Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G038002.285ON72672638030.0
NDAI0G006502.285ON68967830920.0
CAGL0J03454g2.285ON69368929560.0
ZYRO0A01870g2.285ON70770829530.0
YNL021W (HDA1)2.285ON70667229310.0
Skud_14.3082.285ON70670129220.0
Suva_14.3262.285ON70671029200.0
Smik_14.3102.285ON70669429190.0
SAKL0E07700g2.285ON71271428870.0
TDEL0G021602.285ON71470228850.0
KNAG0H020102.285ON69368628730.0
KLTH0G10340g2.285ON70867228280.0
Kwal_27.115372.285ON70867028140.0
KAFR0H033202.285ON70270827550.0
Ecym_33242.285ON70669727460.0
KLLA0E08383g2.285ON70469326990.0
ADL216C2.285ON70570126850.0
Kpol_1039.322.285ON65965626700.0
TPHA0C033902.285ON70169125660.0
TBLA0B069502.285ON79548719600.0
Kpol_1003.372.285ON57830713441e-178
NDAI0B027108.153ON4533543731e-37
AFR172C8.153ON4493333676e-37
TPHA0H003208.153ON4503353651e-36
SAKL0H25124g8.153ON4483393651e-36
KLTH0E06446g8.153ON4493323651e-36
KAFR0C029208.153ON4533343642e-36
Skud_7.798.153ON4523293632e-36
TDEL0B045808.153ON4463323632e-36
YGL194C (HOS2)8.153ON4523303605e-36
CAGL0A03322g8.153ON4503393597e-36
NCAS0B054808.153ON4513323598e-36
Smik_7.798.153ON4523303599e-36
Kpol_246.58.153ON4533323581e-35
TBLA0D021408.153ON4563323572e-35
KNAG0G013508.153ON4513353552e-35
Ecym_23468.153ON4853363563e-35
KLLA0F09119g8.153ON4523323526e-35
Suva_7.718.153ON4523293519e-35
ZYRO0G19316g8.153ON4483353492e-34
Kwal_55.207908.153ON4493323482e-34
Kpol_1038.113.8ON4333503454e-34
KLTH0F19668g3.8ON4323413446e-34
Kwal_55.221423.8ON4323413411e-33
ZYRO0C03498g3.8ON4333503411e-33
AGR395W3.8ON4333263384e-33
KLLA0E01981g3.8ON4323263374e-33
NCAS0C043203.8ON4343263374e-33
TBLA0I005603.8ON4333263374e-33
Ecym_20103.8ON4333263374e-33
Suva_14.113.8ON4333263374e-33
NDAI0G037403.8ON4333263357e-33
SAKL0C13706g3.8ON4333263357e-33
Skud_14.113.8ON4333263341e-32
KNAG0A011603.8ON4333263341e-32
TPHA0A003003.8ON4333263341e-32
CAGL0B01441g3.8ON4333503332e-32
KAFR0A086303.8ON4333263313e-32
Smik_14.23.8ON4333263296e-32
YNL330C (RPD3)3.8ON4333263286e-32
TDEL0A002703.8ON4333263252e-31
TDEL0C050403.362ON4542822133e-17
NDAI0A051203.362ON5082642092e-16
Suva_16.3963.362ON4771831966e-15
TBLA0B023903.362ON5791821966e-15
KLTH0F10582g3.362ON4742291931e-14
NCAS0A111803.362ON4902111931e-14
Skud_16.3533.362ON4711831876e-14
KAFR0H008903.362ON4742161877e-14
Kpol_376.153.362ON5182101861e-13
Kwal_23.37243.362ON4732151851e-13
SAKL0B07854g3.362ON4891831851e-13
CAGL0D01430g3.362ON4452711832e-13
Smik_16.3093.362ON4701831832e-13
YPR068C (HOS1)3.362ON4701831813e-13
ZYRO0C16390g3.362ON4361851804e-13
KLLA0B09394g3.362ON4412141752e-12
ADL339W3.362ON4372071752e-12
Ecym_82908.607ON7093361753e-12
KNAG0H006303.362ON4561881662e-11
Ecym_34653.362ON4451831601e-10
TBLA0E040808.607ON6942921602e-10
ADL265W8.607ON6943051592e-10
SAKL0H08338g8.607ON6903371583e-10
TPHA0A011208.607ON6982521557e-10
TDEL0A055208.607ON6742871549e-10
KLTH0D09592g8.607ON7053021522e-09
KAFR0H027908.607ON7171061493e-09
Kpol_479.68.607ON6882931485e-09
KLLA0F00858g8.607ON715651485e-09
YPL116W (HOS3)8.607ON6973161467e-09
TPHA0M015903.362ON4941511458e-09
ZYRO0F10780g8.607ON6682911451e-08
KNAG0J013008.607ON6773111432e-08
Suva_16.1948.607ON6991341432e-08
Smik_6.3158.607ON6971341422e-08
Kwal_26.85058.607ON708581388e-08
NDAI0E024808.607ON684981379e-08
NCAS0C017608.607ON7001061361e-07
Skud_16.1648.607ON697981342e-07
CAGL0J06974g8.607ON678981324e-07
TDEL0A069906.285ON10458684.0
CAGL0I01210g5.419ON55160708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G03800
         (726 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1469   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1195   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1143   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1142   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1133   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1130   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1129   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1129   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1116   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1115   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1111   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1093   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1088   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1065   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1062   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1044   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1038   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1033   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   993   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   759   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   522   e-178
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    148   1e-37
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   145   6e-37
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   145   1e-36
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   145   1e-36
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   145   1e-36
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   144   2e-36
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   144   2e-36
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   144   2e-36
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   143   5e-36
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   142   7e-36
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   142   8e-36
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   142   9e-36
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   142   1e-35
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   142   2e-35
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   141   2e-35
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   141   3e-35
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   140   6e-35
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   139   9e-35
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   139   2e-34
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   138   2e-34
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   137   4e-34
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   137   6e-34
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   135   1e-33
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   135   1e-33
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   134   4e-33
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   134   4e-33
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      134   4e-33
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   134   4e-33
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   134   4e-33
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   134   4e-33
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   133   7e-33
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   133   7e-33
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   133   1e-32
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   133   1e-32
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   133   1e-32
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   132   2e-32
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   132   3e-32
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   131   6e-32
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   130   6e-32
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   129   2e-31
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    87   3e-17
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    85   2e-16
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    80   6e-15
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    80   6e-15
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    79   1e-14
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    79   1e-14
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    77   6e-14
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    77   7e-14
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    76   1e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    76   1e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    76   1e-13
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    75   2e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    75   2e-13
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    74   3e-13
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    74   4e-13
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    72   2e-12
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    72   2e-12
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    72   3e-12
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    69   2e-11
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    66   1e-10
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    66   2e-10
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    66   2e-10
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    65   3e-10
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    64   7e-10
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    64   9e-10
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    63   2e-09
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    62   3e-09
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    62   5e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    62   5e-09
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    61   7e-09
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    60   8e-09
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    60   1e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    60   2e-08
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    60   2e-08
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    59   2e-08
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    58   8e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    57   9e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    57   1e-07
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    56   2e-07
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    55   4e-07
TDEL0A06990 Chr1 (1223513..1223827) [315 bp, 104 aa] {ON} Anc_6....    31   4.0  
CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly ...    32   8.3  

