LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAI-LHATFQFPNYPQ-- 266
           PE+I+   Y G  I    DIW+LGV LY L   + PF+ + E         + PNY    
Sbjct: 200 PELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDDDDEVKTKWKIVNEEPNYDSTL 255

Query: 267 YSDRLKKLITYMLMEQPSQRPNSYQVL 293
             D  K LI+ +L + P +RP+  QVL
Sbjct: 256 IPDDAKDLISRLLAKNPKERPSLPQVL 282

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 128/298 (42%), Gaps = 43/298 (14%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAH-- 84
           +L  GGFA+ + ++    D F    VA   +  +  + +   L +E+   K +   AH  
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM---AHPN 140

Query: 85  VVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQG 144
           +V +ID         E    V++L+E C  G L++ +  R  + L E E+    +Q+   
Sbjct: 141 IVQFIDCF-------EDDSNVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGA 191

Query: 145 IAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKN 204
           I  MH+    ++HRD+K+ N+   S    K+ DFG    +    +N  E  Y        
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----C 240

Query: 205 TTAQYRAPE-MIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT----F 259
            T  Y APE ++  + G   +   DIW+LGV LY L     PF+      I        F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 260 QFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV--------SSMQNVQCPIPNF 309
            FP     SD  K LI  +L   P +RP+  ++++ V        S    V   +PNF
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVPNF 356

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 124/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++      F    VA L    +  + +   L +E+   K +R+ A++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRH-ANIV 161

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            +ID    + N       V++L+E C  G L++ +  R  + L E E+    +Q+  GI 
Sbjct: 162 QFIDCFEDETN-------VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG    +    +N +E  Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 261

Query: 207 AQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH----ATFQFP 262
             Y APE++ + +      + DIW++GV +Y L     PF+      I        F FP
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 NYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
                S   + L+  +L   P +RP+  +VL+ V
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 102/198 (51%), Gaps = 29/198 (14%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L + +     +R+  DE   + +Q+   I   H+L+   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHLLA--LKRISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLE 157

Query: 164 NVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRGL 221
           N+LL  KG  K+ DFG            + VS  Q D +  TT  Y APE+ +   Y G 
Sbjct: 158 NILLDKKGNAKLTDFGFT---------RECVSKSQLDTICGTTV-YMAPELTERKSYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN-YPQYSDRL-----KKLI 275
            I    DIWALGV LY +   + PF+++ EA      ++  N  P+ ++ L     K LI
Sbjct: 208 KI----DIWALGVILYTMINGSMPFDEDDEAK---TKWKIVNEMPEINEDLVSPDAKDLI 260

Query: 276 TYMLMEQPSQRPNSYQVL 293
             +L + P++RP+  ++L
Sbjct: 261 EQLLAKDPNERPSIEKIL 278

>Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {ON}
           complement(67104..68684) [1581 nt, 527 aa]
          Length = 526

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 120/255 (47%), Gaps = 46/255 (18%)

Query: 65  SLNTLRAEVDTMK-----LLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGG--- 116
           ++NTL  + +  K     L  N +    YI  +   F  +E +  +F+ MEY  MGG   
Sbjct: 266 TINTLNTDPEYQKQIFRELQFNKSFKSDYIVRYYGMFT-DESNSSIFIAMEY--MGGRSL 322

Query: 117 ---LIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEY 173
               ++ +N  L  R+ E  +  I   V +G++ +H     ++HRDIK +N+LL  KG+ 
Sbjct: 323 DAIYLNLLN--LGGRIGEKVLGKIAESVLRGLSYLHERK--VIHRDIKPQNILLNEKGQV 378

Query: 174 KVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALG 233
           K+CDFG V G      N+   ++         T+ Y APE I   +G P     D+W+LG
Sbjct: 379 KLCDFG-VSG---EAVNSLATTFT-------GTSFYMAPERI---QGQPYSVTCDVWSLG 424

Query: 234 VFLYKLCYYTTPFEKNG--------EAAILHATF--QFPNYPQ----YSDRLKKLITYML 279
           + L ++     PF  +         E  +L  TF  Q  + P+    +S   K  I Y L
Sbjct: 425 LTLLEVAQAKFPFGSDKMTATIAPIELLMLILTFSPQLKDEPELNIVWSKSFKSFIEYCL 484

Query: 280 MEQPSQRPNSYQVLE 294
            + PS+RP+  Q+++
Sbjct: 485 KKDPSERPSPRQMIQ 499

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/298 (27%), Positives = 135/298 (45%), Gaps = 44/298 (14%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNV-ACLKRVIVPDKPSL 66
           ++ G  L +GS  KVQ+    ++G  A I  +  +    F N N  A    ++ PD    
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAV---FNNDNANASDSALLTPDSLPY 76

Query: 67  NTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQ 126
              R E+  MKLL N+ +V+   D      N       +++++EY + G L +     L 
Sbjct: 77  GIER-EIIIMKLL-NHPNVLRLYDVWETDSN-------LYMVLEYAEKGELFNL----LV 123

Query: 127 ER--LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGI 184
           ER  L E+E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG     
Sbjct: 124 ERGPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFG--MAA 179

Query: 185 IRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRGLPIDEKSDIWALGVFLYKLCYY 242
           +       E S          +  Y APE+I    Y GL    ++D+W+ G+ L+ L   
Sbjct: 180 LETEDKLLETSC--------GSPHYAAPEIISGLPYHGL----ETDVWSCGIILFALLTG 227

Query: 243 TTPF-EKNGEA-----AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
             PF E++G        +    F+ P   + S   + LI+ +L   P +R  + ++L+
Sbjct: 228 RLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 133/271 (49%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  MK  R+  ++V++I
Sbjct: 633 SGGVYTAYEIG-------TNVSVA-IKQMNLEKQPKKELIINEILVMKGSRH-PNIVNFI 683

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  K        +++++MEY + G L D +   +   L E +I  +  +   G+  +H
Sbjct: 684 DSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLKFLH 733

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    +LHRDIK +N+LL+ +G+ K+ DFG  C  I       E++  +  ++   T  +
Sbjct: 734 SKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI------NELNLKRTTMVG--TPYW 782

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 783 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 839

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
              S  LKK + + L  +P +R ++ ++L +
Sbjct: 840 ENLSSSLKKFLDWCLCVEPEERASATELLHD 870

>KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.652
           YOR231W
          Length = 493

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 121/254 (47%), Gaps = 44/254 (17%)

Query: 65  SLNTLRAEVDTMK-----LLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGL-I 118
           ++NTL  + +  K     LL N +   +YI  +   F  +EG+  ++L MEY  MGG  +
Sbjct: 231 TINTLNTDPEFQKQLFRELLFNKSFKSAYIVRYYGMFT-DEGNSLIYLAMEY--MGGRSL 287

Query: 119 DFMNTRLQER---LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKV 175
           D +   L +R   + E  +  I   V +G++ +H     ++HRDIK +N+L+   GE K+
Sbjct: 288 DAVYRNLLKRGGRISEKVLGKISESVLRGLSYLH--EKKVIHRDIKPQNILINELGEVKL 345

Query: 176 CDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVF 235
           CDFG V G      N+   ++         T+ Y APE I   +G P     D+W+LG+ 
Sbjct: 346 CDFG-VSG---EAVNSLATTFTG-------TSFYMAPERI---QGQPYSVTCDVWSLGLT 391

Query: 236 LYKLCYYTTPFEKNG----------EAAILHATF--QFPNYPQ----YSDRLKKLITYML 279
           + ++     PF+ +           E  +L  TF  +  + P+    +SD  K  I Y L
Sbjct: 392 ILEVAKGKFPFDSDKVQDNANIAPIELLVLILTFTPELKDEPENDIFWSDSFKSFIEYCL 451

Query: 280 MEQPSQRPNSYQVL 293
            + P  RP+  Q+L
Sbjct: 452 KKDPGDRPSPRQML 465

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 88/183 (48%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +    +  + E E   I  QV  GI  +H  H  ++HRDIK ENV++ SKG  K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P +     +V        T  Y APE++  + Y G P     DIWAL
Sbjct: 1301 IIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLSGEPYEGKP----QDIWAL 1345

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQV 292
            G+ LY + +   PF    E  IL    +F +  + ++   +LI  +L+ Q   RP   ++
Sbjct: 1346 GILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEI 1403

Query: 293  LEE 295
             ++
Sbjct: 1404 FDD 1406

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 102/204 (50%), Gaps = 31/204 (15%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY D G L D++ ++   +L E E +    Q+ +G+   H+ +  + HRD
Sbjct: 230 ENKNELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRD 285

Query: 160 IKIENVLLTSKGEY-KVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA--QYRAPEMI- 215
           +K EN+LL  K +  K+ DFG           A +VS   + ++K +     Y +PE++ 
Sbjct: 286 LKPENLLLDKKRKLIKIADFGMA---------ALQVS---NTLLKTSCGSPHYASPEIVM 333

Query: 216 -DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDR 270
              Y G P    SD+W+ G+ L+ L     PF  +    +L    +  +Q PNY   S  
Sbjct: 334 GKTYNGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKD 387

Query: 271 LKKLITYMLMEQPSQRPNSYQVLE 294
            K LI+ +L+  P  R  + Q+LE
Sbjct: 388 AKDLISRILLVNPKARLTTEQILE 411

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 135/298 (45%), Gaps = 45/298 (15%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRV--IVPDKPS 65
           ++ G  L +GS  KVQ+ +  ++G   Q   V++     F   NV+    V    PD   
Sbjct: 19  WKLGETLGLGSTGKVQLARNKSTG---QEAAVKVISKTVFNTGNVSGTSIVGSTTPDALP 75

Query: 66  LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
               R E+  MKLL N+ +V+   D         E + +++L++EY + G L +     L
Sbjct: 76  YGIER-EIIIMKLL-NHPNVLRLYDVW-------ETNADLYLVLEYAEKGELFNL----L 122

Query: 126 QER--LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCG 183
            ER  L E+E +    Q+  G++  HAL   ++HRD+K EN+LL  K   K+ DFG    
Sbjct: 123 VERGPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA- 179

Query: 184 IIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRGLPIDEKSDIWALGVFLYKLCY 241
            +       E S          +  Y APE++    Y+G      SD+W+ GV L+ L  
Sbjct: 180 -LETEGKLLETSC--------GSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFALLT 226

Query: 242 YTTPF-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
              PF E++G    L        F+ P+  + S   + LI+ +L   P +R  +  +L
Sbjct: 227 GRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDIL 284

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 87/183 (47%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +    +  + EDE   I  QV  G+  +H+L   ++HRDIK ENV++ SKG  K
Sbjct: 1131 GCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSL--GIVHRDIKDENVIIDSKGYVK 1188

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y APE++  + Y G P     DIWAL
Sbjct: 1189 IIDFGSAAYVKNGP----------FDVFVGTI-DYAAPEVLAGNPYEGKP----QDIWAL 1233

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQV 292
            G+ LY + +   PF    E  I+     F N    +    +LI  ML++   +RP+  +V
Sbjct: 1234 GILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINEV 1291

Query: 293  LEE 295
              +
Sbjct: 1292 FSD 1294

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 132/293 (45%), Gaps = 38/293 (12%)

Query: 9   YQPGTLLTVGSHKVQVVKY-LTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
           ++ G+ L VGS    V+ Y  T G  A +  +  S  +   +T +      ++P      
Sbjct: 17  WKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLP-----Y 71

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
            +  E+  MKLL N+ +V+   D         E S ++++++EY + G L + +  R   
Sbjct: 72  GIEREIIIMKLL-NHPNVLRLYDVW-------ETSKDLYMVLEYVEKGELFNLLVERGP- 122

Query: 128 RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            L E+E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG     +  
Sbjct: 123 -LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAA--LES 177

Query: 188 PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTTPF 246
                E S          +  Y APE++    GLP    +SD+W+ GV LY L     PF
Sbjct: 178 KDKLLETSC--------GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPF 226

Query: 247 -EKNGEA-----AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
            E++G        +    F+ P   + S   + LI  +L   P QR  + ++L
Sbjct: 227 DEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREIL 279

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 135/296 (45%), Gaps = 41/296 (13%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVI--VPDKPS 65
           ++ G  L +GS  KVQ+ +  ++G   Q   V++     F + NV+    V    PD   
Sbjct: 19  WKLGETLGLGSTGKVQLARNKSTG---QEAAVKVISKAVFNSGNVSGTSIVGSNTPDALP 75

Query: 66  LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
               R E+  MKLL N+ +V+   D         E + +++L++EY + G L + +  R 
Sbjct: 76  YGIER-EIIIMKLL-NHPNVLRLYDVW-------ETNTDLYLVLEYAEKGELFNLLVERG 126

Query: 126 QERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGII 185
              L E+E +    Q+  G++  HAL   ++HRD+K EN+LL  K   K+ DFG     +
Sbjct: 127 P--LPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA--L 180

Query: 186 RPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRGLPIDEKSDIWALGVFLYKLCYYT 243
                  E S          +  Y APE++    Y+G      SD+W+ GV L+ L    
Sbjct: 181 ETEGKLLETSC--------GSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFALLTGR 228

Query: 244 TPF-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
            PF E++G    L        F+ P+  + S   + LI+ +L   P +R  +  +L
Sbjct: 229 LPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDIL 284

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 133/271 (49%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  MK  ++  ++V++I
Sbjct: 610 SGGVYTAYEIG-------TNVSVA-IKQMNLEKQPKKELIINEILVMKGSKH-PNIVNFI 660

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  K        +++++MEY + G L D +   +   L E +I  +  +   G+  +H
Sbjct: 661 DSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLKFLH 710

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    +LHRDIK +N+LL+ +G+ K+ DFG  C  I       E++  +  ++   T  +
Sbjct: 711 SKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI------NELNLKRTTMVG--TPYW 759

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 760 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 816

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
              S  LKK + + L  +P +R ++ ++L +
Sbjct: 817 ENLSSSLKKFLDWCLCVEPEERASATELLHD 847

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 100/200 (50%), Gaps = 33/200 (16%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           V++ +EYC    L +++  +    L  +E   + SQ+   +   H++    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPL--EECSELFSQIVGAVYYAHSM--KCVHRDLKLEN 158

Query: 165 VLLTSKGEYKVCDFG-----SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL-- 217
           +LL  KG  K+ DFG     +  GI+              + +  TT  Y APE+I+   
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGIL--------------ETICGTTV-YMAPELIERKP 203

Query: 218 YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQF-PNYP-QYSD-RLKKL 274
           Y G  I    D W+LG+ LY + + T PF++  E    +    + P Y   Y D   K+L
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKEL 259

Query: 275 ITYMLMEQPSQRPNSYQVLE 294
           I+ +L + P+QRP+  QVL+
Sbjct: 260 ISQLLEKDPNQRPSLTQVLQ 279

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 82/174 (47%), Gaps = 20/174 (11%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +   L+  + E E   I  QV   I  +H+    ++HRDIK ENV++ SKG  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y APE++    G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  VFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRP 287
            V LY + +   PF    E  IL    +F      S+    LI  +L + PSQRP
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRP 1249

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 127/290 (43%), Gaps = 29/290 (10%)

Query: 11  PGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLR 70
           P +L+           +L  GGFA+ + ++      F    VA   ++ +  + +   L 
Sbjct: 80  PPSLIKTRGRDYHRGHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLL 136

Query: 71  AEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLR 130
           +E+   K +R+  +VV +ID         E    V++L+E C  G L++ +  R    + 
Sbjct: 137 SEIQIHKSMRH-FNVVQFIDCF-------EDDTNVYILLEICPNGSLMELLKKR--RTVT 186

Query: 131 EDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSN 190
           E E+   M+Q+   I  MH+    ++HRD+K+ N+        K+ DFG    +    +N
Sbjct: 187 EPEVRYFMTQICGAIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----AN 240

Query: 191 AQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG 250
            +E  Y         T  Y APE++ + +      + DIW++GV +Y L     PF+   
Sbjct: 241 DRERKYTV-----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKD 294

Query: 251 EAAILHAT----FQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
              I        F FP     S+  K LI  +L   P +RP+  ++++ V
Sbjct: 295 VNMIYERIKNRDFAFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 146/324 (45%), Gaps = 58/324 (17%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
           ++ G  L  GS  KVQ+ ++  +G   Q   V++ P   F +         ++P     N
Sbjct: 21  WKLGETLGFGSTGKVQLARHERTG---QKTAVKVIPKSIFKSEGSHGNNDSVLP----FN 73

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTR--L 125
             R E+  MKLL ++ +V+S  D      N       ++L++EY + G L + +  R  L
Sbjct: 74  IER-EIVIMKLL-SHPNVLSLYDVWETDNN-------LYLILEYAEKGELFNLLVDRGPL 124

Query: 126 QERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGII 185
            ER    E +    Q+   I+  HAL   ++HRD+K EN+LL +    K+ DFG     +
Sbjct: 125 PER----EAIKCFKQIIIAISYCHAL--GIVHRDLKPENLLLDNSYNIKIADFGMAA--L 176

Query: 186 RPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTT 244
           +  +   E S          +  Y APE++    GLP +   SD+W+ GV L+ L     
Sbjct: 177 QTDAGMLETSC--------GSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRL 225

Query: 245 PF-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRP----------- 287
           PF E+NG    L        F+ PN  + S   + LI  +L+  P+QR            
Sbjct: 226 PFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285

Query: 288 NSYQVLEEVSSMQNVQCPIPNFYL 311
             YQ +++  S++++  P  N YL
Sbjct: 286 KKYQTIKDSKSIKDL--PRENTYL 307

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 122/274 (44%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++      F    VA L    +  + +   L +E+   K +++  +VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKHQ-NVV 142

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            +ID         E    V++L+E C  G L+D +  R  + L E E+    +Q+   I 
Sbjct: 143 QFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG    +    +N +E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 242

Query: 207 AQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH----ATFQFP 262
             Y APE++ + +      + DIW++GV LY L     PF+      I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 263 NYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
                S+  K LI  +L   P +RP+  ++++ V
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 132/299 (44%), Gaps = 42/299 (14%)

Query: 5   QIPLYQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDK 63
           Q+  ++ G  L +GS  KVQ+    T+G  A I  +  S      N N A    +  PD 
Sbjct: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS----VFNNNSAQSSSLTTPDA 69

Query: 64  PSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNT 123
                 R E+  MKLL N+ +V+   D      N       +++++EY + G L +    
Sbjct: 70  LPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSN-------LYMVLEYAEKGELFNL--- 117

Query: 124 RLQER--LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSV 181
            L E+  L+E E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG  
Sbjct: 118 -LVEKGPLQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFG-- 172

Query: 182 CGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLC 240
              +       E S          +  Y APE++    G+P     SD+W+ GV L+ L 
Sbjct: 173 MAALETEDKLLETSC--------GSPHYAAPEIVS---GIPYHGFASDVWSCGVILFALL 221

Query: 241 YYTTPF-EKNGEA-----AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
               PF E++G        +    F+ P+  + S   + L+  +L   P +R  +  +L
Sbjct: 222 TGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDIL 280

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 132/300 (44%), Gaps = 46/300 (15%)

Query: 12  GTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRA 71
           GTL      KV++ + LT+GG   I  +     ++F   N   L+  +  + P +   R 
Sbjct: 54  GTLGNGQYGKVKLARDLTTGGLVAIKIL-----NRFEKKNGYSLQGTV--ENPRI---RE 103

Query: 72  EVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLRE 131
           E++ MK   ++ +VV   D      N  E S +V+L++EYC  G +      +L+ +   
Sbjct: 104 EIEIMKRC-HHENVVKLYD----ILNDPE-STKVYLVLEYCSRGPVKWCPENQLEIKAVG 157

Query: 132 DEILN------IMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGII 185
             IL       I+S V  G+  +H+    + HRDIK  N+L++S G  K+ DFG     I
Sbjct: 158 PSILTFEQARKIVSDVVSGLEYLHS--QGITHRDIKPSNLLISSNGAVKISDFGVS---I 212

Query: 186 RPPSNAQEVSYVQHDIMKNTTA---QYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYY 242
              + +  +   Q  I K+ T     + APE+             DIW+LGV LY + + 
Sbjct: 213 LTTTGSTNIQSSQEQISKSKTLGTPAFFAPELCTADGDYRCSSAIDIWSLGVTLYCMLFG 272

Query: 243 TTPFEKNGEAA----ILHATFQFPNYPQYSDR------------LKKLITYMLMEQPSQR 286
           T PF  N        I+     FP+Y Q S R             K ++  +L + PS+R
Sbjct: 273 TLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDAKDILNRLLKKNPSER 332

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 127/272 (46%), Gaps = 40/272 (14%)

Query: 31  GGFAQIYTVQISPPDKFTNTNVACLKRVIV---PDKPSLNTLRAEVDTMKLLRNNAHVVS 87
           G F  +Y         F  TN A +   +V     +  ++ L  E+  +  LR+  ++ +
Sbjct: 24  GNFGDVYKA-------FDKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITN 75

Query: 88  YIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAA 147
           YI +     +       ++++MEYC  G   D + T     L E+++  I  +V +G+  
Sbjct: 76  YITTMIEDVS-------MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKY 128

Query: 148 MHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA 207
           +H      +HRDIK  N+LLT +G+ K+ DFG V G IR  +  +  ++V        T 
Sbjct: 129 LHDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIR--ATMKRGTFV-------GTP 176

Query: 208 QYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN---- 263
            + APE+++       +EK+DIW+LG+ +Y+L     P  K     ++      P     
Sbjct: 177 YWMAPEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVM---VSLPRRKPP 232

Query: 264 --YPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
             + QYSD  K  +   L++ P+ RP++  +L
Sbjct: 233 KLHGQYSDVAKGFVAACLVKDPNLRPSAEMLL 264

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 129/296 (43%), Gaps = 39/296 (13%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++    + F    VA   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            +ID         E    V++L+E C  G L++ +  R  + L E E+    +Q+   I 
Sbjct: 143 QFIDCF-------EDDSNVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   S    K+ DFG    +    +N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----CGT 242

Query: 207 AQYRAPE-MIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT----FQF 261
             Y APE ++  + G   +   DIW+LGV LY L     PF+      I        F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV--------SSMQNVQCPIPNF 309
           P     SD  K LI  +L   P +RP+  ++++ V        S    V   +PNF
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPATVMSEVPNF 356

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 123/273 (45%), Gaps = 41/273 (15%)

Query: 31  GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS--LNTLRAEVDTMKLLRNNAHVVSY 88
           G F  +Y         +T T   C  +V+  D     +  ++ E+  +  L+   ++  Y
Sbjct: 28  GKFGVVYK------GYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAM 148
             S+           +++++MEYC  G L   +      ++ E  I  IM ++    A M
Sbjct: 82  YGSYL-------NDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALM 129

Query: 149 HALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQ 208
           H     ++HRDIK  NVL+T+ G  K+CDFG           A ++S  Q  I + T A 
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGV----------AAQLS--QTKIRRQTMAG 177

Query: 209 ---YRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKNGEAAILHATFQFP-- 262
              + APE+I    G+  D K DIW+LG+  Y++     P+ E     A+   T   P  
Sbjct: 178 TPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPR 235

Query: 263 -NYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
               Q+S  LK++I   L E P +RP++  +L+
Sbjct: 236 LEGRQHSSALKEIIALCLDEDPKERPSAEDLLK 268

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 132/271 (48%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y V        TN +VA +K++ +  +P    +  E+  MK  ++ A++V++I
Sbjct: 678 SGGVYTAYEVG-------TNASVA-IKQMNLEKQPKKELIINEILVMKASKH-ANIVNFI 728

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  +        +++++MEY + G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 729 DSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 778

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    ++HRDIK +NVLL+  GE K+ DFG  C  I       E++  +  ++   T  +
Sbjct: 779 S--KGVIHRDIKSDNVLLSMSGEIKLTDFG-FCAQI------NEINLKRTTMV--GTPYW 827

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFP---NY 264
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 828 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDA 884

Query: 265 PQYSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
              SD LK  + + L   P +R  + Q+L +
Sbjct: 885 DSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 88/322 (27%), Positives = 143/322 (44%), Gaps = 54/322 (16%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
           ++ G  L  GS  KVQ+ ++  +G    +  +  S    F N         ++P      
Sbjct: 21  WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSI---FNNNGNHSNDDSVLP-----Y 72

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
            +  E+  MKLL ++ +V+S  D      N       ++L++EY + G L + +      
Sbjct: 73  NIEREIVIMKLL-SHPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVD--HG 122

Query: 128 RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            L E E +N   Q+  GI+  HAL   ++HRD+K EN+LL S    K+ DFG     ++ 
Sbjct: 123 PLPEREAINCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFGMAA--LQT 178

Query: 188 PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTTPF 246
            ++  E S          +  Y APE++    GLP +   SD+W+ GV L+ L     PF
Sbjct: 179 DADLLETSC--------GSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPF 227

Query: 247 -EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRP-----------NS 289
            E+NG    L        F+ PN  + S   + LI  +L+  P QR              
Sbjct: 228 DEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKK 287

Query: 290 YQVLEEVSSMQNVQCPIPNFYL 311
           YQ +++  S++++  P  N YL
Sbjct: 288 YQTIKDSKSIKDL--PRENTYL 307

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 134/296 (45%), Gaps = 41/296 (13%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRV--IVPDKPS 65
           ++ G  L +GS  KVQ+ +  ++G   Q   V++     F   N++    V  I PD   
Sbjct: 19  WKLGETLGLGSTGKVQLARNKSTG---QEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75

Query: 66  LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
               R E+  MKLL N+ +V+   D         E + +++L++EY + G L + +  R 
Sbjct: 76  YGIER-EIIIMKLL-NHPNVLRLYDVW-------ETNTDLYLVLEYAEKGELFNLLVERG 126

Query: 126 QERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGII 185
              L E+E +    Q+  G++  HAL   ++HRD+K EN+LL  K   K+ DFG     +
Sbjct: 127 P--LPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA--L 180

Query: 186 RPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRGLPIDEKSDIWALGVFLYKLCYYT 243
                  E S          +  Y APE++    Y+G      SD+W+ GV L+ L    
Sbjct: 181 ETEGKLLETSC--------GSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFALLTGR 228

Query: 244 TPF-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
            PF E++G    L        F+ P+  + S   + LI  +L   P +R  +  +L
Sbjct: 229 LPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDIL 284

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 101/204 (49%), Gaps = 33/204 (16%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY D G L D++ +R   +L E E ++   Q+ QG+A  HA +  + HRD
Sbjct: 169 ENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRD 224

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA---QYRAPEMI 215
           +K EN+LL  K +  K+ DFG           A EVS    D + +T+     Y +PE++
Sbjct: 225 LKPENLLLDKKNKIIKIADFGMA---------ALEVS----DKLLSTSCGSPHYASPEIV 271

Query: 216 --DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSD 269
               Y G P    +D+W+ G+ L+ L     PF  +    +L       +  P+    S 
Sbjct: 272 MGKSYHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPS--DLSP 325

Query: 270 RLKKLITYMLMEQPSQRPNSYQVL 293
             K LI+ +L+  P +R  + ++L
Sbjct: 326 DAKDLISKILVVDPDKRLTTTEIL 349

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 102/199 (51%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L D++   +  R+  DE   + +Q+   +   H+L+   +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGL 221
           N+LL  +G  K+ DF    G  R  +   ++  +        T  Y APE++  D Y G 
Sbjct: 158 NILLDMQGNAKLADF----GFTRECATKNQLETIC------GTTVYMAPELLRRDTYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN-YPQYSDRLK-----KLI 275
            I    DIW+LGV LY L   + PF++  E       ++  N  P Y++++      +LI
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDET---RTEWKIINEEPDYNEKIFNANSIELI 260

Query: 276 TYMLMEQPSQRPNSYQVLE 294
             +L++ P +RP+  ++L+
Sbjct: 261 KSLLIKDPKKRPSMTEILK 279

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 139/302 (46%), Gaps = 56/302 (18%)

Query: 4   PQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDK 63
           P+ P  Q   L  +G           SGG   +YT      ++  +  +  +K++ +  +
Sbjct: 510 PEDPTKQYANLTKIGQG--------ASGG---VYTA-----NQVKSNELVAIKQMDLEKQ 553

Query: 64  PSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNT 123
           P    +  E+  MK  R+N +VV++I++H +K N       ++++MEY + G L D +  
Sbjct: 554 PKKELILNEIIVMKESRHN-NVVNFINAHLSKGN-------LWIVMEYMEGGSLTDVVTH 605

Query: 124 RLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCG 183
            L   L E +I  +  +  +G+  +H+    ++HRDIK +NVLL+ KG+ K+ DFG  C 
Sbjct: 606 CL---LSEGQIGAVCRETLEGLKFLHS--KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCA 659

Query: 184 IIRPPSNAQEVSYVQHDIMKNTTAQ-----YRAPEMIDLYRGLPIDEKSDIWALGVFLYK 238
            I             +DI  N T       + APE++      P   K DIW+LG+ + +
Sbjct: 660 QI-------------NDIDLNRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIE 703

Query: 239 LCYYTTPF--EKNGEAAILHATFQFPNYPQ---YSDRLKKLITYMLMEQPSQRPNSYQVL 293
           +     P+  E   +A  L AT   P   +    SD     +   L  +P +R ++ ++L
Sbjct: 704 MIEGEPPYLNEAPLKALYLIATNGTPKLKEPENLSDVFSNFLDRCLRVEPEERASAIELL 763

Query: 294 EE 295
            +
Sbjct: 764 AD 765

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 133/294 (45%), Gaps = 38/294 (12%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
           +  G  L VGS  KV + + + +G  A +  +  S  +   +T V      ++P      
Sbjct: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLP-----Y 74

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
            +  E+  MKLL N+ +V+   D         E S ++++++EY + G L + +  R   
Sbjct: 75  GIEREITIMKLL-NHPNVLRLYDVW-------ETSTDLYMVLEYVEKGELFNLLIERGP- 125

Query: 128 RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            L E+E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG     +  
Sbjct: 126 -LPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMAA--LES 180

Query: 188 PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTTPF 246
                E S          +  Y APE++    GLP    +SD+W+ GV LY L     PF
Sbjct: 181 KDKLLETSC--------GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPF 229

Query: 247 -EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
            E +G    L        F+ P+  + S   + LI  +L   PS R  + ++L+
Sbjct: 230 DEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 99/203 (48%), Gaps = 31/203 (15%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY D G L D++ +R   RL E E ++   Q+ QG++  HA +  + HRD
Sbjct: 186 ENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRD 241

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA--QYRAPEMI- 215
           +K EN+LL  K    K+ DFG           A EVS   + +++ +     Y +PE++ 
Sbjct: 242 LKPENLLLDKKNSTIKIADFGMA---------ALEVS---NKLLQTSCGSPHYASPEIVM 289

Query: 216 -DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDR 270
              Y G P    SD+W+ G+ L+ L     PF  +    +L       +Q P     S  
Sbjct: 290 GKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQ--NLSKE 343

Query: 271 LKKLITYMLMEQPSQRPNSYQVL 293
            + LI  +L   P++R  + ++L
Sbjct: 344 AQDLIAKILTVNPAKRLTTEEIL 366

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 123/275 (44%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++    + F    VA   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            +ID         E    V++L+E C  G L++ +  R  + L E E+    +Q+   I 
Sbjct: 143 QFIDCF-------EDDSNVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   S    K+ DFG    +    +N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----CGT 242

Query: 207 AQYRAPE-MIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT----FQF 261
             Y APE ++  + G   +   DIW+LGV LY L     PF+      I        F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
           P     SD  K LI  +L   P +RP+  ++++ V
Sbjct: 301 PRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 98/196 (50%), Gaps = 22/196 (11%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +     + + E ++  I+    +G+  +H      +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPID 224
           +LLT  G+ K+ DFG V G IR  +  +  ++V        T  + APE+I+  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIR--ATMKRGTFVG-------TPYWMAPEVIN-KQCKGYN 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN------YPQYSDRLKKLITYM 278
           EK+DIW+LG+  Y+L     P  K     ++      P       + QYS++ K  ++  
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVM---LNIPKRKPPKLHGQYSEKAKYFVSLC 249

Query: 279 LMEQPSQRPNSYQVLE 294
           L++ P QRP+   +LE
Sbjct: 250 LIKDPKQRPSIEALLE 265

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 138/306 (45%), Gaps = 28/306 (9%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++M+YC  G   D +       + E+++  I+  V  G+  +H      +HRDIK  N
Sbjct: 87  MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLH--EQKKIHRDIKAAN 144

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPID 224
           +LLT  G+ K+ DFG V G I+  +  +  ++V        T  + APE+I+       D
Sbjct: 145 ILLTDDGQVKLGDFG-VSGQIK--ATLKRDTFV-------GTPYWMAPEVINKEINNGYD 194

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQF---PNYPQYSDRLKKLITYMLME 281
           EK DIW+LG+  Y+L     P  K     ++ +  +      +  Y+D  K  I++ L++
Sbjct: 195 EKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIK 254

Query: 282 QPSQRPNSYQVLEEVSSMQNVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQP 341
            P  RPN  Q L +   +      I N   +  +V    +  + + + NG  +  P    
Sbjct: 255 DPKLRPN-VQNLLKTDFIFKFNGKIKN---LQKDV---DLCKKIKNKENGNFIKKPKF-- 305

Query: 342 YVPNNNFVYNTPNAVSMNDIQMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQPVQKSQ 401
             P N   YNT +     +I   N I+   +  +N+ +I PT  +++     + P+  S 
Sbjct: 306 --PINEKFYNTNDRKEPKEIWDFNTIHSMKSIKNNSSLISPT--SDLHSLKQLSPISNSS 361

Query: 402 TLPVSS 407
            L  +S
Sbjct: 362 QLQNAS 367

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 114/239 (47%), Gaps = 34/239 (14%)

Query: 9    YQPGTLLTVGSH-KVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
            +  G ++  GS   V +   +T+G    +  V++    K+++ N A L  V         
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVP---KYSSQNEAILSTV--------E 1223

Query: 68   TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
             LR+EV T+K L ++ ++V Y+      F   +  Y +FL  EY   G +   +  R+  
Sbjct: 1224 ALRSEVSTLKDL-DHLNIVQYLG-----FENKDNIYSLFL--EYVAGGSVGSLI--RMYG 1273

Query: 128  RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            R  E  I ++ +QV +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI R 
Sbjct: 1274 RFDEPLIKHLTTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRK 1327

Query: 188  PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
              +     Y   D+    T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1328 SKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1380

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 116  GLIDFMNT-RLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G +D  +    +  + E E   I  Q+  GI  +H     ++HRDIK ENV++ SKG  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKS-DIWALG 233
            + DFGS   +   P +     +V        T  Y APE++    G P + KS DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 234  VFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
            + LY L Y   PF    E  IL    +F +    S   K LIT +L     +RP   ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 294  EEV 296
            ++V
Sbjct: 1200 QDV 1202

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/340 (22%), Positives = 144/340 (42%), Gaps = 59/340 (17%)

Query: 10  QPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVP--DKPSLN 67
           QP + ++V  H+  + + L  GGF+ +Y V+           +  LK++  P     S++
Sbjct: 15  QP-SYVSVNGHRYHIKRLLGEGGFSFVYLVE------SRENGLMALKKIRCPFGSIGSIS 67

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
               EVD  +  ++  ++   IDS   +    +GS  V++L+ Y   G L D +N  L +
Sbjct: 68  PAMKEVDNYQKFKS-PYIAQIIDSQVVQ--ERDGSKTVYILLPYFSKGSLQDEINRHLLD 124

Query: 128 --RLREDEILNIMSQVTQGIAAMHAL---------------------------------- 151
             ++ E E++ +   V +G+  +H                                    
Sbjct: 125 CTQVPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGE 184

Query: 152 -HPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYR 210
            H    H DIK  N++++S+G   + D GS        ++ Q +   Q    ++ T  + 
Sbjct: 185 SHQAYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFM 244

Query: 211 APEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQF-------PN 263
           APE++D+     I EK D+W+ G  +Y +C+  +PFE+  + +    T+         P+
Sbjct: 245 APEILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPS 304

Query: 264 YPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQNVQ 303
              YS  L  ++   L   P  RP+   V E +S + ++Q
Sbjct: 305 GTNYSSGLIDVVKKCLNVDPDGRPS---VDELISLLMDLQ 341

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 132/298 (44%), Gaps = 45/298 (15%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRV--IVPDKPS 65
           ++ G  L +GS  KVQ+ +   +G   Q   V++     F   NV+    V    PD   
Sbjct: 19  WKLGETLGLGSTGKVQLAR---NGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75

Query: 66  LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
               R E+  MKLL N+ +V+   D         E + +++L++EY + G L +     L
Sbjct: 76  YGIER-EIIIMKLL-NHPNVLRLYDVW-------ETNTDLYLVLEYAEKGELFNL----L 122

Query: 126 QER--LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCG 183
            ER  L E E +    Q+  G++  HAL   ++HRD+K EN+LL  K   K+ DFG    
Sbjct: 123 VERGPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA- 179

Query: 184 IIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRGLPIDEKSDIWALGVFLYKLCY 241
            +       E S          +  Y APE++    Y+G      SD+W+ GV L+ L  
Sbjct: 180 -LETEGKLLETSC--------GSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFALLT 226

Query: 242 YTTPF-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
              PF E++G    L        F+ P+  + S   + LI  +L   P +R  +  +L
Sbjct: 227 GRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDIL 284

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 119/274 (43%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ +         F    VA L    +  + +   L +E+   K ++N  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            +ID         E    V++L+E C  G L+D +  R  + L E E+    +Q+   I 
Sbjct: 144 QFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG    +    +N +E  Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 243

Query: 207 AQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH----ATFQFP 262
             Y APE++ + +      + DIW++GV LY L     PF+      I        F FP
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 NYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
                S   K LI  +L   P +RP+  ++++ V
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 113/239 (47%), Gaps = 34/239 (14%)

Query: 9    YQPGTLLTVGSH-KVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
            +  G ++  GS   V +   +T+G    +  V++    K+++ N A L  V         
Sbjct: 1181 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVP---KYSSQNEAILSTV--------E 1229

Query: 68   TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
             LR+EV T+K L ++ ++V Y+      F      Y +FL  EY   G +   +  R+  
Sbjct: 1230 ALRSEVSTLKDL-DHLNIVQYLG-----FENKNSIYSLFL--EYVAGGSVGSLI--RMYG 1279

Query: 128  RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            R  E  I ++ +QV +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI R 
Sbjct: 1280 RFDESLIKHLTTQVLRGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRK 1333

Query: 188  PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
              +     Y   D+    T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1334 SKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1386

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 103/224 (45%), Gaps = 35/224 (15%)

Query: 31   GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN--------TLRAEVDTMKLLRNN 82
            G F  +Y          T   +  +K+V VP   S N         LR+EV T+K L ++
Sbjct: 1187 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DH 1240

Query: 83   AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
             ++V Y+      F      Y +FL  EY   G +   +  R+  R  E  I ++ +QV 
Sbjct: 1241 LNIVQYLG-----FENKNNIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIRHLTTQVL 1291

Query: 143  QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI R   +     Y   D+ 
Sbjct: 1292 KGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMT 1341

Query: 203  KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1342 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1383

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 122/277 (44%), Gaps = 35/277 (12%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAH-- 84
           +L  GGFA+ + ++    + F    VA   +  +  + +   L +E+   K +   AH  
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM---AHPN 140