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1469 bits (3803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/726 (97%), Positives = 710/726 (97%)

Query: 1   MVKHLPLTLNHRWKTKESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSER 60
           MVKHLPLTLNHRWKTKESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSER
Sbjct: 1   MVKHLPLTLNHRWKTKESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSER 60

Query: 61  PVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 120
           PVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN
Sbjct: 61  PVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 120

Query: 121 GLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK 180
           GLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK
Sbjct: 121 GLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK 180

Query: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSN 240
           GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSN
Sbjct: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSN 240

Query: 241 VAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTI 300
           VAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTI
Sbjct: 241 VAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTI 300

Query: 301 NGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAA 360
           NGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAA
Sbjct: 301 NGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAA 360

Query: 361 DGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXX 420
           DGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIG    
Sbjct: 361 DGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPD 420

Query: 421 XXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQA 480
                       AIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQA
Sbjct: 421 ELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQA 480

Query: 481 IREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQ 540
           IREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQ
Sbjct: 481 IREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQ 540

Query: 541 GTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNY 600
           GTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNY
Sbjct: 541 GTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNY 600

Query: 601 LKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSD 660
           LKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSD
Sbjct: 601 LKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSD 660

Query: 661 WYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFE 720
           WYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFE
Sbjct: 661 WYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFE 720

Query: 721 EWSDSE 726
           EWSDSE
Sbjct: 721 EWSDSE 726

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1195 bits (3092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/678 (81%), Positives = 622/678 (91%), Gaps = 1/678 (0%)

Query: 49  LKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 108
           +KK+KI D   R +IVPPRDA++ YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR
Sbjct: 13  IKKRKI-DPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 71

Query: 109 RIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTST 168
           RIYRIYKILAENGLIKDPTLSGI+DIGDLMLKIPVR+AT EEILEVHSKEH DFIE TS 
Sbjct: 72  RIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSK 131

Query: 169 MNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAE 228
           MNRE+LLKATE GDSVYFN+DS+ASAKLPVGG+IEACKAVVEGRVKN+LAVVRPPGHHAE
Sbjct: 132 MNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAE 191

Query: 229 PQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLH 288
           P+AAGGFCLFSNVAIAAKNILKNYPESVR+I+ILDWDIHHGNGTQKAFYDDDR+LY+SLH
Sbjct: 192 PEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLH 251

Query: 289 RFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQP 348
           RF++GKYYPGTI+G+YDQTGEGKGEGFNCNITWPVGGVGDAEY+WAFEQ+VMPM REFQP
Sbjct: 252 RFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQP 311

Query: 349 DLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSAL 408
           DLVIIS+GFDAADGD+IGQCHVTPSCYGHMTHMLKSLA+GN+ VVLEGGYNLD+IA SAL
Sbjct: 312 DLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISAL 371