Query: 85  VVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQG 144
           +V ++D         E    V++L+E C  G L++ +  R  + L E E+    +Q+   
Sbjct: 141 IVQFVDCF-------EDDSNVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 145 IAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKN 204
           I  MH+    ++HRD+K+ N+   S    K+ DFG    +    +N  E  Y        
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----C 240

Query: 205 TTAQYRAPE-MIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT----F 259
            T  Y APE ++  + G   +   DIW+LGV LY L     PF+      I        F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 260 QFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
            FP     SD  K LI  +L   P +RP+  ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 130/271 (47%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  MK  ++  ++V++I
Sbjct: 631 SGGVYTAYEIG-------TNVSVA-IKQMNLEKQPKKELIINEILVMKGSKH-PNIVNFI 681

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  K        +++++MEY + G L D +   +   L E +I  +  +   G+  +H
Sbjct: 682 DSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLEFLH 731

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    +LHRDIK +N+LL+ +G+ K+ DFG  C  I    N +  + V        T  +
Sbjct: 732 SKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQIN-ELNLKRTTMVG-------TPYW 780

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 781 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 837

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
              S  LKK + + L  +P  R ++ ++L +
Sbjct: 838 ENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 98/200 (49%), Gaps = 30/200 (15%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +       + E ++  I SQV +G+  +H      +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH--EQKKIHRDIKAAN 143

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI----DLYRG 220
           +LLT +G  K+ DFG V G IR  +  +  ++V        T  + APE++    D Y  
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIR--ATLKRGTFV-------GTPYWMAPEVVSKENDGY-- 191

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN------YPQYSDRLKKL 274
              DEK+DIW+LG+ +Y+L     P  K     ++      P       +  YS   K  
Sbjct: 192 ---DEKADIWSLGITVYELLKGAPPLSKCDPMKVM---INLPKRKPPALHGHYSHSAKNF 245

Query: 275 ITYMLMEQPSQRPNSYQVLE 294
           ++  L++ P  R ++Y+++E
Sbjct: 246 VSSCLVKNPVGRASAYEMVE 265

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 123/274 (44%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++      F    VA L    +  + +   L +E+   K +++  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKH-PNIV 150

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            + D         E    V++L+E C  G +++ +  R  + L E E+   M Q+   I 
Sbjct: 151 QFTDCF-------EDDTNVYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+    +   K+ DFG    +    +N +E  Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVL----ANDKERKYTI-----CGT 250

Query: 207 AQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT----FQFP 262
             Y APE++   +      + DIW++GV LY L +   PF+      I        F FP
Sbjct: 251 PNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 263 NYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
                S   K LI+++L   P+ RP+ Y++ + V
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 134/271 (49%), Gaps = 31/271 (11%)

Query: 37  YTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKF 96
           Y V     +K T+  VA +K ++      LN + AE+  +K L N+ ++V Y   H    
Sbjct: 36  YGVVYKAINKHTDQVVA-IKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY---HGFI- 89

Query: 97  NPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
                SYE+++L+EYC  G L   + +R    L E+E  + ++Q   G+  +H     ++
Sbjct: 90  ---RKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG--EGVI 143

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  N+LL++    K+ DFG V  I+   S+A  ++          T  + APE++ 
Sbjct: 144 HRDIKAANILLSADNTVKLADFG-VSTIVN--SSALTLA---------GTLNWMAPEILG 191

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP--QYSDRLKKL 274
             RG      SDIW+LG  + ++     P+    +A I +A      YP   +S+ LK  
Sbjct: 192 -NRGAS--TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDF 248

Query: 275 ITYMLMEQPSQRPNSYQVLEE--VSSMQNVQ 303
           ++   ++   +RP + Q+L+   ++S +NV+
Sbjct: 249 LSKCFVKNMYKRPTADQLLKHAWITSTENVK 279

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 104/214 (48%), Gaps = 26/214 (12%)

Query: 102 SYEVFLLMEYCDMGGLIDFMNTRLQE-RLREDEILNIMSQVTQGIAAMHALHPPLLHRDI 160
           S   ++L EY   G L+D++   +Q   LRE         V   +  +HA +  ++HRD+
Sbjct: 204 SNHFYMLFEYVAGGQLLDYI---IQHGSLREHHARKFARGVASALQYLHANN--IVHRDL 258

Query: 161 KIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--Y 218
           KIEN+++++ GE K+ DFG         SN  +     H      +  + APE++    Y
Sbjct: 259 KIENIMISNSGEIKIIDFGL--------SNVYDTRKQLHTFCG--SLYFAAPELLKAHPY 308

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFP--NYPQY-SDRLKKLI 275
            G  +    D+W+ GV LY L     PF+ +  +++LH   +     YPQ+ S  +  L+
Sbjct: 309 TGPEV----DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKRGKVEYPQHLSIEVMSLL 363

Query: 276 TYMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPNF 309
           + ML+  PS+R +  QV+E     +    P P++
Sbjct: 364 SKMLVVDPSRRASLKQVVEHPWMTKGYDTPAPSY 397

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 115/254 (45%), Gaps = 35/254 (13%)

Query: 31   GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS--------LNTLRAEVDTMKLLRNN 82
            G F  +Y          T   +  +K+V VP   S        L  L++EV T+K L ++
Sbjct: 1155 GSFGSVYLGL-----NVTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDL-DH 1208

Query: 83   AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
             ++V Y+      F      Y +FL  EY   G +   +  RL  R  ED I  +  QV 
Sbjct: 1209 VNIVQYLG-----FENKNHVYSLFL--EYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVL 1259

Query: 143  QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI +  +N     Y   D+ 
Sbjct: 1260 RGLAYLHSKG--ILHRDMKADNLLLDVDGICKISDF----GISKKSNNI----YSNSDMT 1309

Query: 203  KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFP 262
               T  + APEM+D  +G     K DIW+LG  + ++     P+      A +    +F 
Sbjct: 1310 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFK 1367

Query: 263  NYPQYSDRLKKLIT 276
            + P   +  +KL++
Sbjct: 1368 SAPPIPEDTQKLLS 1381

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 131/290 (45%), Gaps = 29/290 (10%)

Query: 11  PGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLR 70
           P +L+          ++L  GGFA+ + ++      F    VA   ++ +  + +   L 
Sbjct: 70  PPSLIKTRGRDYHRGQFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLL 126

Query: 71  AEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLR 130
           +E+   K + ++ ++V +ID         E +  V++L+E C  G L++ +  R  + + 
Sbjct: 127 SEIQIHKSM-SHTNIVQFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTIT 176

Query: 131 EDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSN 190
           E E+   M+Q+  GI  MH+    ++HRD+K+ N+        K+ DFG    +    +N
Sbjct: 177 EPEVRFFMTQICGGIQYMHS--NRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVL----AN 230

Query: 191 AQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG 250
            +E  +         T  Y APE++ + +      + DIW++GV LY L     PF+   
Sbjct: 231 DRERKFTI-----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKD 284

Query: 251 EAAIL----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
              I        F +P   + S   K LI  +L   P +RP+  ++++ V
Sbjct: 285 VNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 95/210 (45%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L D  +     R+   E   + +Q++  +   H++H   +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYD--HLLSLRRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           N+LL   G  K+ DFG            +VCG                      T  Y A
Sbjct: 162 NILLDKNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMID--LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN-YPQYS 268
           PE+I+   Y G  I    DIW+LGV LY L     PF+ + EA      ++  N  P+Y 
Sbjct: 200 PELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEAK---TKWKIVNEEPKYD 252

Query: 269 -----DRLKKLITYMLMEQPSQRPNSYQVL 293
                D  + LI+ +L + P +RP+  QVL
Sbjct: 253 AKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 95/209 (45%), Gaps = 51/209 (24%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L D + ++   RL   E   + +Q+T  +   H L+   +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           NVLL   G  K+ DFG            +VCG                      T  Y A
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMIDL--YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSD 269
           PEMI    Y G  +    DIW+LGV LY L     PF+++ +  +L       + P   +
Sbjct: 201 PEMIQHKPYDGFKV----DIWSLGVILYTLLCGCLPFDEDDD--LLTKQKIINDTPVIDE 254

Query: 270 RL-----KKLITYMLMEQPSQRPNSYQVL 293
           R+     + LI  +L + P++RPN+  +L
Sbjct: 255 RITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 134/293 (45%), Gaps = 35/293 (11%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
           ++ G  L +GS  KVQ+    T+   A I  +  S  +   N+N   +     PD     
Sbjct: 22  WKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV-ANTPDSLPYG 80

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
             R E+  MKLLR+ A+V+S  D      N       +++++EY + G L + +  +   
Sbjct: 81  IER-EIIIMKLLRH-ANVLSLYDVWETNSN-------LYMILEYAEKGELFNLLVEKGP- 130

Query: 128 RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            L E E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG     +  
Sbjct: 131 -LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--LET 185

Query: 188 PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTTPF 246
                E S          +  Y APE++    G+P    +SD+W+ GV L+ L     PF
Sbjct: 186 EDKLLETSC--------GSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRLPF 234

Query: 247 -EKNGEA-----AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
            E++G        +    F+ P+  + S   + LI+ +L   P++R  + ++L
Sbjct: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREIL 287

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 95/210 (45%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L D + +    R+   E   + +Q++  +   H++H   +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           N+LL   G  K+ DFG            +VCG                      T  Y A
Sbjct: 162 NILLDKNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMID--LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN-YPQYS 268
           PE+I    Y G  I    D W+LGV LY L   + PF+ + EA      ++  N  P+Y 
Sbjct: 200 PELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDDDDEA---KTKWKIVNEEPKYD 252

Query: 269 -----DRLKKLITYMLMEQPSQRPNSYQVL 293
                D  K LI+ +L + P +RP+  QVL
Sbjct: 253 PKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/262 (28%), Positives = 128/262 (48%), Gaps = 29/262 (11%)

Query: 37  YTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKF 96
           Y V     +K T+  VA +K ++  +   LN + AE+  +K L N+ ++V Y   H    
Sbjct: 36  YGVVYKAINKHTDQVVA-IKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY---HGFI- 89

Query: 97  NPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
                SYE+++L+EYC  G L   + +R    L E+E    ++Q   G+  +H     ++
Sbjct: 90  ---RKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVI 143

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  N+LL++    K+ DFG V  I+   S+A  ++          T  + APE++ 
Sbjct: 144 HRDIKAANILLSADNTVKLADFG-VSTIVN--SSALTLA---------GTLNWMAPEILG 191

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP--QYSDRLKKL 274
             RG      SDIW+LG  + ++     P+    +A I +A      YP   +S+ LK  
Sbjct: 192 -NRGAS--TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDF 248

Query: 275 ITYMLMEQPSQRPNSYQVLEEV 296
           ++   ++   +RP + Q+L+ V
Sbjct: 249 LSKCFVKNMYKRPTADQLLKHV 270

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 134/271 (49%), Gaps = 31/271 (11%)

Query: 37  YTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKF 96
           Y V     +K T+  VA +K V+  +   LN + AE+  +K L +N ++V Y   H    
Sbjct: 36  YGVVYKAINKHTDQVVA-IKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY---HGFI- 89

Query: 97  NPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
                SYE+++L+EYC  G L   + +R    L E+E    ++Q   G+  +H     ++
Sbjct: 90  ---RKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVI 143

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  N+LL++    K+ DFG V  I+   S+A  ++          T  + APE++ 
Sbjct: 144 HRDIKAANILLSADNTVKLADFG-VSTIVN--SSALTLA---------GTLNWMAPEILG 191

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP--QYSDRLKKL 274
             RG      SDIW+LG  + ++     P+    +A I +A      YP   +S+ LK  
Sbjct: 192 -NRGAS--TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDF 248

Query: 275 ITYMLMEQPSQRPNSYQVLEEV--SSMQNVQ 303
           ++   ++   +RP + Q+L+ V  +S +NV+
Sbjct: 249 LSKCFVKNMYKRPTADQLLKHVWINSTENVK 279

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 132/294 (44%), Gaps = 38/294 (12%)

Query: 9   YQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
           ++ G  L  GS  KV + +   +G  A +  +  S  +   +T V      ++P      
Sbjct: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLP-----Y 73

Query: 68  TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
            +  E+  MKLL N+ +V+   D         E + ++++++EY + G L + +  R   
Sbjct: 74  GIEREIIIMKLL-NHPNVLRLYDVW-------ETAQDLYMVLEYVEKGELFNLLVQRGP- 124

Query: 128 RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            L E+E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG     +  
Sbjct: 125 -LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA--LES 179

Query: 188 PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTTPF 246
                E S          +  Y APE++    GLP    +SD+W+ GV LY L     PF
Sbjct: 180 KDKLLETSC--------GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPF 228

Query: 247 E------KNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           +      +N    +    ++ P   + S   + LI  +L  +P QR  + ++L+
Sbjct: 229 DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii ACR117W
          Length = 538

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 125/270 (46%), Gaps = 50/270 (18%)

Query: 48  TNTNVACLKRVIVPDKPSLNTLRAEVDTMK-----LLRNNAHVVSYIDSHAAKFNPNEGS 102
           T T +  LK        ++ TL ++ ++ K     L  N +   S+I  +   F   E S
Sbjct: 271 TGTKIFALK--------AITTLNSDQESQKQIFRELQFNKSCKSSFIVQYYGMFTDQEHS 322

Query: 103 YEVFLLMEYCDMGG-LIDFMNTRLQE---RLREDEILNIMSQVTQGIAAMHALHPPLLHR 158
             +++ MEY  MGG  +D +   L +   R+ E  +  I   V +G++ +H     ++HR
Sbjct: 323 -SIYIAMEY--MGGKSLDAIYKHLLKYGGRVSEKVLGKIAESVLRGLSYLH--ERKIIHR 377

Query: 159 DIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLY 218
           DIK +NVLL   GE K+CDFG V G      N+   ++         T+ Y APE I   
Sbjct: 378 DIKPQNVLLNEAGEVKLCDFG-VSG---EAVNSLATTF-------TGTSYYMAPERI--- 423

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAA----------ILHATFQFPNYPQ-- 266
           +G P    SD+W+LG+ L ++     PF+    AA          IL  T Q  + P+  
Sbjct: 424 QGQPYSVTSDVWSLGLTLLEVAQAHFPFDSGKMAANMPPIELLMLILTFTPQLKDEPESN 483

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
             +S   K  I + L ++  +RP+  Q+L+
Sbjct: 484 IAWSKAFKSFIEFCLKKESRERPSPRQMLQ 513

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 107/220 (48%), Gaps = 30/220 (13%)

Query: 85  VVSYIDSHA---AKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQV 141
           V+  + SHA   A F   E   E++L++EY D G L D++ +R   +L E E ++   Q+
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQI 223

Query: 142 TQGIAAMHALHPPLLHRDIKIENVLLTSKG-EYKVCDFGSVCGIIRPPSNAQEVSYVQHD 200
            +G++  H+ +  + HRD+K EN+LL  K  + K+ DFG     +  P+   + S     
Sbjct: 224 VEGVSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG--MAALELPNKLLKTSC---- 275

Query: 201 IMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL--- 255
                +  Y +PE++    Y G P    SD+W+ G+ L+ L     PF  +    +L   
Sbjct: 276 ----GSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKV 327

Query: 256 -HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
               +Q P     S   + LI+ +L+  P +R  + ++LE
Sbjct: 328 QSGKYQMP--MNLSLEARNLISKILVIDPEKRITTQEILE 365

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 132/274 (48%), Gaps = 44/274 (16%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y V        T+ +VA +K++ +  +P    +  E+  MK  ++  ++V++I
Sbjct: 562 SGGVYTAYEVG-------TDASVA-IKQMNLEKQPKKELIINEIIVMKDSKH-PNIVNFI 612

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS   K        +++++ME+ + G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 613 DSFLLKG-------DLWVIMEFMEGGSLTDVVTHCI---LTEGQIGTVCRETLRGLQFLH 662

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNT---T 206
           +    ++HRDIK +N+LL+ KG+ K+ DFG  C  I            +H++ + T   T
Sbjct: 663 SNG--VIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN-----------EHNLKRTTMVGT 708

Query: 207 AQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNY 264
             + APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P  
Sbjct: 709 PYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGTPKL 765

Query: 265 PQ---YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
            +    SD L   +++ L   P +R ++  +LE+
Sbjct: 766 KEPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 36/202 (17%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +       L E+++  I+ QVT G+  +H      +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEM----IDLYRG 220
           +LL  +G  K+ DFG V G +R  S  +  ++V        T  + APE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLR--STMKRDTFV-------GTPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQ---------YSDRL 271
              +EK+DIW+LG+  Y+L     P  K     ++       N P+         +SD  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGSFSDAA 240

Query: 272 KKLITYMLMEQPSQRPNSYQVL 293
           K+ +   L++ P+ RP++Y +L
Sbjct: 241 KEFVAGCLVKVPADRPSAYDLL 262

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 98/202 (48%), Gaps = 36/202 (17%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +       L E+++  I+ +VT G+  +H      +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEM----IDLYRG 220
           +LL  +G  K+ DFG V G IR  S  +  ++V        T  + APE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--STLKRDTFV-------GTPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQ---------YSDRL 271
              +EK+DIW+LG+  Y+L     P  K     ++       N P+         +SD  
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGPFSDAA 245

Query: 272 KKLITYMLMEQPSQRPNSYQVL 293
           K  +   L++ P+ RP++Y +L
Sbjct: 246 KDFVAGCLVKTPADRPSAYNLL 267

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 121/275 (44%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++      F    VA   ++ +  + +   L +E+   K +R+  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRH-PNIV 133

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            + D         E    V++L+E C  G L+D +  R Q  L E E+    +Q+   I 
Sbjct: 134 QFTDCF-------EDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG    +    +N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----ANDRERKYTI-----CGT 233

Query: 207 AQYRAPEMI-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH----ATFQF 261
             Y APE++   + G   +   D+W++GV +Y L     PF+      I        F F
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNF 291

Query: 262 PNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
           P     S   K LI  +L   P +RP+  +++E V
Sbjct: 292 PRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 36/202 (17%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +       L E+++  I+ QVT G+  +H      +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEM----IDLYRG 220
           +LL  +G  K+ DFG V G IR  S  +  ++V        T  + APE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--STMKRDTFV-------GTPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQ---------YSDRL 271
              +EK+DIW+LG+  Y+L     P  K     ++       N P+         +S+  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGSFSEAA 240

Query: 272 KKLITYMLMEQPSQRPNSYQVL 293
           K+ +   L++ P+ RP++Y +L
Sbjct: 241 KEFVAGCLVKAPADRPSAYDLL 262

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 97/202 (48%), Gaps = 27/202 (13%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY + G L D++  R   +L E E ++   Q+ QG++  H  +  + HRD
Sbjct: 134 ENKSELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRD 189

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--D 216
           +K EN+LL  K +  K+ DFG     +   +   E S          +  Y +PE++   
Sbjct: 190 LKPENLLLDKKNKTVKIADFGMAA--LETTNRLLETSC--------GSPHYASPEIVMGQ 239

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF  +    +L    H  +Q P+    S   K
Sbjct: 240 KYHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAK 293

Query: 273 KLITYMLMEQPSQRPNSYQVLE 294
            LI+ +L+  P +R    ++LE
Sbjct: 294 DLISKILVVDPEKRITVDKILE 315

>KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {ON}
           Anc_6.262 YPL236C
          Length = 366

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/343 (24%), Positives = 147/343 (42%), Gaps = 62/343 (18%)

Query: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTN--TNVACLKRVIVP--DK 63
           Y   TL+TV + K QVV+ L     +  Y V+  SP    +N  T +  +K +  P  D 
Sbjct: 22  YYSETLITVNARKYQVVRLLGEKSLSFTYLVERTSPTSDASNDATRLFAMKVISCPFGDI 81

Query: 64  PSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNT 123
            +++    E++  K   ++AH+++   S  ++    +GS  + +L+ Y  +G L D ++ 
Sbjct: 82  DTISNALQEIELYKYF-HSAHIINLYGSQVSQ--ELDGSRTILILLPYYPLGSLQDMIDR 138

Query: 124 RLQE--RLREDEILNIMSQVTQGIAAMH---------------------ALHPPLLHRDI 160
            L +   + E + + IM  + +G+  +H                     +     L  D 
Sbjct: 139 NLLDGSTVSESQCIKIMVSLCKGLDILHNSSSRAVGNMKASFDSVSITVSDDAASLLADT 198

Query: 161 KIE----------------------NVLLTSKGEYKVCDFGSVCGIIR-PPSNAQEVSYV 197
            +E                       VL  S G   + D  S+C  ++   + + ++   
Sbjct: 199 PLELAVMSPTNYTEESFALLNMSPTTVLFRSDGTPLIGDL-SICSKVKFEITESADLLAF 257

Query: 198 QHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK----NG--- 250
           +  I +N +  Y APE++ L +G  I ++ DIW+LG  LY L Y  +PFE+    NG   
Sbjct: 258 KERIQENCSLPYLAPELVSLKKGSLITKEVDIWSLGAILYFLMYGVSPFEREEQLNGTPI 317

Query: 251 EAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
           + AI    + FP   +YS  L  +I   L   PS R +  Q++
Sbjct: 318 KYAIKKGQYSFPQESEYSSSLNDIIISCLQVDPSMRSSPIQLI 360

>Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {ON}
           YPL140C (REAL)
          Length = 513

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 108/232 (46%), Gaps = 37/232 (15%)

Query: 81  NNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGL---IDFMNT-RLQERLREDEILN 136
           N +   SYI  +   F  +E S  +++ MEY  MGG      + N  R   R+ E  I  
Sbjct: 272 NKSFASSYIVQYYGMFT-DEQSSSIYIAMEY--MGGRSLEATYKNLLRRGGRISEKVIGK 328

Query: 137 IMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSY 196
           I   V +G++ +H     ++HRDIK +N+LL  KGE K+CDFG V G      N+  V++
Sbjct: 329 IAESVLRGLSYLH--ERKVIHRDIKPQNILLNDKGEIKLCDFG-VSG---EAVNSLAVTF 382

Query: 197 VQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG------ 250
                    T+ Y APE I   +G P     D+W+LG+ L ++     PFE +       
Sbjct: 383 T-------GTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAEGRFPFESDKITQNVA 432

Query: 251 --EAAILHATF--QFPNYPQ----YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
             E   +  TF     + P+    +S   K  I Y L +   +RP+  Q+L+
Sbjct: 433 PIELLTMILTFSPHLKDEPELNIIWSTTFKSFIEYCLKKDARERPSPRQMLK 484

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 113/239 (47%), Gaps = 34/239 (14%)

Query: 9    YQPGTLLTVGSH-KVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
            +  G ++  GS   V +   +T+G    +  V++    K+++ N A L  V         
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVP---KYSSQNEAILSTV--------E 1223

Query: 68   TLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQE 127
             LR+EV T+K L ++ ++V Y+      F      Y +FL  EY   G +   +  R+  
Sbjct: 1224 ALRSEVSTLKDL-DHLNIVQYLG-----FENKNNIYSLFL--EYVAGGSVGSLI--RMYG 1273

Query: 128  RLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRP 187
            R  E  I ++ +QV +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI R 
Sbjct: 1274 RFDEPLIKHLTTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRK 1327

Query: 188  PSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
              +     Y   D+    T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1328 SKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1380

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 107/224 (47%), Gaps = 35/224 (15%)

Query: 31   GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS--------LNTLRAEVDTMKLLRNN 82
            G F  +Y          T   +  +K+V VP   S        +  LR+EV T+K L ++
Sbjct: 1223 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-DH 1276

Query: 83   AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
             ++V Y+      F   +  Y +FL  EY   G +   +  R+  R  E  I ++ +QV 
Sbjct: 1277 LNIVQYLG-----FENKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVL 1327

Query: 143  QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI R    ++++ Y   D+ 
Sbjct: 1328 RGLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISR---KSKDI-YSNSDMT 1377

Query: 203  KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1378 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1419

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 132/271 (48%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y V        TN +VA +K++ +  +P    +  E+  MK  ++ A++V++I
Sbjct: 677 SGGVYTAYEVG-------TNASVA-IKQMNLEKQPKKELIINEILVMKASKH-ANIVNFI 727

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  + +       ++++MEY + G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 728 DSYLLRGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 777

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    ++HRDIK +N+LL+  GE K+ DFG  C  I       E++  +  ++   T  +
Sbjct: 778 S--KGVIHRDIKSDNILLSMTGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYW 826

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFP---NY 264
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 827 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDA 883

Query: 265 PQYSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
              SD LK  + + L   P +R  + ++L +
Sbjct: 884 DSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 132/271 (48%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  MK  ++  ++V++I
Sbjct: 666 SGGVYTAYELG-------TNASVA-IKQMNLEKQPKKELIINEIMVMKGSKHR-NIVNFI 716

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  K        +++++MEY + G L D +   +   L E +I  +  +   G+  +H
Sbjct: 717 DSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFLH 766

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    ++HRDIK +N+LL+  GE K+ DFG  C  I       E++  +  ++   T  +
Sbjct: 767 SKG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYW 815

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 816 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 872

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
               + L+  + + L  +P QR +S Q+L++
Sbjct: 873 DNLGEELQNFLDWCLTVEPDQRASSSQLLKD 903

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 36/202 (17%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +       L E+++  I+ QVT G+  +H      +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEM----IDLYRG 220
           +LL  +G  K+ DFG V G IR  S  +  ++V        T  + APE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--STFKRDTFV-------GTPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQ---------YSDRL 271
              +EK+DIW+LG+  Y+L     P  K     ++       N P+         +S+  
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGPFSEAA 245

Query: 272 KKLITYMLMEQPSQRPNSYQVL 293
           K+ +   L++ P+ RP++Y +L
Sbjct: 246 KEFVAGCLVKTPADRPSAYDLL 267

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/321 (23%), Positives = 135/321 (42%), Gaps = 65/321 (20%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQI----------SPPDKFTNTNVACLKRVIVPDKP 64
           +T+G     + K +  G FA ++   +          SPP  F    +  + R  + +K 
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFA---IKIVSRSKLKNKK 86

Query: 65  SLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTR 124
            L  L  E+  +K + N+ H+V  ID           + + +L+MEYC +G L   +  R
Sbjct: 87  LLENLEIEIAILKKI-NHPHIVKLIDCERT-------TTDFYLIMEYCALGDLTFLIKKR 138

Query: 125 --------LQERLREDE--------------ILNIMSQVTQGIAAMHALHPPLLHRDIKI 162
                   L E++ E                ILN + Q+   +  + +    L+HRDIK 
Sbjct: 139 HELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRS--KNLVHRDIKP 196

Query: 163 ENVLLTS----KGEYKVCDFGSVCGIIRPP----SNAQEVSYVQHDIMKNTTAQ---YRA 211
           +N+LL +      + K        GI   P    ++     ++ +  M  T      Y A
Sbjct: 197 QNLLLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFARFLPNTSMAETLCGSPLYMA 256

Query: 212 PEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT------FQFPNYP 265
           PE+++  +    + K+D+W++G  LY++CY T PF+ +    +            FPNY 
Sbjct: 257 PEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYI 313

Query: 266 QYSDRLKKLITYMLMEQPSQR 286
           Q  + +K LI+ +L   P +R
Sbjct: 314 QIQNDMKILISKLLTFDPQRR 334

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 121/275 (44%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVV 86
           +L  GGFA+ + ++      F    VA   ++ +  + +   L +E+   K +++  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 133

Query: 87  SYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA 146
            + D         E    V++L+E C  G L+D +  R Q  L E E+    +Q+   I 
Sbjct: 134 QFTDCF-------EDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG    +    +N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----ANDRERKYT-----ICGT 233

Query: 207 AQYRAPEMI-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH----ATFQF 261
             Y APE++   + G   +   DIW++GV +Y L     PF+      I        F F
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSF 291

Query: 262 PNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
           P     S   K LI  +L   P +RP+  +++E V
Sbjct: 292 PKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 127/291 (43%), Gaps = 31/291 (10%)

Query: 11  PGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLR 70
           P +L+       +   +L  GGFA+ + ++      F    VA   ++ +  + +   L 
Sbjct: 84  PPSLIKTRGRDYRREHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLL 140

Query: 71  AEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLR 130
           +E+   K +++ +++V +ID         E    V++L+E C  G L+D +  R  + L 
Sbjct: 141 SEIQIHKSMKH-SNIVQFIDCF-------EDDANVYILLEICPNGSLMDLLKKR--KSLT 190

Query: 131 EDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSN 190
           E E+    +Q+   I  +H+    ++HRD+K+ N+        KV DFG    +    +N
Sbjct: 191 EPEVRFFTTQICGAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----AN 244

Query: 191 AQEVSYVQHDIMKNTTAQYRAPE-MIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKN 249
            +E  Y         T  Y APE ++  + G   +   DIW++GV +Y L     PF+  
Sbjct: 245 DRERKYTV-----CGTPNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAK 297

Query: 250 GEAAILH----ATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
               I        + +P     S   + LI  +L   P QRP    ++++V
Sbjct: 298 DVNVIYERIKLCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {ON}
           Anc_8.652 YOR231W
          Length = 592

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 118/259 (45%), Gaps = 49/259 (18%)

Query: 65  SLNTLRAEVDTMK-----LLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGG-LI 118
           ++NTL ++ +  K     L  N +   +YI  +   F   E S  + + MEY  MGG  +
Sbjct: 326 TINTLNSDPEFQKQIFRELQFNKSFKCNYIVQYYGMFEDLENS-TILIAMEY--MGGKSL 382

Query: 119 DFMNT---RLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKV 175
           D +     +L  R+ E  +  I   V +G++ +H     ++HRDIK +N+LL  KGE K+
Sbjct: 383 DSIYKHLLKLGGRISEKVLGKIAESVLKGLSYLH--EKKVIHRDIKPQNILLNDKGEIKL 440

Query: 176 CDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVF 235
           CDFG V G      N+   ++         T+ Y APE I   +G P     D+W+LG+ 
Sbjct: 441 CDFG-VSG---EAVNSLATTFT-------GTSYYMAPERI---KGQPYSVTCDVWSLGLT 486

Query: 236 LYKLCYYTTPFEKNG---------------EAAILHATFQ--FPNYPQ----YSDRLKKL 274
           L ++     PF  N                E  +L  TF     + P+    +S   K  
Sbjct: 487 LLEVAQAKFPFGSNNDEKKTLSNNANIAPIELLMLIVTFTPVLNDEPELNIIWSKSFKSF 546

Query: 275 ITYMLMEQPSQRPNSYQVL 293
           I Y L ++P +RP+  Q++
Sbjct: 547 IEYCLKKEPRERPSPRQMI 565

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 130/271 (47%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  MK  ++  ++V++I
Sbjct: 672 SGGVYTAYEIG-------TNVSVA-IKQMNLEKQPKKELIINEILVMKGSKH-PNIVNFI 722

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  K        +++++MEY + G L D +   +   L E +I  +  +   G+  +H
Sbjct: 723 DSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLKFLH 772

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    +LHRDIK +N+LL+ +G+ K+ DFG  C  I    N +  + V        T  +
Sbjct: 773 SKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQIN-ELNLKRTTMVG-------TPYW 821

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 822 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 878

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
              S  LKK + + L  +P +R ++  +L +
Sbjct: 879 ENLSSYLKKFLDWCLCVEPEERASATDLLHD 909

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 128/278 (46%), Gaps = 34/278 (12%)

Query: 23  QVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNN 82
           ++++ +  G F  +Y  +    ++     V  L+     D+P ++ L  E+  +  LR+ 
Sbjct: 21  EILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDT---DEP-IDLLAQEIFFLSELRS- 75

Query: 83  AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
                YI ++   F  +     ++++MEYC  G   + +    + +L ED+   I+S+V 
Sbjct: 76  ----PYITNYKTAFLVD---VSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVL 128

Query: 143 QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            G+  +H+     +HRDIK  N+LLT  G  K+ DFG          + Q +   + D  
Sbjct: 129 VGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG---------VSGQMMVTRKRDTF 177

Query: 203 KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFP 262
             T   + APE+ID  +    +E +DIW+LG+ + +L     P +K      L A    P
Sbjct: 178 VGTPF-WMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMA---IP 232

Query: 263 NY------PQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
                    ++S   K  +   L++ PSQRP + ++L+
Sbjct: 233 KRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 93/194 (47%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
           GSY     ++++MEYC  G L   +   +   + E  I  IM ++   +  +H  +  ++
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIHKDN--VI 162

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  NVL+T++G+ K+CDFG    + +     Q ++          T  + APE+I 
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 212

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKNGEAAILHATFQFP---NYPQYSDRLK 272
              G+  D K DIW+LG+  Y++     P+ E     A+   T   P      QYS  LK
Sbjct: 213 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLK 271

Query: 273 KLITYMLMEQPSQR 286
           + I   L E P +R
Sbjct: 272 EFIALCLDEDPKER 285

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 119/262 (45%), Gaps = 47/262 (17%)

Query: 69  LRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128
           +  E+  MKLL ++ +V+S  D      N       ++L++EY + G L + +  R    
Sbjct: 66  IEREIVVMKLL-SHPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVDR--GP 115

Query: 129 LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP 188
           L E E +    Q+   I+  HAL   ++HRD+K EN+LL +    K+ DFG     ++  
Sbjct: 116 LPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPENLLLDNDYNIKIADFGMAA--LQTD 171

Query: 189 SNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
           +   E S          +  Y APE++    YRG      SD+W+ GV L+ L     PF
Sbjct: 172 ARLLETSC--------GSPHYAAPEIVSGLPYRGFA----SDVWSCGVILFALLTGRLPF 219

Query: 247 -EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNS----------- 289
            E NG    L        F+ P+  + S   + LI+ +L+  P+QR  +           
Sbjct: 220 DEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKK 279

Query: 290 YQVLEEVSSMQNVQCPIPNFYL 311
           YQ + +  S++N+  P  N YL
Sbjct: 280 YQTIRDSKSIRNL--PRENTYL 299

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 25/195 (12%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           V++++EYC    L + +    ++RL  +E   + SQ+   +   H L    +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHEL--KCVHRDLKLEN 158

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID--LYRGLP 222
           VLL   G  K+ DFG            +  +  Q + +  TT  Y APE+I+   Y G  
Sbjct: 159 VLLDGNGHAKLTDFGFT---------REMATRSQLETICGTTV-YMAPELIERKCYDGFK 208

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKNGEA----AILHATFQFPNYPQYSDRLKKLITYM 278
           +    DIW+LG+ LY +     PF+++ +      I++    F N    SD    LI  M
Sbjct: 209 V----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQGM 263

Query: 279 LMEQPSQRPNSYQVL 293
           L + P++R +  QVL
Sbjct: 264 LRKNPNERISLAQVL 278

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 11  PGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLR 70
           P +L+       +   +L  GGFA+ + ++      F    VA   ++ +  + +   L 
Sbjct: 81  PPSLIKTRGRDYRRGHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLL 137

Query: 71  AEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLR 130
           +E+   K +++  ++V ++D         E    V++L+E C  G L+D M  R  + L 
Sbjct: 138 SEIQIHKSMKH-PNIVHFVDCF-------EDDTNVYILLEICSNGSLMDLMKKR--KTLT 187

Query: 131 EDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSN 190
           E E+    +Q+   +  MH+    ++HRD+K+ N+        KV DFG    +    +N
Sbjct: 188 EPEVRFFTTQICGAVKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----AN 241

Query: 191 AQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG 250
            +E  Y         T  Y APE++ + +      + DIW++GV +Y L     PF+   
Sbjct: 242 NRERKYTV-----CGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKD 295

Query: 251 EAAILH----ATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
              I        + +P     S   K LI  +L   P +RP+  +++++V
Sbjct: 296 VNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 105/215 (48%), Gaps = 28/215 (13%)

Query: 102 SYEVFLLMEYCDMGGLIDFMNTRLQE-RLREDEILNIMSQVTQGIAAMHALHPPLLHRDI 160
           S   ++L EY   G L+D++   +Q   LRE         V   +  +HA +  ++HRD+
Sbjct: 197 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGVASALQYLHANN--IVHRDL 251

Query: 161 KIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRG 220
           KIEN+++++ GE K+ DFG         SN  +     H      +  + APE++   + 
Sbjct: 252 KIENIMISTSGEIKIIDFGL--------SNVFDTRKQLHTFC--GSLYFAAPELL---KA 298

Query: 221 LP-IDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH-----ATFQFPNYPQYSDRLKKL 274
            P I  + DIW+ GV LY L     PF+ +  +++LH        ++PN+   S  +  L
Sbjct: 299 NPYIGPEVDIWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVEYPNH--LSIEVISL 355

Query: 275 ITYMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPNF 309
           ++ ML+  P +R N  +V+E    ++    P P++
Sbjct: 356 LSKMLVVDPLKRANLTKVIEHPWMIRGYDFPPPSY 390

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 131/264 (49%), Gaps = 33/264 (12%)

Query: 51  NVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLME 110
           N   +K++I+  +P    +  E+  MK  ++N ++V++++++    +      +++++ME
Sbjct: 626 NKVAIKQMILSKQPRKELIVNEILVMKDSKHN-NIVNFLEAYLKTED------DLWVVME 678

Query: 111 YCDMGGLIDFM-----NTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENV 165
           Y + G L D +      +  Q  L E +I  I+ +  QG+  +H  H  ++HRDIK +NV
Sbjct: 679 YMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNV 736

Query: 166 LLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE 225
           LL ++G  K+ DFG    +      ++  + V        T  + APE++   +    DE
Sbjct: 737 LLDTRGRVKITDFGFCAKLTD--KRSKRATMV-------GTPYWMAPEVV---KQREYDE 784

Query: 226 KSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFP--NYPQY-SDRLKKLITYMLM 280
           K D+W+LG+   ++     P+  E+  +A  L AT   P   +P+Y S  +K+ ++  L 
Sbjct: 785 KVDVWSLGIMTIEMLESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVCLC 844

Query: 281 EQPSQRPNSYQVLEEVSSMQNVQC 304
                R ++ ++L    S  N+ C
Sbjct: 845 VDVKYRASTEELLHH--SFFNMSC 866

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 108/224 (48%), Gaps = 35/224 (15%)

Query: 31   GGFAQIYTVQISPPDKFTNTNVACLKRVIVP-----DKPSLNT---LRAEVDTMKLLRNN 82
            G F  +Y          T   +  +K+V VP     D+  L+T   LR+EV T+K L ++
Sbjct: 1284 GSFGAVYLCL-----NLTTGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDL-DH 1337

Query: 83   AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
             ++V Y+      F  +   Y +FL  EY   G +   +  RL  R  E  I  +  QV 
Sbjct: 1338 LNIVQYLG-----FENDHDIYSLFL--EYVGGGSVGSLI--RLYGRFDEALIRFLTVQVL 1388

Query: 143  QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI R    ++++ Y   D+ 
Sbjct: 1389 EGLAYLHS--KGILHRDMKADNLLLDLDGVCKISDF----GISR---KSKDI-YSNSDMT 1438

Query: 203  KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1439 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPW 1480

>Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W
           (MKK1) - protein kinase involved in protein kinase C
           pathway [contig 67] FULL
          Length = 444

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 108/232 (46%), Gaps = 37/232 (15%)

Query: 81  NNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGG-LIDFMNTRLQER---LREDEILN 136
           N +    YI  +   F   E +  +++ MEY  MGG  +D +   L ER   + E  +  
Sbjct: 208 NRSCSSEYIVRYYGMFA-EESTSSIYIAMEY--MGGKSLDAIYKHLLERGGRIGEKVLGK 264