Query: 409 SVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINE 468
           SVAKILIG                 IE+IDKV+R+QSKYWKCFK ++GNAGC+F+++IN 
Sbjct: 372 SVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINN 431

Query: 469 SLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHD 528
           S+ +KNFPLQ AIR+QQ+  LS++F F+ LP+ K ELP+DT+LCS N+Y+S T+IIC HD
Sbjct: 432 SIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHD 491

Query: 529 TPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVT 588
           TPEIWAKRD IQGTIDPSSSIIVDS+LD IKWA E+KYGVIDINIPQNL EQENY +I+T
Sbjct: 492 TPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIIT 551

Query: 589 SQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLR 648
           +QEVL  +WDNYLKYFPNV K+AF+GIGDAYSGIVHLLGHRDTRSVVK+VINF+ QKQL+
Sbjct: 552 AQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLK 611

Query: 649 ALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERF 708
            LVPLVDESL +WYFKNSLVFS+K+H YWGDKENKKPRKKYGR+LRC+TDGI+NI+EERF
Sbjct: 612 PLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERF 671

Query: 709 EEATDFILDSFEEWSDSE 726
           EEATDFILDSFEEWSDSE
Sbjct: 672 EEATDFILDSFEEWSDSE 689

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1143 bits (2956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/689 (76%), Positives = 607/689 (88%), Gaps = 5/689 (0%)

Query: 43  VKEEPELKKQKITDVS-----ERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYF 97
           +K+EP   K+K+ D       +RPVIVP R A++ YTPLKTG+CYDVRMRYHAKIFTSYF
Sbjct: 5   LKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYF 64

Query: 98  EYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSK 157
           EYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+ DIGDLMLKIP+R AT EEILEVHSK
Sbjct: 65  EYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSK 124

Query: 158 EHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSL 217
           EH +FIEKT  MNREELLK TEKGDSVYFNNDS+A+++LP GG+IEACKAVVEGRVKNSL
Sbjct: 125 EHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSL 184

Query: 218 AVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFY 277
           AVVRPPGHHAEP+AAGGFCLFSNVA+AAKNILKNYPESVRRI+ILDWD+HHGNGTQKAFY
Sbjct: 185 AVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFY 244

Query: 278 DDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQ 337
           DDDRVLYISLHRFELGKYYPGTI GQYDQ GEGKG+GFNCNITWPVGGVGDAEY+WAFEQ
Sbjct: 245 DDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQ 304

Query: 338 VVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGG 397
           VVMPM REFQPDLVIISSGFDAADGD+IGQCHVTPSCYGHMTHMLKSLA+GNLCVVLEGG
Sbjct: 305 VVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGG 364

Query: 398 YNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRYGN 457
           YNLDAIA SALSVAKILIG                A+EIIDKVI LQSKYWKCF +RYGN
Sbjct: 365 YNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGN 424

Query: 458 AGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVY 517
            G   ++ +   ++SK+FPLQ AIR++Q + LS+DF F TLPLL  E+P+D+V+CSPN++
Sbjct: 425 LGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLF 484

Query: 518 QSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNL 577
              T+++  HDTPEIWAKR+VI GTIDPS+S++VDS  +FIKW  E+KYG++DINIPQ+L
Sbjct: 485 NETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSL 544

Query: 578 FEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKS 637
           FEQENY+A++TSQE+L YIWDNYLK+FP++ KVAFIGIGDA +GIVHLLGHRDTRSVVKS
Sbjct: 545 FEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKS 604

Query: 638 VINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCET 697
           V++FI +K L+ LVPLV+ESL DWYFKNSLVF+D SH+ WGD EN+KPRKK+GR+LRC+ 
Sbjct: 605 VVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDA 664

Query: 698 DGINNIVEERFEEATDFILDSFEEWSDSE 726
           +G+NNI+EER EE+TDFILDSFEEWSDSE
Sbjct: 665 EGMNNIIEERLEESTDFILDSFEEWSDSE 693

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/708 (75%), Positives = 617/708 (87%), Gaps = 5/708 (0%)

Query: 23  LQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVS----ERPVIVPPRDAELSYTPLKT 78
           + T+    Q D   KR +      P  KK  +  VS    +R +IVP  + ++ YTPLKT
Sbjct: 1   MNTDNPVKQEDEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKT 60

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG +DIG+LM
Sbjct: 61  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELM 120

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPV 198
           LKIPVR+AT EE+L+VH+KEH +FIEKTS MNREELLK TE GDSVYFN+DS+++AKLP 
Sbjct: 121 LKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPC 180

Query: 199 GGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRR 258
           GG+IEACKAVVEGRVKN+LAV+RPPGHHAEP+ AGGFCLFSNVA+AA+NILKNYPESVRR
Sbjct: 181 GGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRR 240

Query: 259 IMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCN 318
           I+ILDWDIHHGNGTQKAFY+DDRVLYISLHRFELGKYYPGTI+GQYDQTGEGKGEGFNCN
Sbjct: 241 ILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCN 300

Query: 319 ITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHM 378
           ITWPVGGVGDAEY+ AFEQ+VMPMARE++PDLVIISSGFDAADGD+IGQCHV+PSCYGHM
Sbjct: 301 ITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHM 360