Query: 137 IMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSY 196
           I   V +G++ +      ++HRDIK +N+LL   G+ K+CDFG V G+     N+   ++
Sbjct: 265 IAESVLKGLSYLQERK--IIHRDIKPQNILLNEAGQVKLCDFG-VSGVA---VNSLATTF 318

Query: 197 VQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAA--- 253
                    T+ Y APE I   +G P    SD+W+LG+ L ++     PF  +  AA   
Sbjct: 319 -------TGTSFYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGQFPFGSDNMAANMP 368

Query: 254 -------ILHATFQFPNYPQ----YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
                  IL  T    + P+    +S   K  I Y L ++P  RP+  Q+L+
Sbjct: 369 PIELLMLILTFTPALKDIPESNVTWSKSFKSFIQYCLNKEPRDRPSPRQMLQ 420

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 111/247 (44%), Gaps = 30/247 (12%)

Query: 54  CLKRVIVPDKPSLNTLRAEVDTMKLLRNNAH--VVSYIDSHAAKFNPNEGSYEVFLLMEY 111
           C K+ I+ ++  +  +  E D + LL    H  VV         F+  +  Y V   +  
Sbjct: 42  CSKKHIIRER-KVKYVTVEKDLLNLLAGGGHPGVVRLF----CTFHDTDNLYYVLEFVSG 96

Query: 112 CDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKG 171
            ++ GL+  M      RL E+    I SQ+   +  MHA    ++HRD+K ENVLL+ +G
Sbjct: 97  GELLGLVRRMG-----RLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPENVLLSQEG 149

Query: 172 EYKVCDFGSVC----GIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKS 227
              + DFG+ C    G   P +  +  S+V        TA+Y +PE++ L+        S
Sbjct: 150 RIVITDFGAACCASEGGSAPGAADRAASFVG-------TAEYVSPELL-LHSQCSFG--S 199

Query: 228 DIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSD--RLKKLITYMLMEQPSQ 285
           D+WALG  +Y+L     PF  + E               Y+    +  L+  +L+  P Q
Sbjct: 200 DVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPLIVALVQSILVLDPLQ 259

Query: 286 RPNSYQV 292
           RP++ Q+
Sbjct: 260 RPSAKQL 266

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 130/268 (48%), Gaps = 35/268 (13%)

Query: 31  GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYID 90
           GG A +YT      +  TN +VA +K++ +  +P    +  E+  MK    + ++V++ID
Sbjct: 622 GGSALVYTAY----EVGTNLSVA-IKQINLEKQPRKQLILNEIIVMKK-SQHPNIVNFID 675

Query: 91  SHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHA 150
           S+           +++++MEY + G L D +   +   LRE +I  +  +V +G+  +H+
Sbjct: 676 SYLV-------DGKLWVIMEYMEAGSLTDVVTRCI---LREGQIGAVCREVLKGLVFLHS 725

Query: 151 LHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYR 210
               ++HRDIK +NVLL+  G+ K+ DFG  C  +          +++ + M   T  + 
Sbjct: 726 --KGVIHRDIKSDNVLLSMDGDIKLTDFG-FCAQLND-------IHLKRNTMVG-TPYWM 774

Query: 211 APEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNY---P 265
           APE+++     P   K DIW+LGV + ++     P+  E    A  L AT   P      
Sbjct: 775 APEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPYLNEPPLRALYLIATNGTPKLKDPE 831

Query: 266 QYSDRLKKLITYMLMEQPSQRPNSYQVL 293
           + S+ L + I   L   P  R  + ++L
Sbjct: 832 KLSETLSEFINCCLFVDPELRKTAAELL 859

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 109/233 (46%), Gaps = 33/233 (14%)

Query: 69  LRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128
           ++ E+  + LLR   ++  Y  S+         + +++++MEYC+ G + + +      R
Sbjct: 49  IQNEIKFLSLLRYAPNITYYYHSYLI-------NRKIWIIMEYCNGGSVRNLIKIG---R 98

Query: 129 LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP 188
             E  I  I+ ++   +  +H  H  ++HRDIK  N+L+   G  K+CDFG    +    
Sbjct: 99  FNEIYISVILRELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAAKL---- 152

Query: 189 SNAQEVSYVQHDIMKNTTAQYRAPEMI---DLYRGLPIDEKSDIWALGVFLYKLCYYTTP 245
               E S  +   M   T  + APE+I    LY     D K+DIW++G+  Y++     P
Sbjct: 153 ----EFSKPKRQTMAG-TPYWMAPEVIIESSLY-----DTKADIWSVGITAYEITTGNPP 202

Query: 246 F-EKNGEAAILHATFQFP---NYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           + E +   A+   T   P       YS  LK+ I   L E PS+R  S ++LE
Sbjct: 203 YCEYDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLE 255

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 128/279 (45%), Gaps = 35/279 (12%)

Query: 20  HKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLL 79
           H   +VK +  G    ++T      D      +  +K++ +  +P    +  E+  MK  
Sbjct: 676 HYKDLVK-IGQGASGGVFTAH----DSRDENRLVAIKQMNLQKQPKKELIINEIIVMKGS 730

Query: 80  RNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMS 139
           R+  ++V++IDS+  K        +++++MEY + G L D +   +   L E +I  +  
Sbjct: 731 RH-ENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGTVCK 779

Query: 140 QVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQH 199
           +   G+A +H+    ++HRDIK +N+LL+  G+ K+ DFG  C  I       EV   + 
Sbjct: 780 ETLGGLAFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG-FCAQI------NEVHLKRT 830

Query: 200 DIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILH--- 256
            ++   T  + APE++      P   K DIW+LG+ + ++     P+        L+   
Sbjct: 831 TMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA 885

Query: 257 --ATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
              T Q  +     + LKK + + L   P +R  + ++L
Sbjct: 886 TNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/329 (24%), Positives = 138/329 (41%), Gaps = 69/329 (20%)

Query: 13  TLLTVGSHKVQVVKYLTSGGFAQIYTVQISPP----------DKFTNTNVACLKRVIVP- 61
           T + VGS +  V K +  G FA ++   +  P          D  +  N  C    IVP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGL 117
               +K  L  L  E+  +K + ++ H+V  ID           S + +L+MEYC +G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLIDFE-------RTSKDFYLIMEYCSLGDL 140

Query: 118 IDFMNTRLQ----------------------ERLREDEILNIMSQVTQGIAAMHALHPPL 155
              +  R Q                        L +  ILN + Q++  +  + + +  L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--L 198

Query: 156 LHRDIKIENVLLTS-----KGEYKVCDFGSVCGIIRPP----SNAQEVSYVQHDIMKNTT 206
           +HRDIK +N+LL++            D G V GI   P    ++     ++ +  M  T 
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFV-GIYNLPILKIADFGFARFLPNTSMAETL 257

Query: 207 AQ---YRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL------HA 257
                Y APE+++  +    + K+D+W++G  LY++CY   PF+ +    +       + 
Sbjct: 258 CGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKAND 314

Query: 258 TFQFPNYPQYSDRLKKLITYMLMEQPSQR 286
              FP Y +  + LK LI+ +L   P +R
Sbjct: 315 LIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 100/201 (49%), Gaps = 27/201 (13%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY D G L D++ ++   +L E E ++   Q+ QG++  H+ +  + HRD
Sbjct: 206 ENKSELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRD 261

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--D 216
           +K EN+LL  K +  K+ DFG     +  P+   + S          +  Y +PE++   
Sbjct: 262 LKPENLLLDKKNKSIKIADFG--MAALELPNKLLQTSC--------GSPHYASPEIVMGK 311

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF  +    +L       F+ P+    S   +
Sbjct: 312 SYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPEAQ 365

Query: 273 KLITYMLMEQPSQRPNSYQVL 293
            LI+ +L+  PS+R  + ++L
Sbjct: 366 DLISRILVIDPSKRITTDRIL 386

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 137/299 (45%), Gaps = 38/299 (12%)

Query: 5   QIPLYQPGTLLTVGS-HKVQVVKYLTSGGFAQIYTVQISPPDKFTN-TNVACLKRVIVPD 62
           +I  ++ G+ L  GS  KV + ++ ++G   Q   V+I     F N +N + +     PD
Sbjct: 22  KIGPWKLGSTLGAGSTGKVVMAQHESTG---QQAAVKIVSKSIFGNQSNSSTIVGSNDPD 78

Query: 63  KPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMN 122
                  R E+  MKLL N+ +V+   D         E +  +++++EY + G L + + 
Sbjct: 79  VLPYGIER-EIIIMKLL-NHPNVLRLYDVW-------ETNSSLYMVLEYVEKGELFNLLV 129

Query: 123 TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVC 182
            R    L E+E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG   
Sbjct: 130 DRGP--LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA 185

Query: 183 GIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCY 241
             +       E S          +  Y APE++    GLP    +SD+W+ G+ L+ L  
Sbjct: 186 --LESKDKLLETSC--------GSPHYAAPEIVS---GLPYHGFESDVWSCGIILFALLT 232

Query: 242 YTTPF-EKNGEA-----AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
              PF E++G        +    F+ P+  + S   + LI  +L   P+ R  S  +L+
Sbjct: 233 GRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILK 291

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 95/210 (45%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L D  +     RL   E   + +Q++  +   H++H   +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYD--HLLSLRRLSLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           N+LL   G  K+ DFG            +VCG                      T  Y A
Sbjct: 162 NILLDRNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 212 PEMID--LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN-YPQYS 268
           PE+I+   Y G  I    DIW+LGV LY L     PF+ + E   +   ++  N  P+Y 
Sbjct: 200 PELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDDDDE---VKTKWKIVNEEPKYD 252

Query: 269 -----DRLKKLITYMLMEQPSQRPNSYQVL 293
                D  K LI+ +L + P +RP+  QVL
Sbjct: 253 SKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 32/208 (15%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +       L E +   I  +V +G+  +H      +HRDIK  N
Sbjct: 88  MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHEQKK--IHRDIKAAN 145

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI----DLYRG 220
           +LLT +G+ K+ DFG V G IR  +  +  ++V        T  + APE++    D Y  
Sbjct: 146 ILLTDEGKVKLGDFG-VSGQIR--ATLKRGTFV-------GTPFWMAPEVVSKDSDGY-- 193

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPN------YPQYSDRLKKL 274
              DEK+DIW+LG+ +Y+L   + P  K     ++      P       +  YS   K  
Sbjct: 194 ---DEKADIWSLGITVYELLKGSPPLYKCDPMKVM---VNLPKRKPPVLHGHYSSAAKHF 247

Query: 275 ITYMLMEQPSQRPNSYQVL--EEVSSMQ 300
           +   L++ P  RP++ ++L  E V+++Q
Sbjct: 248 VASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 100/203 (49%), Gaps = 31/203 (15%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY D G L D++ +R   +L E E ++   Q+ QG++  H+ +  + HRD
Sbjct: 212 ENKSELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICHRD 267

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA--QYRAPEMI- 215
           +K EN+LL  K +  K+ DFG           A EVS   + +++ +     Y +PE++ 
Sbjct: 268 LKPENLLLDKKNKSIKIADFGMA---------ALEVS---NKLLQTSCGSPHYASPEIVM 315

Query: 216 -DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDR 270
              Y G P    SD+W+ G+ L+ L     PF  +    +L       F  P     S  
Sbjct: 316 GRPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQ--NLSAE 369

Query: 271 LKKLITYMLMEQPSQRPNSYQVL 293
            K L++ +L+  P +R  + ++L
Sbjct: 370 AKDLMSKILVVNPFKRIATEEIL 392

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 130/275 (47%), Gaps = 43/275 (15%)

Query: 31  GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYID 90
           G    +Y       D  TN ++A +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 636 GASGGVYIAN----DVSTNESIA-IKQMNLEKQPKKELIINEILVMKGSKH-PNIVNFID 689

Query: 91  SHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHA 150
           S+       +G  +++++MEY + G L D +   +   L E +I  +  +   G+  +H+
Sbjct: 690 SYLL-----DG--DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLQFLHS 739

Query: 151 LHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA--- 207
               +LHRDIK +N+LL+  G  K+ DFG  C            + V    +K TT    
Sbjct: 740 --KGVLHRDIKSDNILLSINGNIKLTDFG-FC------------AQVNETTLKRTTMVGT 784

Query: 208 -QYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNY 264
             + APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P  
Sbjct: 785 PYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPEL 841

Query: 265 PQ---YSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
            +    SD LK  + + L   P QR ++ ++LE+V
Sbjct: 842 KEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 124/293 (42%), Gaps = 37/293 (12%)

Query: 16  TVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDT 75
           TVG    + ++ L  G   ++Y V+    D+     +     +I   K  +  + AE + 
Sbjct: 476 TVGPQSFEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKK--IKRILAEQEI 533

Query: 76  MKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEIL 135
           +    N+  +V+   S   +       Y ++L MEYC  G     + TR  + + ED+  
Sbjct: 534 LAT-SNHPFIVTLYHSFQTE------DY-LYLCMEYCMGGEFFRALQTRKTKCISEDDAR 585

Query: 136 NIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVS 195
              S+VT  +  +H +    ++RD+K EN+LL   G   + DF  +    + P N Q   
Sbjct: 586 FYASEVTAALEYLHLM--GFIYRDLKPENILLHQSGHIMLSDF-DLSVQAKGPRNPQVKG 642

Query: 196 YVQHDIMKN-------------TTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYY 242
             Q  ++                T +Y APE+I   RG       D W LG+  Y++ + 
Sbjct: 643 NAQSSLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTASVDWWTLGILTYEMLFG 699

Query: 243 TTPFEKNGE------AAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNS 289
            TPF+  GE      + IL     FPN  + S   K LI  +L++  ++R  S
Sbjct: 700 FTPFK--GENTNQTFSNILKVEATFPNNNEISRTCKDLIKKLLIKSETKRLGS 750

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 104/224 (46%), Gaps = 35/224 (15%)

Query: 31   GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS--------LNTLRAEVDTMKLLRNN 82
            G F  +Y          T   +  +K+V VP   S        +  LR+EV T+K L ++
Sbjct: 1105 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-DH 1158

Query: 83   AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
             ++V Y+      F   +  Y +FL  EY   G +   +  R+  R  E  I ++  QV 
Sbjct: 1159 LNIVQYLG-----FENKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVL 1209

Query: 143  QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            +G++ +H+    +LHRD+K +N+LL   G  K+ DF    GI R  ++     Y   D+ 
Sbjct: 1210 RGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSNDI----YSNSDMT 1259

Query: 203  KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1260 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPW 1301

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 97/196 (49%), Gaps = 22/196 (11%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPP-LLHRDIKIE 163
           ++++MEYC  G +   +      ++ E  I  IM ++   + A+H +H   ++HRDIK  
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMREL---LVALHYIHKDNVIHRDIKAA 167

Query: 164 NVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPI 223
           N+L+T++G  K+CDFG    + +     Q ++          T  + APE+I    G+  
Sbjct: 168 NLLITNEGNVKLCDFGVAAQLNQNTMRRQTMA---------GTPYWMAPEVI--MEGISY 216

Query: 224 DEKSDIWALGVFLYKLCYYTTPF-EKNGEAAILHATFQFPNYPQYSDR---LKKLITYML 279
           D K+DIW++G+  Y++     PF E     A+   +   P   +  +    LK+ I   L
Sbjct: 217 DTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCL 276

Query: 280 MEQPSQRPNSYQVLEE 295
            E P +RP + ++L E
Sbjct: 277 DEDPQERPTADKLLHE 292

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 103/213 (48%), Gaps = 24/213 (11%)

Query: 102 SYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIK 161
           S   ++L EY   G L+D++       LRE         +   +  +HA +  ++HRD+K
Sbjct: 236 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLK 291

Query: 162 IENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YR 219
           IEN+++++ GE K+ DFG +  +  P +                +  + APE++    Y 
Sbjct: 292 IENIMISTSGEIKIIDFG-LSNMFDPRTQLHTFC---------GSLYFAAPELLKASPYV 341

Query: 220 GLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFP--NYPQY-SDRLKKLIT 276
           G  +    D+W+ GV LY L     PF+ +  +++LH   +    +YPQ+ S  +  L++
Sbjct: 342 GPEV----DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVDYPQHLSIEVISLLS 396

Query: 277 YMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPNF 309
            ML+  P +R +  QV+E    ++    P P++
Sbjct: 397 KMLVVDPRKRASLKQVVEHHWMIRGYDFPAPSY 429

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 143/311 (45%), Gaps = 51/311 (16%)

Query: 9   YQPGTLLTVGSH-KVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLN 67
           ++ G  L  GS  +V++ K + +G   Q+  ++I P  K     V C     VP+  S +
Sbjct: 81  WKLGKTLGKGSSGRVRLAKNMETG---QLAAIKIVPKKK---AFVHCSNNGTVPNSYSSS 134

Query: 68  TLRAEVDTMKLL-RNNAH-------------VVSYIDSHA---AKFNPNEGSYEVFLLME 110
            + + V +  +  R +++             V+  + SH    A F   E   E++L++E
Sbjct: 135 MVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLE 194

Query: 111 YCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSK 170
           Y D G L D++ ++   +L E E ++   Q+ +G++  H+ +  + HRD+K EN+LL  K
Sbjct: 195 YVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDKK 250

Query: 171 G-EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKS 227
               K+ DFG     +  P+   + S          +  Y +PE++    Y G P    S
Sbjct: 251 NRRIKIADFG--MAALELPNKLLKTSC--------GSPHYASPEIVMGRPYHGGP----S 296

Query: 228 DIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLKKLITYMLMEQP 283
           D+W+ G+ L+ L     PF  +    +L       +Q P+    S   + LI+ +L+  P
Sbjct: 297 DVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPS--NLSSEARDLISKILVIDP 354

Query: 284 SQRPNSYQVLE 294
            +R  + ++L+
Sbjct: 355 EKRITTQEILK 365

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 80/357 (22%), Positives = 152/357 (42%), Gaps = 47/357 (13%)

Query: 11  PGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLR 70
           P +L+       +  ++L  GGFA+ + ++      F    VA   ++ +  + +   L 
Sbjct: 131 PPSLIKTRGRDYRRGQFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLL 187

Query: 71  AEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLR 130
           +E+   K +++  ++V ++D      N       V++L+  C  G L++ +  R  + L 
Sbjct: 188 SEIQIHKSMKHQ-NIVQFVDCFEDHIN-------VYILLGMCPNGSLMELLKKR--KILT 237

Query: 131 EDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSN 190
           E E+     Q+   I  MH+    ++HRD+K+ N+        K+ DFG    +    +N
Sbjct: 238 EPEVRFFTVQICGAIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVL----AN 291

Query: 191 AQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG 250
            +E  Y         T  Y APE++ L +      + DIW++GV ++ L     PF+   
Sbjct: 292 DRERKYTV-----CGTPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKD 345

Query: 251 ----EAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVS--------S 298
                + I ++ + FP     S   K LI  +L+  P  RP+  +++E V         +
Sbjct: 346 VNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMT 405

Query: 299 MQNVQCPIPNF--YL--------MNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPN 345
              V   IP +  +L          N + Q  + +     NNG ++++ N+   V N
Sbjct: 406 SNTVFTEIPEYDQFLTPNESLNNFRNCMIQSGLILPDNKGNNGTILSTNNISSAVDN 462

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 107/224 (47%), Gaps = 35/224 (15%)

Query: 31   GGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS--------LNTLRAEVDTMKLLRNN 82
            G F  +Y          T   +  +K+V VP   S        ++ +++EV T+K L ++
Sbjct: 1263 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKDL-DH 1316

Query: 83   AHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVT 142
             ++V Y+      F   +  Y +FL  EY   G +   +  R+  R  E  I ++  QV 
Sbjct: 1317 LNIVQYLG-----FENKDNIYSLFL--EYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVL 1367

Query: 143  QGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIM 202
            +G+A +HA    +LHRD+K +N+LL   G  K+ DF    GI R    ++++ Y   D+ 
Sbjct: 1368 RGLAYLHARG--ILHRDMKADNLLLDQDGVCKISDF----GISR---KSKDI-YSNSDMT 1417

Query: 203  KNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               T  + APEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1418 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1459

>TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {ON}
           Anc_8.652 YOR231W
          Length = 713

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 103/225 (45%), Gaps = 35/225 (15%)

Query: 88  YIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER---LREDEILNIMSQVTQG 144
           YI  +   F  N+ +  +F+ MEY   GG +D +   L ER   + E  +  I   V +G
Sbjct: 484 YIVRYYGMFADNQRT-SIFIAMEYMG-GGSLDGIYKHLLERGGRIGEKVLGKIAESVLRG 541

Query: 145 IAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKN 204
           ++ +H     ++HRDIK +N+LL   G+ K+CDFG V G      N+   ++        
Sbjct: 542 LSYLH--EKKVIHRDIKPQNILLNELGQVKLCDFG-VSG---EAVNSLATTFTG------ 589

Query: 205 TTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG--------EAAILH 256
            T+ Y APE I   +G P     D+W+LG+ L ++     PF            +  +L 
Sbjct: 590 -TSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAEAKFPFGSENLKTNLAPIDLLMLI 645

Query: 257 ATF------QFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
            TF      +  N+  +S   +  I Y L + PS RP+  Q++  
Sbjct: 646 LTFTPNLKEEPENHIVWSSSFRSFIDYCLKKDPSDRPSPRQMIRH 690

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 108/234 (46%), Gaps = 36/234 (15%)

Query: 69  LRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128
           +  E+  MKLL N+ +V+   D      N       +++++EY + G L +     L E+
Sbjct: 90  IEREIIIMKLL-NHTNVLRLYDVWETNNN-------LYMVLEYAEKGELFNL----LVEK 137

Query: 129 --LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIR 186
             L E+E +    Q+  G++  HAL   ++HRD+K EN+LL  K   K+ DFG     + 
Sbjct: 138 GPLAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPENILLDHKSNIKIADFGMAA--LE 193

Query: 187 PPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTTP 245
                 E S          +  Y APE++    GLP +  ++DIW+ GV L+ L     P
Sbjct: 194 TEDKLLETSC--------GSPHYAAPEIVS---GLPYNGLETDIWSCGVILFALLTGRLP 242

Query: 246 F-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
           F E++G    L        F+ P   + S   + LI  +L   P QR  + ++L
Sbjct: 243 FDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREIL 296

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 79/175 (45%), Gaps = 22/175 (12%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +   L+  + E E+  I  Q+  GI  +H     ++HRDIK ENV++ + G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y APE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRP 287
            G+ LY + +   PF    E  IL     F      S   K LI+ +L     +RP
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRP 1427

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 94/194 (48%), Gaps = 27/194 (13%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E+FL++EY D G L D++ +R   RL E E ++   Q+ +G A  H+ +  + HRD
Sbjct: 127 ENKLELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRD 182

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--D 216
           +K EN+LL  K +  K+ DFG     ++  +   E S          +  Y +PE++   
Sbjct: 183 LKPENLLLDKKNKRIKIADFG--MAALQTSNKLLETSC--------GSPHYASPEIVMGK 232

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF  +    +L       +Q P     S   +
Sbjct: 233 TYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--AISLEAQ 286

Query: 273 KLITYMLMEQPSQR 286
            LI+ +L+  P++R
Sbjct: 287 DLISRILVVDPNKR 300

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 106/219 (48%), Gaps = 30/219 (13%)

Query: 85  VVSYIDSHA---AKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQV 141
           V+  + SHA   A F   E   E++L++EY D G L D++ ++   +L E E ++   Q+
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQI 223

Query: 142 TQGIAAMHALHPPLLHRDIKIENVLLTSKG-EYKVCDFGSVCGIIRPPSNAQEVSYVQHD 200
            +G++  H+ +  + HRD+K EN+LL  K  + K+ DFG     +  P+   + S     
Sbjct: 224 VEGVSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFG--MAALELPNKLLKTSC---- 275

Query: 201 IMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL--- 255
                +  Y +PE++    Y G P    SD+W+ G+ L+ L     PF  +    +L   
Sbjct: 276 ----GSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKV 327

Query: 256 -HATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
               +Q P     S   + LI+ +L+  P +R  + ++L
Sbjct: 328 QSGKYQMP--MNLSAEARDLISKILVINPEKRITTQEIL 364

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 111/234 (47%), Gaps = 42/234 (17%)

Query: 72  EVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER--L 129
           E+  MKLL N+ +V+         F+  E + +++L++EY + G L +     L ER  L
Sbjct: 79  EIIIMKLL-NHPNVLRL-------FDVWETNSDLYLVLEYAEKGELFNM----LVERGPL 126

Query: 130 REDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPS 189
            E+E +    Q+  GI+  H+L   ++HRD+K EN+LL +K   K+ DFG          
Sbjct: 127 PENEAVRAFRQIIIGISYCHSLG--VVHRDLKPENLLLDNKLNIKIADFGMAA------- 177

Query: 190 NAQEVSYVQHDIMKNTTA---QYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTTP 245
                     D +  T+     Y APE+I    GLP +   SD+W+ GV L+ L     P
Sbjct: 178 ------LESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLP 228

Query: 246 F-EKNGEA-----AILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
           F E++G        +    F+ P+  + +   + L+  +L   PS+R    ++L
Sbjct: 229 FDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREIL 282

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 95/199 (47%), Gaps = 31/199 (15%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           V++ +EYC    L D++   L++R+  DE   + +Q+   +   H+L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLP 222
           +LL   G   + DF    G  R  +   ++  V        T  Y APE+I  + Y G  
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKNGEA----AILH---ATFQFPNYPQYSDRLKKLI 275
           +    D W+LG+ LY + +   PF+++        I+H   A       PQ  D    LI
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKD----LI 260

Query: 276 TYMLMEQPSQRPNSYQVLE 294
             +L +  +QRPN  +VL+
Sbjct: 261 VRLLDKNAAQRPNLNEVLQ 279

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 143/305 (46%), Gaps = 45/305 (14%)

Query: 19   SHKVQVVKYLTSGGFAQIYT-VQISPPDKFTNTNVACLKRVIVPDKPSLN----TLRAEV 73
            S + Q   ++ SG F  +Y+ V +   D      +  +K + + D  S+     +L+ E+
Sbjct: 1256 SIRWQKRSFIGSGSFGTVYSAVNLDTGD------ILAVKEIKIQDAKSMKQIFPSLKEEM 1309

Query: 74   DTMKLLRNNAHVVSY--IDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLRE 131
              M++L N+ ++V Y  ++ H  K N         + ME+C+   L   +      R+ +
Sbjct: 1310 RVMEIL-NHPNIVQYYGVEVHRDKVN---------IFMEFCEGSSLASLLE---HGRIED 1356

Query: 132  DEILNIMS-QVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPS- 189
            + +  + + Q+ +G+A +H     ++HRDIK EN+LL   G  K  DFG+   I +  S 
Sbjct: 1357 EMVTQVYTLQLLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSK 1414

Query: 190  ----NAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTP 245
                +A   S    D++   T  Y APE +   +G       DIW+LG  + ++     P
Sbjct: 1415 RISLDANNKSTGGKDMIG--TPMYMAPETVT-GQGHGKFGSDDIWSLGCVVLEMVTGRRP 1471

Query: 246  FEK-NGEAAILHATF-----QFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEE--VS 297
            +   + E AI++        QFP   + S   +K I+  L++  ++R  + ++L +  +S
Sbjct: 1472 WANLDNEWAIMYHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELLLDPWIS 1531

Query: 298  SMQNV 302
             ++N+
Sbjct: 1532 QIRNI 1536

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 131/269 (48%), Gaps = 38/269 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  MK  ++ +++V++I
Sbjct: 340 SGGVYTAYELG-------TNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-SNIVNFI 390

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  K        +++++MEY + G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 391 DSYLLK-------GDLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLKGLQFLH 440

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    ++HRDIK +N+LL+  G+ K+ DFG  C  I       EV+  +  ++   T  +
Sbjct: 441 S--KGVIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN------EVNLKRTTMVG--TPYW 489

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P     
Sbjct: 490 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDP 546

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVL 293
              SD LK+ + + L   P  R N+ ++L
Sbjct: 547 ENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 94/196 (47%), Gaps = 24/196 (12%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++L++EY + G L + +  R    L E E +    Q+   ++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHAL--GIVHRDLKPEN 157

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPID 224
           +LL S    KV DFG     ++  +   E S          +  Y APE++    GLP +
Sbjct: 158 LLLDSDYNIKVADFGMAA--LQTDAALLETSC--------GSPHYAAPEIVS---GLPYE 204

Query: 225 E-KSDIWALGVFLYKLCYYTTPF-EKNGEAAIL-----HATFQFPNYPQYSDRLKKLITY 277
              SD+W+ GV L+ L     PF E+NG    L        F+ P+  + S   + LI+ 
Sbjct: 205 GFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQDLISK 264

Query: 278 MLMEQPSQRPNSYQVL 293
           +L+  P+QR     +L
Sbjct: 265 ILVVDPAQRIKIRDIL 280

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 98/202 (48%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
           GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +  ++
Sbjct: 99  GSYLKNTSLWIIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKYIHKDN--VI 153

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  NVL+ + G  K+CDFG    + +  S  Q ++          T  + APE+I 
Sbjct: 154 HRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTPYWMAPEVI- 203

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYP--QYSDRLK 272
              G+  D K+DIW+ G+  Y++     P+   +   A  L A  + P      YS  +K
Sbjct: 204 -MEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIK 262

Query: 273 KLITYMLMEQPSQRPNSYQVLE 294
           + I   L E PS+RP + ++L+
Sbjct: 263 EFIATCLDEDPSERPTADELLK 284

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 110/237 (46%), Gaps = 30/237 (12%)

Query: 65   SLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTR 124
            +++ LR EV T+K L ++ ++V Y+      F    G Y +FL  EY   G +   +  R
Sbjct: 1186 TVDALRLEVSTLKDL-DHLNIVQYLG-----FEAKNGIYSLFL--EYVAGGSVGSLI--R 1235

Query: 125  LQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGI 184
            +  R  +  I ++  QV QG++ +H+    +LHRD+K +N+LL   G  K+ DF    GI
Sbjct: 1236 MYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GI 1289

Query: 185  IRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTT 244
             R  ++     Y   ++    T  + APEM+D  +G     K DIW+LG  + ++     
Sbjct: 1290 SRKSNDI----YSNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1343

Query: 245  PFEKNGEAAILHATFQFPN--------YPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
            P+      A +    Q  +         P  S+  K+ +       P +RP + ++L
Sbjct: 1344 PWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 106/230 (46%), Gaps = 27/230 (11%)

Query: 69  LRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128
           +R E+  +  L+   ++  Y  S+           +++++MEYC  G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLID-------TKLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP 188
           + E  I  IM ++   + ++H  +  ++HRDIK  N+L+ + G  K+CDFG    + +  
Sbjct: 109 IEEKYIGVIMREILVALISIHRDN--VIHRDIKAANILIANNGSVKLCDFGVAAQLSQ-- 164

Query: 189 SNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF-E 247
                 S ++   M   T  + APE+I    G+  D K DIW+LG+  Y++     P+  
Sbjct: 165 ------SMLKRQTMAG-TPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCH 215

Query: 248 KNGEAAILHATFQFP---NYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
                A+   T   P      +YS  LK+ I   L E P +RP + ++ +
Sbjct: 216 MEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERPYAEELFK 265

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 111/236 (47%), Gaps = 30/236 (12%)

Query: 66   LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
            L  LR+EV T+K L ++ ++V Y+      F      Y +FL  EY   G +   +  RL
Sbjct: 1193 LEALRSEVATLKDL-DHTNIVQYLG-----FENKNYVYSLFL--EYVAGGSVGSLI--RL 1242

Query: 126  QERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGII 185
              +  E+ I  +  QV +G++ +H+    +LHRD+K +N+LL   G  K+ DF    GI 
Sbjct: 1243 YGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMKADNLLLDVDGICKISDF----GIS 1296

Query: 186  RPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTP 245
            +  +N     Y   D+    T  + APEM+D  +G     K DIW+LG  + ++     P
Sbjct: 1297 KKSNNI----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1350

Query: 246  FEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLME--------QPSQRPNSYQVL 293
            +      A +    +F + P   +  +K+I+    E         P +RP + ++L
Sbjct: 1351 WSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 107/215 (49%), Gaps = 28/215 (13%)

Query: 102 SYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIA-AMHALHPP-LLHRD 159
           S   ++L EY   G L+D++       LRE        + T+GIA A+  LH   ++HRD
Sbjct: 174 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHH----ARKFTRGIASALQYLHANNIVHRD 227

Query: 160 IKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL-- 217
           +KIEN+++++ GE K+ DFG         SN  + S   H      +  + APE++    
Sbjct: 228 LKIENIMISTSGEIKIIDFGL--------SNLFDKSKQLHTFC--GSLYFAAPELLKASP 277

Query: 218 YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFP--NYPQY-SDRLKKL 274
           Y G  +    D+W+ GV LY L     PF+ +  +++LH   +     YPQ+ S  +  L
Sbjct: 278 YTGPEV----DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVEYPQHLSIEVISL 332

Query: 275 ITYMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPNF 309
           ++ ML+  P +R +  QV+E    ++    P P++
Sbjct: 333 LSKMLVVDPHRRASLKQVVEHHWMVRGYDGPPPSY 367

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 86/184 (46%), Gaps = 26/184 (14%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +    +  + E E   I  Q+  GI  +H     ++HRDIK ENV++ SKG  K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y APE++  + Y G P     DIWA+
Sbjct: 1272 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAI 1316

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQV 292
            G+ LY + +   PF    E  IL    +F N    S+   +LI  +L+    +RP    +
Sbjct: 1317 GILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRP----L 1370

Query: 293  LEEV 296
            +EE+
Sbjct: 1371 IEEI 1374

>ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR231W (MKK1) and
           YPL140C (MKK2)
          Length = 524

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 107/224 (47%), Gaps = 37/224 (16%)

Query: 88  YIDSHAAKFNPNEGSYEVFLLMEYCDMGGL-IDFMNTRLQE---RLREDEILNIMSQVTQ 143
           YI  +   F   E S  +++ MEY  MGG  +D +   L +   R+ E  +  I   V +
Sbjct: 294 YIVRYYGMFTDEEHS-SIYIAMEY--MGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLR 350

Query: 144 GIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMK 203
           G++ +H     ++HRDIK +N+LL   G+ K+CDFG V G      N+   ++       
Sbjct: 351 GLSYLH--QRKIIHRDIKPQNILLNEAGQVKLCDFG-VSG---EAVNSLATTF------- 397

Query: 204 NTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAA---------- 253
             T+ Y APE I   +G P    SD+W+LG+ L ++     PF+    AA          
Sbjct: 398 TGTSYYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQAHFPFDSGKFAANMPPIELLML 454

Query: 254 ILHATFQFPNYPQ----YSDRLKKLITYMLMEQPSQRPNSYQVL 293
           IL  T Q  + P+    +S   K  I+Y L ++  +RP+  Q+L
Sbjct: 455 ILTFTPQLKDEPEANIVWSKAFKSFISYCLKKESRERPSPRQML 498

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 97/201 (48%), Gaps = 27/201 (13%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E++L++EY D G L D++ +R   +L E E ++   Q+ QG++  H+ +  + HRD
Sbjct: 222 ENKSELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICHRD 277

Query: 160 IKIENVL-LTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--D 216
           +K EN+L    K   K+ DFG     +  P    + S          +  Y +PE++   
Sbjct: 278 LKPENLLIDKKKKSIKIADFG--MAALELPKKLLQTSC--------GSPHYASPEIVMGK 327

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF  +    +L       +Q P     SD  K
Sbjct: 328 SYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMPK--NLSDEAK 381

Query: 273 KLITYMLMEQPSQRPNSYQVL 293
            LI+ +L+  PS+R  + ++L
Sbjct: 382 DLISRILVVSPSKRLTTVEIL 402

>CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {ON}
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047w or uniprot|P25341 Saccharomyces cerevisiae
           YCR091w KIN82
          Length = 895

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 127/293 (43%), Gaps = 35/293 (11%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVD 74
           +TVG    + ++ L  G   ++Y V+    ++     +     +I   K  +  + AE +
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKK--IKRILAEQE 547

Query: 75  TMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEI 134
            +    N+  VV+   S  ++       Y ++L MEYC  G     + TR  + + E++ 
Sbjct: 548 IL-ATSNHPFVVTLYHSFQSE------DY-LYLCMEYCMGGEFFRALQTRKSKCISEEDA 599

Query: 135 LNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF-----GSVCGIIRPPS 189
               S+VT  +  +H L    ++RD+K EN+LL   G   + DF          +     
Sbjct: 600 KFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDLSIQAKDAKVPVVKG 657

Query: 190 NAQEV---SYVQHDIMKNT----TAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYY 242
           NAQ     + +  D  +      T +Y APE+I   RG       D W LG+ +Y++ + 
Sbjct: 658 NAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEMLFG 714

Query: 243 TTPFEKNGE------AAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNS 289
            TPF+  GE      + IL     FPN  + S   K LI  +L++  S+R  S
Sbjct: 715 FTPFK--GENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNESKRLGS 765

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 129/284 (45%), Gaps = 38/284 (13%)

Query: 19  SHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKL 78
           +H   V + +  G F  +Y       D+ TN  VA     +      L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVY----RAIDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 79  LRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIM 138
           L++  ++++YI +     +       ++++MEYC  G   D +       L E ++  I 
Sbjct: 75  LKS-PYIINYITTLLEDAS-------MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 SQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQ 198
            ++ +G+  +H      +HRDIK  N+LLT +G  K+ DFG V G ++  S  +  + V 
Sbjct: 127 REILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLK--STLRRGTIV- 180

Query: 199 HDIMKNTTAQYRAPEM----IDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAI 254
                  T  + APE+    I+ Y     DEK DIW+LG+ +++L     P  K     +
Sbjct: 181 ------GTPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRV 229

Query: 255 LHATFQFPNYPQ----YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           L A     + P+    YSD  K  +   L++ P++RP +  +L+
Sbjct: 230 L-ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 128/274 (46%), Gaps = 36/274 (13%)

Query: 24  VVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS----LNTLRAEVDTMKLL 79
           V++ +  GGFA++ ++ ++  DK+        K  ++ +  +       +  E+  M  L
Sbjct: 672 VLQDMGEGGFAKV-SLCLNKEDKYVVVIKKVFKEKVLEETWTSDNKFGNIPREIQIMSTL 730

Query: 80  RN--NAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMN-TRLQERLREDEILN 136
               N + +  +D     F  +E  Y +  L+    M G ID  +    ++++ E E   
Sbjct: 731 HKYPNKNTLRMLD-----FFEDENFYYIETLVH--SMKGSIDLFDFIEKKDKIDEVEQKL 783

Query: 137 IMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSY 196
           I  Q+  GI  +H L   ++HRDIK EN+++ S+G  +V DFGS       P        
Sbjct: 784 IFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVIDFGSAAYATNGPFQ------ 835

Query: 197 VQHDIMKNTTAQYRAPEMIDLYRGLPIDEK-SDIWALGVFLYKLCYYTTPFEKNGEAAIL 255
           V H      T  Y +PE++   +G P + K  D+WALG+ LY + +  TPF  N  A I+
Sbjct: 836 VFH-----GTIDYASPEVL---KGEPYEGKPQDVWALGILLYIITFKQTPF--NSVAEII 885

Query: 256 HATFQF-PNYPQ-YSDRLKKLITYMLMEQPSQRP 287
               +  P + +  SD+ + LI  ML ++   RP
Sbjct: 886 ENELEIDPAHSENVSDQCRVLIHKMLDKKAWARP 919

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 96/205 (46%), Gaps = 30/205 (14%)