Query: 379 THMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIID 438
           THMLKSLA+GNLCV LEGGYNLDAIA SALSVAKILIG                AIE+ID
Sbjct: 361 THMLKSLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMID 420

Query: 439 KVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATL 498
           KVI +QSKYWKCF RR GN+GCNFK+ + ESLI+KNFPLQ+AIR++Q + L +++ F TL
Sbjct: 421 KVIHVQSKYWKCF-RRLGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTL 479

Query: 499 PLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFI 558
           P+ K ELP+DTVLCSP+V+Q  TVII  HDTPEIWAKRDVI G IDPS+SI VDS LDFI
Sbjct: 480 PVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFI 539

Query: 559 KWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDA 618
           KW+  +KYGVID+NIPQ+LFEQ+NYSA++TSQEVL Y+WDN++KYFP++ KVAF+G+GDA
Sbjct: 540 KWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDA 599

Query: 619 YSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWG 678
           YSGIVHLLGHRDTRSVVK+VINF+ +KQL+ LVPLVDESL DWYFKNSLVFSD+++  W 
Sbjct: 600 YSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWV 659

Query: 679 DKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           D ENKKPR+K+GR+LRCE+DGINN +EERF+EATDFILDSFEEWSDSE
Sbjct: 660 DNENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1133 bits (2931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/672 (77%), Positives = 598/672 (88%)

Query: 55  TDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIY 114
           T  S+R VIVP    ++ Y+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIY
Sbjct: 35  TSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIY 94

Query: 115 KILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREEL 174
           KILAENGLI DPTLSG++D+GDLMLKIPVR AT EEILEVH+KEH +FIE T  M+REEL
Sbjct: 95  KILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREEL 154

Query: 175 LKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGG 234
           LK TEKGDSVYFNNDS+ASA+LP GG+IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGG
Sbjct: 155 LKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGG 214

Query: 235 FCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGK 294
           FCLFSNVA+AAKNILKNYPESVRRIMILDWDIHHGNGTQK+FY DD+VLY+SLHRFE+GK
Sbjct: 215 FCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGK 274

Query: 295 YYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIIS 354
           YYPGTI GQYDQTGEGKGEGFNCNITWPVGGVGDAEY+WAFEQVVMPM REF+PDLVIIS
Sbjct: 275 YYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIIS 334

Query: 355 SGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKIL 414
           SGFDAADGD+IGQCHVTPSCYGHMTHMLKSLA+GNLCVVLEGGYNLDAIARSALSVAK+L
Sbjct: 335 SGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVL 394

Query: 415 IGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKN 474
           IG                 IE+IDKVIRLQSKYW CF+RR+ N+GCNF + IN+S+ISKN
Sbjct: 395 IGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKN 454

Query: 475 FPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWA 534
           FPLQ+AIR+QQ + LS +F F TLPL+  +LP +TVLC+PN+ +S T+II  HDT +IWA
Sbjct: 455 FPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWA 514

Query: 535 KRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLT 594
           KR+VI GTID SSS+I+D++LDFIKW  ++KYG+ID+NIP  LFE +NYS ++TSQEVL 
Sbjct: 515 KRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLI 574

Query: 595 YIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLV 654
           Y+WDNY+KYFP+V K+AFIGIGD+YSGIVHLLGHRDTR+V K+VINF+  KQL+ LVPLV
Sbjct: 575 YLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLV 634

Query: 655 DESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDF 714
           DE+LS+WYFKNSL+FS+ SH  W + E++KPRKK+GR+LRC+TDG+NNI+EERFEEATDF
Sbjct: 635 DETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDF 694

Query: 715 ILDSFEEWSDSE 726
           ILDSFEEWSD E
Sbjct: 695 ILDSFEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/701 (74%), Positives = 603/701 (86%), Gaps = 2/701 (0%)

Query: 26  NKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVR 85
           N+     D   KR +   KE+        T  ++R VIVP    ++ Y+PLKTGLCYDVR
Sbjct: 8   NEVLENPDHDLKRTLENTKEDQ--NSLSTTSRNKRQVIVPACTPKIHYSPLKTGLCYDVR 65

Query: 86  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRD 145
           MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG++DIGDLMLKIPVR 
Sbjct: 66  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPVRA 125

Query: 146 ATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEAC 205
           AT EEILEVH+KEH +FIE T  M+RE+LLK TEKGDSVYFNNDS+ASA+LP GG+IEAC
Sbjct: 126 ATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEAC 185

Query: 206 KAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWD 265
           KAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVA+AAKNILKNYPESVRRIMILDWD
Sbjct: 186 KAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWD 245

Query: 266 IHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGG 325
           IHHGNGTQK+FY DD+VLY+SLHRFE+GKYYPGTI GQYDQTGEGKGEGFNCNITWPVGG
Sbjct: 246 IHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGG 305

Query: 326 VGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSL 385
           VGDAEY+WAFEQVVMPM REF+PDLVIISSGFDAADGD+IGQCHV+PSCYGHMTHMLKSL
Sbjct: 306 VGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSL 365

Query: 386 AKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQS 445
           A+GNLCVVLEGGYNLDAIARSALSVAK+LIG                 IE+IDKVIRLQS
Sbjct: 366 ARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRLQS 425

Query: 446 KYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPEL 505
           KYW CF+RR+ N+GCNF + IN+S+ISKNFPLQ+AIR+QQL  LS +F F TLPL+   L
Sbjct: 426 KYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINMGL 485

Query: 506 PKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKK 565
           P +T LC+PNV++S  +++  HDT ++WAKR+VI GTID SSS+I+D+ +DFIKW  ++K
Sbjct: 486 PDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRK 545

Query: 566 YGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHL 625
           YG+ID+NIP  LFE +NYS ++TSQEVL Y+WDNY+KYFPNV K+AFIGIGD++SGIVHL
Sbjct: 546 YGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHL 605

Query: 626 LGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKP 685
           LGHRDTR+V K+VINF+  KQL+ LVPLVDE+LS+WYFKNSL+FS+ SH  W + E++KP
Sbjct: 606 LGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKP 665

Query: 686 RKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           RKK+GR+LRC+TDG++N +EERFEEATDFILDSFEEWSD E
Sbjct: 666 RKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1129 bits (2920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/710 (74%), Positives = 608/710 (85%), Gaps = 5/710 (0%)

Query: 17  ESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPL 76
           +SATV    N+     D   K  +  +KEE        T  ++R VIVP    +L YTPL
Sbjct: 2   DSATV---KNEVLETPDQDLKHKLEGMKEEQ--NSLSTTSKNKRQVIVPACTPKLHYTPL 56

Query: 77  KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGD 136
           +TGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG++D+GD
Sbjct: 57  RTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGD 116

Query: 137 LMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKL 196
           LMLKIPVR AT EEILEVH+KEH +FIE T  M+RE+LLK TEKGDSVYFNNDS+ASA+L
Sbjct: 117 LMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARL 176

Query: 197 PVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESV 256
           P GG+IEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVA+AAKNILKNYPESV
Sbjct: 177 PCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESV 236

Query: 257 RRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFN 316
           RRIMILDWDIHHGNGTQK+FY DD+VLYISLHRFE+GKYYPGTI GQYDQTGEGKGEGFN
Sbjct: 237 RRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFN 296

Query: 317 CNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYG 376
           CNITWPVGGVGDAEY+WAFEQVVMPM REF+PDLVIISSGFDAADGD+IGQCHVTPSCYG
Sbjct: 297 CNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYG 356

Query: 377 HMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEI 436
           HMTHMLKSLA+GNLCVVLEGGYNLDAIA SALSVAK+LIG                 IE+
Sbjct: 357 HMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEM 416

Query: 437 IDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFA 496
           IDKV+RLQSKYW CF+RR+ N+GCNF + IN+S+ISKNFPLQ+AIR+QQL+ LS +F F 
Sbjct: 417 IDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFV 476

Query: 497 TLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLD 556
           TLPL+  ELP + VLC+PNV +S T+++  HDT ++WAKR+VI GTID SSS+++D+ LD
Sbjct: 477 TLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLD 536

Query: 557 FIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIG 616
           FIKW  ++KYG+ID+NIP  LFE +NYS ++TSQEVL Y+WDNY+KYFP V K+A+IGIG
Sbjct: 537 FIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIG 596

Query: 617 DAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTY 676
           D+YSGIVHLLGHRDTR+V K+VINF+  KQL+ LVPLVDE+L++WYFKNSLVF++ SH  
Sbjct: 597 DSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQC 656

Query: 677 WGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           W + E++KPRKK+GR+LRC+TDG++N VEERFEEATDFILDSFEEWSD E
Sbjct: 657 WKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/694 (75%), Positives = 602/694 (86%), Gaps = 2/694 (0%)

Query: 33  DTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKI 92
           D   KR +   KE+        T  ++R VIVP    ++ Y+PLKTGLCYDVRMRYHAKI
Sbjct: 15  DGNLKRRLEETKEDQ--NSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKI 72

Query: 93  FTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEIL 152
           FTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG++D+GDLMLKIPVR AT EEIL
Sbjct: 73  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEIL 132

Query: 153 EVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGR 212
           EVH+KEH +FIE T  M+RE+LLK TEKGDSVYFNNDS+ASA+LP GG+IEACKAVVEGR
Sbjct: 133 EVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGR 192

Query: 213 VKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGT 272
           VKNSLAVVRPPGHHAEPQAAGGFCLFSNVA+AAKNILKNYPESVRRIMILDWDIHHGNGT
Sbjct: 193 VKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGT 252

Query: 273 QKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYI 332
           QK+FY DD+VLY+SLHRFE+GKYYPGTI GQYDQ GEGKGEGFNCNITWPVGGVGDAEY+
Sbjct: 253 QKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYM 312

Query: 333 WAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCV 392
           WAFEQVVMPM REF+PDLVIISSGFDAADGD+IGQCHVTPSCYGHMTHMLKSLA+GNLCV
Sbjct: 313 WAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCV 372