Query: 101 GSY----EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
           GSY     ++++MEYC  G L   +      ++ E  I  IM +V   +  +H  +  ++
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  NVL+T++G  K+CDFG    + +     Q ++          T  + APE+I 
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT-FQFPNYP------QYSD 269
              G+  D K DIW+LG+  Y++     P+    E   L A      + P       YS 
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPY---CEVEALRAMQLIIKSKPPRLEGRSYSP 247

Query: 270 RLKKLITYMLMEQPSQRPNSYQVLE 294
            LK+ I   L E P +R ++  +L+
Sbjct: 248 SLKEFIALCLDEDPKERLSADDLLK 272

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 131/272 (48%), Gaps = 38/272 (13%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y V        TN +VA +K++ +  +P    +  E+  MK  ++  ++V++I
Sbjct: 634 SGGVYTAYEVG-------TNASVA-IKQMNLEKQPKKELIINEILVMKGSKHQ-NIVNFI 684

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  K        +++++MEY + G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 685 DSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLH 734

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    ++HRDIK +N+LL+  GE K+ DFG  C  I       E++  +  ++   T  +
Sbjct: 735 S--KGVIHRDIKSDNILLSMNGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYW 783

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P   + 
Sbjct: 784 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 840

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296
              S  LK  + + L   P  R ++ ++L +V
Sbjct: 841 EVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 119/264 (45%), Gaps = 38/264 (14%)

Query: 47   FTNTNVACLKRVIVPDKPS-----LNTLRA---EVDTMKLLRNNAHVVSYIDSHAAKFNP 98
             T   +  +K++ VP   S     LNT+ A   EV T+K L ++ ++V Y+      F  
Sbjct: 1155 ITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDL-DHLNIVQYLG-----FEM 1208

Query: 99   NEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHR 158
                Y +FL  EY   G +   +  R+  R  +  I ++ +QV +G++ +H+    +LHR
Sbjct: 1209 KHNIYSLFL--EYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLHS--QGILHR 1262

Query: 159  DIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLY 218
            D+K +N+LL   G  K+ DFG         S   E  Y   ++    T  + APEM+D  
Sbjct: 1263 DMKADNLLLDQDGICKISDFG--------ISKKSEDIYSNSEMTMRGTVFWMAPEMVDTK 1314

Query: 219  RGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLIT-- 276
            +G   + K DIW+LG  + ++     P+        ++   Q  + P   +  K LI+  
Sbjct: 1315 QGY--NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPT 1372

Query: 277  ------YMLMEQPSQRPNSYQVLE 294
                        P +RP + Q+LE
Sbjct: 1373 AKNFLNQCFHIDPKERPTAGQLLE 1396

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 18/198 (9%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++L MEYC  G     + TR  +R+ E++     S+V   +  +H L    ++RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLL--GFIYRDLKPEN 450

Query: 165 VLLTSKGEYKVCDFG-SVCGIIRPPSNAQEVSYVQHDIMKN--------TTAQYRAPEMI 215
           +LL   G   + DF  S+          ++ +Y+   +  +         T +Y APE+I
Sbjct: 451 ILLHQSGHVMLSDFDLSIQATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI 510

Query: 216 DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGE----AAILHATFQFPNYPQYSDRL 271
              RG       D W LG+ +Y++ +  TPF+ +      + IL    +FP+  + S   
Sbjct: 511 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFPHDKEISKHC 567

Query: 272 KKLITYMLMEQPSQRPNS 289
           K LI  +L +  S+R  S
Sbjct: 568 KDLIKRLLNKNESKRLGS 585

>KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {ON}
           Anc_8.652 YOR231W
          Length = 500

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 119/253 (47%), Gaps = 42/253 (16%)

Query: 65  SLNTLRAEVDTMK-----LLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGG-LI 118
           ++NTL  + +  K     L  N +    YI  +   F  +E +  +F+ MEY  MGG  +
Sbjct: 240 TINTLNTDPEFQKQIFRELQFNRSFKSDYIVRYYGMFT-DESNSSIFIAMEY--MGGKSL 296

Query: 119 DFMNTRLQER---LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKV 175
           D +   L +R   + E  +  I   V +G++ +H     ++HRDIK +N+LL  +GE K+
Sbjct: 297 DAIYKNLLKRNGKISEKVLGKIAEDVLRGLSYLH--EKKVIHRDIKPQNILLNDRGEVKL 354

Query: 176 CDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVF 235
           CDFG     +    N+   ++         T+ Y APE I   +G P     D+W+LG+ 
Sbjct: 355 CDFGVSGEAV----NSLATTFT-------GTSFYMAPERI---KGEPYSVTCDVWSLGLT 400

Query: 236 LYKLCYYTTPF--EK-NGEAA-------ILHATFQFPNYPQ----YSDRLKKLITYMLME 281
           + ++     PF  EK N   A       IL  T +  + P+    ++   K  I Y L +
Sbjct: 401 ILEVAEGHFPFGSEKINNTIAPIELLVYILTFTPELKDEPEIGISWTSSFKSFIEYCLKK 460

Query: 282 QPSQRPNSYQVLE 294
            P +RP+  Q+++
Sbjct: 461 DPRERPSPRQMIQ 473

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 96/201 (47%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           E++L++EY + G L D++ +R   +L E E ++   Q+ QG++  H  H  + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCH--HFNICHRDLKPE 196

Query: 164 NVLLTSKG-EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA---QYRAPEMI--DL 217
           N+LL  K    K+ DFG           A E +    D +  T+     Y +PE++    
Sbjct: 197 NLLLDKKNLSVKIADFGMA---------ALETT----DKLLETSCGSPHYASPEIVMGQK 243

Query: 218 YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLKK 273
           Y G P    SD+W+ G+ L+ L     PF  +    +L       +Q P     S+  K 
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKD 297

Query: 274 LITYMLMEQPSQRPNSYQVLE 294
           LI  +L+  P+ R    +VLE
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 96/201 (47%), Gaps = 27/201 (13%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E+FL++EY D G L D++ +R   RL E E ++   Q+ +G A  H  +  + HRD
Sbjct: 127 ENKLELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRD 182

Query: 160 IKIENVLLTSKGE-YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--D 216
           +K EN+LL  K +  K+ DFG     ++  +   E S          +  Y +PE++   
Sbjct: 183 LKPENLLLDKKNKRIKIADFG--MAALQTSNKLLETSC--------GSPHYASPEIVMGK 232

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF  +    +L       +Q P     S   +
Sbjct: 233 NYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSGAQ 286

Query: 273 KLITYMLMEQPSQRPNSYQVL 293
            LI+ +L+  P +R +  ++L
Sbjct: 287 DLISRILVVDPDKRISINEIL 307

>NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON}
           Anc_6.371
          Length = 918

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 124/288 (43%), Gaps = 31/288 (10%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVD 74
           +TVG    + +K L  G   ++Y V+    ++     +     +I   K  +  + AE +
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKK--IKRILAEQE 569

Query: 75  TMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEI 134
            +    N+  VV+   S  ++       Y ++  MEYC  G     + TR  + + ED+ 
Sbjct: 570 IL-ATSNHPFVVTLYHSFQSE------DY-LYFCMEYCMGGEFFRALQTRRTKCISEDDA 621

Query: 135 LNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFG-SV-CGIIRPP--SN 190
               S+VT  +  +H L    ++RD+K EN+LL   G   + DF  SV     + P    
Sbjct: 622 RFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKVPVMKG 679

Query: 191 AQEVSYVQHDIMKN--------TTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYY 242
           + E + V   I  +         T +Y APE+I   RG       D W LG+ +Y++ + 
Sbjct: 680 SAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEMLFG 736

Query: 243 TTPFEKNGE----AAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQR 286
            TPF+ +      + IL     FPN    S   K LI  +L +  ++R
Sbjct: 737 FTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKNEAKR 784

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 97/188 (51%), Gaps = 16/188 (8%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++++MEYC  G   D +    +  L E++   I  +V +G+  +H      +HRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPID 224
           +LLT  G  K+ DFG V G I+  +  ++ ++V        T  + APE++        +
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIK--ATLKKDTFV-------GTPYWMAPEVVKKDES-GYN 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGEAAILHAT--FQFPN-YPQYSDRLKKLITYMLME 281
           EK+DIW+LG+ +Y+L     P  K     ++ +    + P  +  YS+  K  I++ L++
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 282 QPSQRPNS 289
            P+ RPN+
Sbjct: 253 DPNARPNA 260

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 117/247 (47%), Gaps = 32/247 (12%)

Query: 54  CLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCD 113
           C K+ I+ +K  +  +  E D + +L    H+   I      F+  E    ++ ++EY  
Sbjct: 42  CSKKHIIREK-KVKYVTIEKDLLNMLAKGGHL--GIVKLFCTFHDIE---NLYFVLEYVS 95

Query: 114 MGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEY 173
            G L+  +  RL  RL ED   +I +Q+   +  MH+    ++HRD+K ENVLL+ +G  
Sbjct: 96  GGELLALIQ-RLG-RLTEDLSRHITAQLVDTVDYMHS--KGVIHRDLKPENVLLSQEGRV 151

Query: 174 KVCDFGSVC-GIIRPPSNAQE-VSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWA 231
            + DFG+ C    R   N +   S+V        TA+Y +PE++ L+        SDIWA
Sbjct: 152 VITDFGAACTAADRKFENTKRTASFVG-------TAEYVSPELL-LHSQCGFS--SDIWA 201

Query: 232 LGVFLYKLCYYTTPFEKNGE------AAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQ 285
           LG  +Y+L     PF    E         L   + F N PQ    +  ++  +L+  P +
Sbjct: 202 LGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQ----VVSIVQSILVTDPLK 257

Query: 286 RPNSYQV 292
           RP++ Q+
Sbjct: 258 RPSAAQL 264

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 137/307 (44%), Gaps = 61/307 (19%)

Query: 2   NQPQIPLYQPGTLLTVGSH-KVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60
           N+  +  ++ G  L  GS  +V++ K + +G  + I  V    P KF  +N   +K++  
Sbjct: 66  NRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIV----PKKFVKSN--QIKQLPY 119

Query: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSH---AAKFNPNEGSYEVFLLMEYCDMGGL 117
                   +  E+  MKL+           SH      +   E   E++L++EY + G L
Sbjct: 120 G-------IEREIIIMKLI-----------SHPNVMGLYEVWENKSELYLVLEYVEGGEL 161

Query: 118 IDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGE-YKVC 176
            D++ ++   +L E E ++   Q+ Q +A  H  +  + HRD+K EN+LL  K    K+ 
Sbjct: 162 FDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPENLLLDKKKRSIKIA 217

Query: 177 DFGSVCGIIRPPSNAQEVSYVQHDIMKNTTA---QYRAPEMI--DLYRGLPIDEKSDIWA 231
           DFG           A E S    D +  T+     Y +PE++    Y G P    SD+W+
Sbjct: 218 DFGMA---------ALETS----DKLLETSCGSPHYASPEIVLGRKYHGSP----SDVWS 260

Query: 232 LGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLKKLITYMLMEQPSQRP 287
            G+ L+ L     PF  +    +L       +Q P +   S   K LI+ +L+  P++R 
Sbjct: 261 CGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKDLISRILVVDPNRRI 318

Query: 288 NSYQVLE 294
              Q+L+
Sbjct: 319 TIDQILQ 325

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 101/208 (48%), Gaps = 27/208 (12%)

Query: 94  AKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHP 153
           A F   E   E++L++EY D G L D++ ++   +L E E ++   Q+ +G++  H+ + 
Sbjct: 178 ALFEVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN- 234

Query: 154 PLLHRDIKIENVLLTSKG-EYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAP 212
            + HRD+K EN+LL  K    K+ DFG     +  P+   + S          +  Y +P
Sbjct: 235 -ICHRDLKPENLLLDKKNRRIKIADFG--MAALELPNKLLKTSC--------GSPHYASP 283

Query: 213 EMI--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQ 266
           E++    Y G P    SD+W+ G+ L+ L     PF  +    +L       +Q P    
Sbjct: 284 EIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMP--MN 337

Query: 267 YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
            S   + LI+ +L+  P++R  + ++L+
Sbjct: 338 LSAEARDLISKILVIDPAKRITTQEILK 365

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 93/194 (47%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
           GSY    +++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +  ++
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELLVALLYIHKDN--VI 144

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  NVL+T+ G  K+CDFG    + +        S V+   M   T  + APE+I 
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAAQLTQ--------SNVRRQTMAG-TPYWMAPEVI- 194

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKNGEAAILHATFQFP---NYPQYSDRLK 272
              G+  D K DIW+LG+  Y++     P+ +     A+   T   P      QYS  LK
Sbjct: 195 -MEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSPLLK 253

Query: 273 KLITYMLMEQPSQR 286
           + I   L E P +R
Sbjct: 254 EFIALCLDEDPKER 267

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 108/236 (45%), Gaps = 38/236 (16%)

Query: 69  LRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128
           +  E+  MKLLR+  +V+S  D         E + ++++++EY + G L + +  R    
Sbjct: 77  IEREIIIMKLLRH-PNVLSLYDVW-------ETNSKLYMILEYAEKGELFNLLVERGP-- 126

Query: 129 LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP 188
           L E E +    Q+  GI+  HAL   ++HRD+K EN+LL  K   K+ DFG         
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKLNIKIADFGMAA------ 178

Query: 189 SNAQEVSYVQHDIMKNTTA---QYRAPEMIDLYRGLPIDE-KSDIWALGVFLYKLCYYTT 244
                      D M  T+     Y APE++    G+P    +SD+W+ GV L+ L     
Sbjct: 179 -------LETKDKMLETSCGSPHYAAPEIVS---GVPYHGFQSDVWSCGVILFALLTGRL 228

Query: 245 PFE------KNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           PF+      +N    +    ++ P+  + S   + LI  +L   P QR  +  +L+
Sbjct: 229 PFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILK 284

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 106/216 (49%), Gaps = 30/216 (13%)

Query: 102 SYEVFLLMEYCDMGGLIDFM--NTRLQERLREDEILNIMSQVTQGIA-AMHALH-PPLLH 157
           S   ++L EY   G L+D++  +  L+ER           +  +GIA A+  LH   ++H
Sbjct: 175 SNHFYMLFEYVSGGQLLDYIIQHGSLRERH--------ARKFARGIASALQYLHMNNIVH 226

Query: 158 RDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL 217
           RD+KIEN+++++ GE K+ DFG         SN  +     H      +  + APE++  
Sbjct: 227 RDLKIENIMISTSGEIKIIDFGL--------SNMYDPKKQLHTFC--GSLYFAAPELLKA 276

Query: 218 YRGLP-IDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFP--NYPQY-SDRLKK 273
           +   P I  + D+W+ GV LY L     PF+ +  A++LH   +     YPQ+ S  +  
Sbjct: 277 H---PYIGPEVDVWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYPQHLSIEVIS 332

Query: 274 LITYMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPNF 309
           L++ ML+  PS+R    QV+      +    P P++
Sbjct: 333 LLSKMLVVDPSKRATLKQVVSHQWMQRGYDFPAPSY 368

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 99/200 (49%), Gaps = 26/200 (13%)

Query: 102 SYEVFLLMEYCDMGGLIDFMNTRLQE-RLREDEILNIMSQVTQGIAAMHALHPPLLHRDI 160
           S   ++L EY   G L+D++   +Q   LRE         +   +  +H+ +  ++HRD+
Sbjct: 279 SNHFYMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLHSNN--IVHRDL 333

Query: 161 KIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--Y 218
           KIEN+++++ GE K+ DFG         SN  + +   H      +  + APE++    Y
Sbjct: 334 KIENIMISTSGEIKIIDFGL--------SNLYDTTRQLHTFCG--SLYFAAPELLKAHPY 383

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFP--NYPQY-SDRLKKLI 275
            G  +    D+W+ GV LY L     PF+ +  +++LH   +    +YPQ+ S  +  L+
Sbjct: 384 TGPEV----DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVDYPQHLSIEVISLL 438

Query: 276 TYMLMEQPSQRPNSYQVLEE 295
           + ML+  P +R    QV+E 
Sbjct: 439 SKMLVVDPKKRATLRQVVEH 458

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 131/297 (44%), Gaps = 42/297 (14%)

Query: 7   PLYQP-GTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS 65
           PL+ P  T +   S    + + +  G F  +Y       DK T   VA     +   +  
Sbjct: 20  PLHHPPDTAVEKPSQLYDIKECVGKGSFGDVYRA----IDKETGEMVAVKIINLEETQDD 75

Query: 66  LNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRL 125
           ++ L  E+  +  LR    V +Y  ++    +       ++++ME+C  G   D +    
Sbjct: 76  IDVLAQEIYFLSELRA-PFVTTYYKTYVEDVS-------MWIVMEFCGGGSCADLLKHLP 127

Query: 126 QERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGII 185
           + RL E+++  I+ +V  G+  +H+     +HRD+K  N+LLT +GE K+ DFG V G I
Sbjct: 128 EHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQI 184

Query: 186 RPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTP 245
              +  +  ++V        T  + APE+I    G   DEK+DIW+LG+   +L     P
Sbjct: 185 M--ATLKRNTFV-------GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPP 233

Query: 246 FEKNGEAAILHATFQFPNYP---------QYSDRLKKLITYMLMEQPSQRPNSYQVL 293
           + K     +L       N P         +++   +  I   L + P+ RP +  +L
Sbjct: 234 YAKYDPMKVLM------NIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 92/194 (47%), Gaps = 27/194 (13%)

Query: 100 EGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRD 159
           E   E+FL++EY D G L D++ +R   +L E E ++   Q+ +G++  H+ +  + HRD
Sbjct: 189 ENKSELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRD 244

Query: 160 IKIENVLLTSK-GEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--D 216
           +K EN+LL  K    K+ DFG     +  P+     S          +  Y +PE++   
Sbjct: 245 LKPENLLLDKKINTIKIADFG--MAALELPNKLLVTSC--------GSPHYASPEIVMGK 294

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAIL----HATFQFPNYPQYSDRLK 272
            Y G P    SD+W+ G+ L+ L     PF  +    +L       FQ P     S   +
Sbjct: 295 SYHGSP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQ--NISLEAE 348

Query: 273 KLITYMLMEQPSQR 286
            LI+ +L+  P +R
Sbjct: 349 DLISRILVVDPEKR 362

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 99/199 (49%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQ-ERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKI 162
           +V++ +EYC    L D +   LQ +R+  +E + + SQ+   +   H+L+   +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDL--YRG 220
           EN+LL   G  K+ DFG            + +  V  + +  TT  Y APE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFT---------RECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRL-----KKLI 275
             I    DIW+LGV LY +   + PF+++ EA            P+Y+ +      + L+
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEAKTKWKIIN--EEPEYNSKFMTAEGEDLV 269

Query: 276 TYMLMEQPSQRPNSYQVLE 294
             +L +  + RP+  ++L+
Sbjct: 270 RKLLQKDSNLRPSVREILQ 288

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 135/302 (44%), Gaps = 51/302 (16%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++ L+EY   G  +  M  +    L ED      +Q+   I  +H+    ++HRDIK EN
Sbjct: 241 LYFLLEYAPNGDFLSIM--KKYGSLNEDCACYYSAQIIDAIDFLHS--KGIVHRDIKPEN 296

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNT-----TAQYRAPEMI-DLY 218
           +LL    + K+ DFG+   I+ P  N  +     +D++  +     TA+Y +PE++ D Y
Sbjct: 297 ILLDKDFKVKLTDFGT-AKILEPKPNTTD----SYDLLSRSKSFVGTAEYVSPELLNDNY 351

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDR------LK 272
               +D + DIWA G  L+++     PF+   E    + TFQ     QY+        ++
Sbjct: 352 ----VDYRCDIWAFGCILFQMIAGKPPFKATNE----YLTFQKVMKVQYAFTAGFPLVVR 403