Query: 393 VLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFK 452
           VLEGGYNLDAIARSALSVAK+LIG                 IE+IDKVIRLQSKYW CF+
Sbjct: 373 VLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFR 432

Query: 453 RRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLC 512
           RR+ N+GCNF + IN+S++SKNFPLQ+AIR+QQ + LS +F   TLPL+  +LP +TVLC
Sbjct: 433 RRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLC 492

Query: 513 SPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDIN 572
           +PNVY+S T+++  HDT +IWAKR+VI GTID SSS+I+D+ LDFIKW  ++KYG+ID+N
Sbjct: 493 TPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVN 552

Query: 573 IPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTR 632
           IP +LFE +NYS ++TSQEVL Y+WDNY+KYFP V K+AF+GIGD+YSGIVHLLGHRDTR
Sbjct: 553 IPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTR 612

Query: 633 SVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRL 692
           +V K+VINF+  KQL+ LVPLVDE+LS+WYFKNSL+FS+ SH  W + E++KPRKK+GR+
Sbjct: 613 AVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRV 672

Query: 693 LRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           LRC+TDG+NN +EERFEEATDFILDSFEEWSD E
Sbjct: 673 LRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/714 (72%), Positives = 610/714 (85%), Gaps = 5/714 (0%)

Query: 15  TKESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYT 74
           T+ +ATV    +    + + + KR +  +++E E +K+    +   PVIVP     + YT
Sbjct: 2   TESTATVTGNDSAVEVKMEDSLKRKVDTMEDEVESRKRSTGTL---PVIVPEVPPRIHYT 58

Query: 75  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDI 134
            LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSG+++I
Sbjct: 59  QLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEI 118

Query: 135 GDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASA 194
           G+LMLKIPVR+AT EEIL+VH+KEH  F+EKT  M RE+LLK TE GDSVYFNNDS  SA
Sbjct: 119 GELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSA 178

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPE 254
           KL  GG+IEACKAVVEGRVKN+LAV+RPPGHHAEP+ AGGFCLFSNVA+AA+NILKNYPE
Sbjct: 179 KLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPE 238

Query: 255 SVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEG 314
           SVRRIMILDWDIHHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT++G Y+QTGEGKGEG
Sbjct: 239 SVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEG 298

Query: 315 FNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSC 374
           FNCNI WP GG+GDAEY+WAF+QVVMPM REFQPDLVIISSGFDAADGD+IGQCHV+PSC
Sbjct: 299 FNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSC 358

Query: 375 YGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAI 434
           YGHMTHMLKSLA+GNLCVVLEGGYNLD+IA+SAL VAKILIG                AI
Sbjct: 359 YGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAI 418

Query: 435 EIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFK 494
           E I+ VIR QSKYW CFK  + N GCNFK+E+ ES ISKNFPLQQAIR++QL  LS+ F 
Sbjct: 419 ETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFG 478

Query: 495 FATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDST 554
           F TLPLL  E+P+DTV+CSPN+Y ++TV++C HDTPEIWA+R+ I GTIDPS+SIIVD+T
Sbjct: 479 FVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTT 538

Query: 555 LDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIG 614
           LD IKW+ ++KY VID+NIPQ+LFEQ+NYSA++TSQEVL YIWDNYLKYFP++ KVAFIG
Sbjct: 539 LDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIG 598

Query: 615 IGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSH 674
           +GDAYSGIVHLLGHRDTRSVVK+ ++F+  K L++LVPLVDESL +WYFKNSLVF+ K+H
Sbjct: 599 VGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNH 658

Query: 675 TYWG--DKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           + WG    ENKKPRK++GR+L+C+T G+NNIVEERF+EATDFILDSFEEWSDSE
Sbjct: 659 SCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1115 bits (2885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/702 (74%), Positives = 603/702 (85%), Gaps = 6/702 (0%)

Query: 31  QSDTTQ--KRNMTAVKEEPELKKQKIT----DVSERPVIVPPRDAELSYTPLKTGLCYDV 84
           ++DTT   KR M    +  + KK ++       + + VIVP     L YTPLKT LCYDV
Sbjct: 13  ENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDV 72

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           RMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSGI++IGDLMLKIPVR
Sbjct: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEA 204
           +AT+EEILEVHSKE+ +F+E++S M REELLK TEKGDSVYFNNDS+ SAKL  GG I+A
Sbjct: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDA 192

Query: 205 CKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDW 264
           CKAVVEGRVKN+LAVVRPPGHHAEP+A GGFCLFSNVA+AA+NILK YPESVRRI+ILDW
Sbjct: 193 CKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDW 252

Query: 265 DIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVG 324
           DIHHGNGTQKAFY+D RVLYISLHRFE+GKYYPGTING+YDQTGEGKGEGFNCNITWPVG
Sbjct: 253 DIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG 312

Query: 325 GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKS 384
           GVGDAEY+ AFEQ+VMPMAREFQPDLVIISSGFDAADGD+IGQCHVTPSCYG MTHMLKS
Sbjct: 313 GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKS 372

Query: 385 LAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQ 444
           LA+GNLCV LEGGYNLDAIA SALSVAK+LIG                AIE+ID VI  Q
Sbjct: 373 LARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQ 432

Query: 445 SKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPE 504
           SKYWKCF+R++GNAGCNF + + E++ISK+FPLQ AIR++Q   LS+++ F TLP+ K E
Sbjct: 433 SKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLE 492

Query: 505 LPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEK 564
           +P D+VLCSP V+Q  T++I  HDTPEIWAKRDVI G IDPS+SIIVDS LDF KW   +
Sbjct: 493 IPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNR 552

Query: 565 KYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVH 624
           KYGVID+NIPQ+LFEQ+NYSA++TSQEVL YIWDNY+KYFP++ KVAF+G GDAY+GIVH
Sbjct: 553 KYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVH 612

Query: 625 LLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKK 684
           LLGHRDTR+ VK+V++FI +KQL+ LVPLVDESLSDWYFKNSL+F+DK+H  W D E+KK
Sbjct: 613 LLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKK 672

Query: 685 PRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           PRKK+GR+LRC+TDG+N+ +EERFEEATDFILD FEEWSDSE
Sbjct: 673 PRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/686 (74%), Positives = 595/686 (86%), Gaps = 3/686 (0%)

Query: 44  KEEPELKKQKITDV-SERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDP 102
           +E P+ +K   +   S+R +IV P   +L YTPLKTGLCYDVRMRYHAKIFTSYFEYIDP
Sbjct: 8   RENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDP 67

Query: 103 HPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDF 162
           HPEDPRRIYRIYKILAENGLI DP LSGI+DIGDLMLKIPVR+AT +E+LEVHSKEH +F
Sbjct: 68  HPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEF 127

Query: 163 IEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRP 222
           IE  + M+ +ELLK+TE GDSVYFNNDS +SAKL  GG+IEACKAVVEGRVKN+ AVVRP
Sbjct: 128 IESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRP 187

Query: 223 PGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRV 282
           PGHH+EP++AGGFCLFSNVA+A+KNIL+NYPESVRRIMILDWDIHHGNGTQKAFYDDDRV
Sbjct: 188 PGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRV 247

Query: 283 LYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPM 342
           LYISLHRFELGKYYPGT  G YD+TGEGKGEGFNCNITWPVGGVGDAEY+WAFEQVVMPM
Sbjct: 248 LYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM 307

Query: 343 AREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDA 402
           +REF+PDLVIIS+GFDAADGD+IGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGGYNLDA
Sbjct: 308 SREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDA 367

Query: 403 IARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRYGNAGCNF 462
           IARSALSVAK+LIG                AIEII+KVIRLQSKYWKCF+RR+GN+GC F
Sbjct: 368 IARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTF 427

Query: 463 KDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTV 522
           +  + ES+ + NFPLQ AIR+QQ + LS++F F   PL + +L  DTV+CSP VY   T+
Sbjct: 428 EKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTI 487

Query: 523 IICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQEN 582
           II   DTPEIWAKRDVIQGTIDPS+SII D+ L FIKWA E+ YGVID+NIPQ+LFEQ+N
Sbjct: 488 IILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDN 547

Query: 583 YSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFI 642
           YSA++T+QEV++++WDNY+++F +  K+AF+G+GDA SGIVHLLGHRDTRS VKSVINFI
Sbjct: 548 YSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFI 607

Query: 643 AQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLLRCETDGI 700
           AQK L+ L+PLVDE+L DWYFKNSLVFSDK+H  WGD   ENKKPRKK+GR+LRC +DG+
Sbjct: 608 AQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGL 667

Query: 701 NNIVEERFEEATDFILDSFEEWSDSE 726
            NI+EERFEEATDF+LDSFEEWS+S+
Sbjct: 668 TNIIEERFEEATDFMLDSFEEWSESD 693

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/672 (73%), Positives = 587/672 (87%), Gaps = 3/672 (0%)

Query: 57  VSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 116
           V++RP IVP    +L YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI
Sbjct: 38  VAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 97

Query: 117 LAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLK 176
           LAENGLI DPTLSG++ IGDLMLKIPVR+AT+EEIL+VH+KEH +FI KT++M R++LLK
Sbjct: 98  LAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLK 157

Query: 177 ATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFC 236
            TEKGDSVYFNNDS+ SAKL  GG+IEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFC
Sbjct: 158 ETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFC 217

Query: 237 LFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYY 296
           LFSNVA+AA+NILKNYPESVR+IM+LDWD+HHGNGTQKAFYDDDRVLYISLHR ELGKYY
Sbjct: 218 LFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYY 277

Query: 297 PGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSG 356
           PGTI+G  D+ GEGKGEGFNCNI WP  GVGD+EY+WAFEQV+MPM REF+PDLVIISSG
Sbjct: 278 PGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSG 337

Query: 357 FDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIG 416
           FDAADGD++GQCHVTPSCYGHMTHMLKSLA+GNLC VLEGGY+LD+IA+SAL+VAK+LIG
Sbjct: 338 FDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIG 397

Query: 417 XXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFP 476
                           A+E+ID VI+ QSKYWKCFK  +GN GC+FK++  ++ I+KNFP
Sbjct: 398 -EPPDELPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFP 456