Query: 273 KLITYMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGA 332
            L+  +L++QP+QR    Q+               + +  + N   G +  +  P+    
Sbjct: 404 DLVKGILIKQPAQRLTIPQIKS-------------HHFFKDKNFKDGSIWDEPAPEIQPY 450

Query: 333 MMASPNMQPY-------VPNNNFVYNTPNAVSMNDIQMMNAINLKVNSTHNTGMIPPTMA 385
            +++ +MQP        VP    V +   A S +++      N   +S+   G +PPT +
Sbjct: 451 KVSARSMQPIPALSCGSVPQRRPVISKFYAKSTSNLSTEPGGN--GSSSSKLGKLPPTSS 508

Query: 386 TN 387
           +N
Sbjct: 509 SN 510

>SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {ON}
           similar to uniprot|P32491 Saccharomyces cerevisiae
           YPL140C MKK2 Mitogen-activated kinase kinase involved in
           protein kinase C signaling pathway that controls cell
           integrity upon activation by Bck1p phosphorylates
           downstream target Slt2p functionally redundant with
           Mkk1p
          Length = 486

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 116/253 (45%), Gaps = 42/253 (16%)

Query: 65  SLNTLRAEVDTMK-----LLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGG-LI 118
           ++ TL  + +T K     L  N      YI  +   FN +  S  +++ MEY  MGG  +
Sbjct: 228 TITTLNTDAETQKQIFRELQFNKNCKSEYIVRYYGMFNDDRNS-SIYIAMEY--MGGKSL 284

Query: 119 DFMN---TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKV 175
           D +     R   R+ E  +  I   V +G++ +H     ++HRDIK +N+LL   G+ K+
Sbjct: 285 DAIYKNLLRRGGRISEKVLGKIAESVLRGLSYLHERR--IIHRDIKPQNILLNEIGQVKL 342

Query: 176 CDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVF 235
           CDFG V G      N+   ++         T+ Y APE I   +G P    SD+W+LG+ 
Sbjct: 343 CDFG-VSG---EAVNSLATTFT-------GTSYYMAPERI---QGQPYSVTSDVWSLGLT 388

Query: 236 LYKLCYYTTPFEKNGEAA----------ILHATFQFPNYPQ----YSDRLKKLITYMLME 281
           L ++     PF  +  A           IL  T +  + P+    +S   K  I Y L +
Sbjct: 389 LLEVAQGHFPFNSDKMAINMPPIELLMLILTLTPELKDEPEQNISWSKSFKSFIGYCLKK 448

Query: 282 QPSQRPNSYQVLE 294
           +  +RP+  Q+L+
Sbjct: 449 ESRERPSPRQMLQ 461

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 89/203 (43%), Gaps = 25/203 (12%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           V+L MEYC  G     + TR  + + ED+     S+VT  +  +H L    ++RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLL--GFIYRDLKPEN 566

Query: 165 VLLTSKGEYKVCDFG---SVCGIIRPPSN-AQEVSYVQHDIMKN--------TTAQYRAP 212
           +LL   G   + DF          +P    A + S V   +            T +Y AP
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 213 EMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGE------AAILHATFQFPNYPQ 266
           E+I   RG       D W LG+ +Y++ +  TPF+  GE        IL     FP + +
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFK--GENTNETFCNILKNEVTFPEHHE 681

Query: 267 YSDRLKKLITYMLMEQPSQRPNS 289
            S   K LI  +L +  S+R  S
Sbjct: 682 ISRHCKDLIRKLLSKNESKRLGS 704

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 130/271 (47%), Gaps = 38/271 (14%)

Query: 30  SGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYI 89
           SGG    Y +        TN +VA +K++ +  +P    +  E+  MK  ++N ++V++I
Sbjct: 709 SGGVYTAYELG-------TNASVA-IKQMNLEKQPKKELIVNEILVMKGSKHN-NIVNFI 759

Query: 90  DSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMH 149
           DS+  +        +++++MEY + G L D +   +   L E +I  +  +  +G+  +H
Sbjct: 760 DSYLFR-------GDLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 809

Query: 150 ALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQY 209
           +    ++HRDIK +N+LL+  G+ K+ DFG  C  I       EV+  +  ++   T  +
Sbjct: 810 SKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQI------NEVNLKRTTMVG--TPYW 858

Query: 210 RAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF--EKNGEAAILHATFQFPNYPQ- 266
            APE++      P   K DIW+LG+ + ++     P+  E    A  L AT   P     
Sbjct: 859 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDP 915

Query: 267 --YSDRLKKLITYMLMEQPSQRPNSYQVLEE 295
              S ++   + + LM  P  R  +  +LE+
Sbjct: 916 GNLSHKMAMFLNWCLMVDPEDRGTAADLLED 946

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 117/258 (45%), Gaps = 39/258 (15%)

Query: 105 VFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIEN 164
           ++ L+EYC  G  +  M  +    L E       +QV   I  +H     ++HRDIK EN
Sbjct: 253 LYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHT--NGIIHRDIKPEN 308

Query: 165 VLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI-DLYRGLPI 223
           +LL  + + K+ DFG+   +    +N  ++       +   TA+Y APE++ D +    +
Sbjct: 309 ILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTAEYVAPELLNDSF----V 362

Query: 224 DEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDR------LKKLITY 277
           D + D+WA G  LY++     PF+   E    + TFQ     QY+        ++ L+  
Sbjct: 363 DYRCDVWAFGCILYQMIAGKPPFKATNE----YLTFQKVMKVQYAFTAGFPLIIRDLVKK 418

Query: 278 MLMEQPSQRPNSYQVLEEVSSMQNVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASP 337
           +L++  +QRP+  Q+ +             + +    N   G +     P+ +G  +++ 
Sbjct: 419 ILVKDLNQRPSISQIEK-------------HHFFREKNFQNGSVWSDPVPEISGFKISAK 465

Query: 338 NMQPYVP----NNNFVYN 351
           +MQP +P     NN  YN
Sbjct: 466 SMQP-IPELNKRNNVTYN 482

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 94/203 (46%), Gaps = 28/203 (13%)

Query: 101 GSY----EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
           GSY     +++LMEYC  G L   +      ++ E  I  IM ++   +  +H  +  ++
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  NVL+T++G  K+CDFG    + +     Q ++          T  + APE+I 
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI- 191

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP------QYSDR 270
              G+  D K DIW+LG+  Y++     P+      A+        + P       YS  
Sbjct: 192 -MEGVYYDTKVDIWSLGITTYEIATGNPPYCD--VEALRAMQLIIKSKPPRLEGRSYSSS 248

Query: 271 LKKLITYMLMEQPSQRPNSYQVL 293
           LK+ I   L E P +R ++  +L
Sbjct: 249 LKEFIALCLDEDPKERLSADDLL 271

>Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C
           (REAL)
          Length = 511

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 108/232 (46%), Gaps = 37/232 (15%)

Query: 81  NNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGL---IDFMNT-RLQERLREDEILN 136
           N +   +YI  +   F  +E S  +++ MEY  MGG      + N  R   R+ E  I  
Sbjct: 270 NKSFKSNYIVQYYGMFT-DEQSSSIYIAMEY--MGGRSLEATYKNLLRRGGRISERVIGK 326

Query: 137 IMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSY 196
           I   V +G++ +H     ++HRDIK +N+LL  KGE K+CDFG V G      N+  +++
Sbjct: 327 IAESVLRGLSYLH--ERKIIHRDIKPQNILLNEKGEVKLCDFG-VSG---EAVNSLAMTF 380

Query: 197 VQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNG------ 250
                    T+ Y APE I   +G P     D+W+LG+ L ++     PF+         
Sbjct: 381 T-------GTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAGGKFPFKSEKITQNVA 430

Query: 251 --EAAILHATF--QFPNYPQ----YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
             E   +  TF     + P+    +S   K  I Y L +  S+RP+  Q+L+
Sbjct: 431 PIELLTMILTFSPHLKDEPELDICWSKTFKSFIEYCLKKDASERPSPRQMLK 482

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 121/279 (43%), Gaps = 41/279 (14%)

Query: 23  QVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVI----VPDKPSLNTLRAEVDTMKL 78
           ++ + L  G F ++Y V+  P      + + C  +V+    + +       + E+D    
Sbjct: 119 EIGRKLGKGKFGKVYCVRHKP------SGLICALKVMNKMEIVNFNVQKQFKREIDIQYH 172

Query: 79  LRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIM 138
           L +      Y   H +K         V+L+MEY   G L   +  +    + +    N +
Sbjct: 173 LNHKNLTKLYAFFHDSK--------NVYLVMEYLIGGELYKLL--KKNGPMNDITASNYV 222

Query: 139 SQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQ 198
            Q+T  +  MH     ++HRD+K EN+L+    + K+ DFG     I  P+N +  +   
Sbjct: 223 YQMTDALNYMHK--RKIIHRDLKPENILIGFNNQIKLTDFGWS---IYNPNNQKRKTLC- 276

Query: 199 HDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGE----AAI 254
                  T  Y +PE+I        DE  D+WALG+  Y+L     PFE++ +      I
Sbjct: 277 ------GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRI 327

Query: 255 LHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVL 293
             +  +FP  P  S   + LIT +L   PS+R N  QV+
Sbjct: 328 AKSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 86/184 (46%), Gaps = 22/184 (11%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +   L+  + E E   I  QV  GI  +H     ++HRDIK ENV++ SKG  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y APE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQV 292
            G+ LY + +   PF    E  I+  T +F    + S+    LI  +L +   +RP    +
Sbjct: 1172 GILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 293  LEEV 296
             ++V
Sbjct: 1230 YDDV 1233

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 82/182 (45%), Gaps = 22/182 (12%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +    +  + E E   I  Q+  GI+ +H     ++HRDIK ENV++ +KG  K
Sbjct: 1094 GCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVK 1151

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y +PE++  + Y G P     DIWAL
Sbjct: 1152 LIDFGSAAYVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWAL 1196

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQV 292
            G+ LY + +   PF    E  IL    +FP     S     LI  +L     +RP+   +
Sbjct: 1197 GILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDI 1254

Query: 293  LE 294
             E
Sbjct: 1255 SE 1256

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 82/176 (46%), Gaps = 22/176 (12%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +   ++  + E E + I  Q+  GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P           D+   T   Y APE++  + Y G P     DIWA+
Sbjct: 1103 IVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1147

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPN 288
            GV LY + Y   PF    E  IL A  +  +  + SD    LI  +L    S+RP+
Sbjct: 1148 GVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPS 1201

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 98/204 (48%), Gaps = 28/204 (13%)

Query: 101 GSY----EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLL 156
           GSY     ++++MEYC  G L   +      ++ E  I  IM ++   +  +H  +  ++
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKVIHKDN--VI 134

Query: 157 HRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMID 216
           HRDIK  NVL+T++G+ K+CDFG    + +     Q ++          T  + APE+I 
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI- 184

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP------QYSDR 270
              G+  D K DIW+LG+  Y++     P+      A+        + P       Y+ +
Sbjct: 185 -MEGVYYDTKVDIWSLGITAYEIATGNPPYCD--VEALRAMQLIIKSKPPRLEERNYTPQ 241

Query: 271 LKKLITYMLMEQPSQRPNSYQVLE 294
           LK+ I   L E P +R ++ ++L+
Sbjct: 242 LKEFIALCLDEDPQERLSAEELLK 265

>Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047W
           (REAL)
          Length = 895

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 129/290 (44%), Gaps = 35/290 (12%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVD 74
           + VG    + V+ L  G   +++ V+    +K TN  V  LK +   +    N ++  + 
Sbjct: 491 IMVGPQSFEKVRLLGQGDVGKVFLVR----EKKTN-RVYALKVLSKDEMIKRNKIKRVLT 545

Query: 75  TMKLLRNNAH--VVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLRED 132
             ++L  + H  +V+   S  ++       Y ++L MEYC  G     + TR  + + ED
Sbjct: 546 EQEILATSNHPFIVTLYHSFQSE------DY-LYLCMEYCMGGEFFRALQTRKTKCICED 598

Query: 133 EILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF-------GSVCGII 185
           +     S+VT  +  +H L    ++RD+K EN+LL   G   + DF        S   ++
Sbjct: 599 DARFYASEVTAALEYLHLL--GFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDSKVPVV 656

Query: 186 RPPSNAQEV-SYVQHDIMKNT----TAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           +  + +  V + +  D  +      T +Y APE+I   RG       D W LG+ +Y++ 
Sbjct: 657 KGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILVYEML 713

Query: 241 YYTTPFEKNGE----AAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQR 286
           +  TPF+ +        IL     FPN  + S   K LI  +L +  S+R
Sbjct: 714 FGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIRKLLTKNESKR 763

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 128/279 (45%), Gaps = 36/279 (12%)

Query: 23  QVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPS-LNTLRAEVDTMKLLRN 81
           ++++ +  G F  +Y  +       T+  +  +K V + D    ++ L  E+  +  LR+
Sbjct: 21  EILQCIGRGNFGDVYKAR-----DLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS 75

Query: 82  NAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQV 141
                 YI ++   F  +     ++++MEYC  G   + +    + ++ E++   I+S+V
Sbjct: 76  -----PYITNYKTAFLVD---VSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEV 127

Query: 142 TQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDI 201
             G+  +H+     +HRDIK  N+LLT  G  K+ DFG          + Q +   + D 
Sbjct: 128 LIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG---------VSGQMMVTRKRDT 176

Query: 202 MKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQF 261
              T   + APE+ID  +    +E +DIW+LG+ + +L     P +K      L A    
Sbjct: 177 FVGTPF-WMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMA---I 231

Query: 262 PNY------PQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
           P         ++S   +  +   L++ PSQRP + ++L+
Sbjct: 232 PKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 96/212 (45%), Gaps = 55/212 (25%)

Query: 104 EVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIE 163
           +V++ +EYC    L + +  RL  R+  DE   + +Q++  +   H+L+   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLE 157

Query: 164 NVLLTSKGEYKVCDFG------------SVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRA 211
           N+LL   G  K+ DFG            ++CG                      T  Y A
Sbjct: 158 NILLDKVGNAKLTDFGFTRECASKNILETICG----------------------TTVYMA 195

Query: 212 PEMI--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFE----KNGEAAILHATFQFPNY- 264
           PE+I  + Y G  I    D+W+LGV LY L     PF+    KN E  I++    F +  
Sbjct: 196 PELIKRERYDGFKI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTL 251

Query: 265 --PQYSDRLKKLITYMLMEQPSQRPNSYQVLE 294
             P   D L KL    L + P  RP+  +VLE
Sbjct: 252 LGPDAVDLLSKL----LAKDPIDRPSMKEVLE 279

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 126/285 (44%), Gaps = 53/285 (18%)

Query: 31   GGFAQIY-TVQISPPDKFTNTNVACLKRVIVPD--------KPSLNTLRAEVDTMKLLRN 81
            G F  +Y ++ I      T   +  +K+V VP         K  +  L++EV T+K L +
Sbjct: 1160 GSFGAVYLSLNI------TTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-D 1212

Query: 82   NAHVVSYIDSHAAKFNPNEGS-YEVFLLMEYCDMGGLIDFMNTRLQERLREDEILNIMSQ 140
            + ++V Y+ S         G+ Y +FL  EY   G +   +  RL  R  E  I ++ +Q
Sbjct: 1213 HLNIVQYLGSEI------RGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQ 1262

Query: 141  VTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPPSNAQEVSYVQHD 200
            V  G+  +H+    +LHRD+K +N+LL   G  K+ DF    GI +   N     Y   D
Sbjct: 1263 VLSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSNSD 1312

Query: 201  IMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKNGEAAILHATFQ 260
            +    T  + APEM+D  +G     K DIW+LG  + ++     P+       ++ A FQ
Sbjct: 1313 MTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFQ 1367

Query: 261  F------PNYPQ-----YSDRLKKLITYMLMEQPSQRPNSYQVLE 294
                   P  P       S + K  ++      P +RP +  +LE
Sbjct: 1368 IGKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 86/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +    +  + E E   I  QV  GI  +H     ++HRD+K ENV++ +KG  K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P +     +V        T  Y APE++  + Y G P     DIWA+
Sbjct: 1257 LIDFGSAAYVNSGPFDV----FV-------GTIDYAAPEVLSGEPYLGKP----QDIWAI 1301

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQV 292
            G+ LY + +   PF    E  IL A  +  N    S     LI  +L + P++RP   ++
Sbjct: 1302 GILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEI 1359

Query: 293  LEE 295
            + +
Sbjct: 1360 VND 1362

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 82/175 (46%), Gaps = 22/175 (12%)

Query: 116  GLIDFMN-TRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYK 174
            G ID  +    +  + E E   I  QV  GI  +H     ++HRDIK ENV++ SKG  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 175  VCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMI--DLYRGLPIDEKSDIWAL 232
            + DFGS   +   P +     +V        T  Y APE++  + Y G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 233  GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRP 287
            G+ LY + +   PF    E  IL    +F N  + S+   +LI  +L  +   RP
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRP 1343

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 121/251 (48%), Gaps = 37/251 (14%)

Query: 62  DKPSLNTLRAEV-------DTMKLLRNNAHVVS-----YIDSHAAKFNPNEGSYEVFLLM 109
           DK + NT+  +V       D + LL    + ++     YI ++ + F  +     ++++M
Sbjct: 53  DKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAELHSPYITNYFSTFVED---VSMWIVM 109

Query: 110 EYCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTS 169
           EYC  G   D +    +  L E+++  I  ++ +G+  +H+     +HRDIK  N+LLT 
Sbjct: 110 EYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAANILLTD 167

Query: 170 KGEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDI 229
            G+ K+ DFG          + Q ++  + D    T   + APE+I        +EK+DI
Sbjct: 168 DGKVKLGDFG---------VSGQMMATRRRDTFVGTPF-WMAPEVIARSE-QGYNEKADI 216

Query: 230 WALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNY------PQYSDRLKKLITYMLMEQP 283
           W+LG+ +++L     P  ++    +L      P+        +YS  +++ ++  L + P
Sbjct: 217 WSLGITVFELLKGQPPLSQHDPMKVL---MSIPSRRPPKLEDRYSHAIREFVSLCLNKDP 273

Query: 284 SQRPNSYQVLE 294
           ++RP + ++L+
Sbjct: 274 AKRPTASELLK 284

>Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047W
           (REAL)
          Length = 897

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 129/290 (44%), Gaps = 35/290 (12%)

Query: 15  LTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNTLRAEVD 74
           + VG    + ++ L  G   +++ V+    +K TN  V  LK +   +    N ++  + 
Sbjct: 493 IMVGPQSFEKIRLLGQGDVGKVFLVR----EKKTN-RVYALKVLSKEEMIKRNKIKRVLT 547

Query: 75  TMKLLRNNAH--VVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQERLRED 132
             ++L  + H  +V+   S  ++       Y ++L MEYC  G     + TR  + + ED
Sbjct: 548 EQEILATSNHPFIVTLYHSFQSE------DY-LYLCMEYCMGGEFFRALQTRETKCICED 600

Query: 133 EILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF-------GSVCGII 185
           +     S+VT  +  +H L    ++RD+K EN+LL   G   + DF        S   ++
Sbjct: 601 DARFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDLSIQAKDSKIPVV 658

Query: 186 RPPSNAQEV-SYVQHDIMKNT----TAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240
           +  + +  V + +  D  +      T +Y APE+I   RG       D W LG+ +Y++ 
Sbjct: 659 KGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEML 715

Query: 241 YYTTPFEKNGE----AAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQR 286
           +  TPF+ +        IL     FPN  + S   K LI  +L +  S+R
Sbjct: 716 FGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNESKR 765

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,543,050
Number of extensions: 3532038
Number of successful extensions: 18571
Number of sequences better than 10.0: 2363
Number of HSP's gapped: 17802
Number of HSP's successfully gapped: 2494
Length of query: 661
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 545
Effective length of database: 40,180,143
Effective search space: 21898177935
Effective search space used: 21898177935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)