Query: 477 LQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKR 536
           LQ AIR+QQ+  L+ +F+F TLPL K ELP DT +CSPN+Y +  +I+C HDTP IWA+R
Sbjct: 457 LQNAIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQR 516

Query: 537 DVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYI 596
               GTIDPS+SIIVD+TLD IKWA+ + YGVIDINIPQ+L EQ+NYSA++T+QEVL +I
Sbjct: 517 SRATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHI 576

Query: 597 WDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDE 656
           WDNYLKYFP++ +VAF+ IGDA+SG+VHLLGHRDTRSVVKS ++F+ Q+ LR L+PLVDE
Sbjct: 577 WDNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDE 636

Query: 657 SLSDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLLRCETDGINNIVEERFEEATDF 714
           +L+DWYFKNSLVF+   HT WG+   ENKKPRKK+GR+L+C++DGINNI+EERFEEATDF
Sbjct: 637 TLADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDF 696

Query: 715 ILDSFEEWSDSE 726
           ILD+FEEWSDSE
Sbjct: 697 ILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1088 bits (2814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/670 (74%), Positives = 587/670 (87%), Gaps = 3/670 (0%)

Query: 59  ERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 118
           +RPVIVP   A+L YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 40  KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 119 ENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT 178
           ENGLI DPTLSG++DIGDLMLKIP R+AT+EEIL+VH+ EH +F+ KT++M RE+LLK T
Sbjct: 100 ENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKET 159

Query: 179 EKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 238
           EKGDSVYFNNDS+ SAKL  GG+IEAC+AVVEGRVKN+LAVVRPPGHHAEP  AGGFCLF
Sbjct: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLF 219

Query: 239 SNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 298
           SNVA+AA+NILKNYPESV++IMILDWD+HHGNGTQKAFY+DDRVLY+SLHR ELGKYYPG
Sbjct: 220 SNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPG 279

Query: 299 TINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFD 358
           TI+G  D+ GEGKGEGFNCNI WP  GVGDAEYIWAFEQVV+PM REFQPDLVIISSGFD
Sbjct: 280 TIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFD 339

Query: 359 AADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXX 418
           AADGD++GQCHVTPSCYGHMTHMLKSLA+GN+C VLEGGY+LD+IA+SAL VAK+LIG  
Sbjct: 340 AADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIG-E 398

Query: 419 XXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQ 478
                         A+E+ID VI++QS+YW+CFK  + N GC+FK+ + E+L+++NFPLQ
Sbjct: 399 PPDELPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQ 458

Query: 479 QAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDV 538
            AIR+QQ+  L+ ++ F TLPL+K ELP DT LCSPN+Y S+++I+C HDTPEIWA+R  
Sbjct: 459 TAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSR 518

Query: 539 IQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWD 598
             GTIDPS+SIIVD+TLD IKWA+++ YGVIDINIPQ+L EQ+NYSA++T+QEVL YIWD
Sbjct: 519 ATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWD 578

Query: 599 NYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESL 658
           +YLKYF ++ KVAF+ IGDAYSG+VHLLGHRDTR+VVK+ I+FI Q+ LR LVPLVDESL
Sbjct: 579 SYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESL 638

Query: 659 SDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLLRCETDGINNIVEERFEEATDFIL 716
           +DWYFKNSLVF+   HT WG+   ENKKPRKK+GR+L+C +DG+NNI+EERFEEATDFIL
Sbjct: 639 ADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFIL 698

Query: 717 DSFEEWSDSE 726
           D+FEEWSDSE
Sbjct: 699 DTFEEWSDSE 708

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/708 (69%), Positives = 592/708 (83%), Gaps = 10/708 (1%)

Query: 23  LQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCY 82
           +Q+N   +  + + KR     +EE  L+   +  V +R VIVP +  ++ Y PLKTGLCY
Sbjct: 1   MQSNMTSSAMEGSTKRK----QEEENLESLNV--VPKRQVIVPTKKPQVHYIPLKTGLCY 54

Query: 83  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIP 142
           DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI D  LSG++DIGD+MLKIP
Sbjct: 55  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIP 114

Query: 143 VRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSI 202
           VR+AT +EILEVHS+EH +F+E T+TMNRE LLK TEKGDSVYFNNDS+ SAKL  GG+I
Sbjct: 115 VREATADEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAI 174

Query: 203 EACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMIL 262
           EACKAVVEG+VKN+LAVVRPPGHH+EP+++GGFCLFSNVA+AAKNILKNYPESVR+IMIL
Sbjct: 175 EACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMIL 234

Query: 263 DWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWP 322
           DWDIHHGNGTQKAFY D+RVLY+SLHRFE GKYYPGT+ GQYDQ GEGKGEGFNCNITWP
Sbjct: 235 DWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWP 294

Query: 323 VGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHML 382
            GGVGDAEY+WAFEQ+VMPM REFQPDLVIISSGFDAADGD IGQCHVTPSCYGHMTHML
Sbjct: 295 TGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHML 354

Query: 383 KSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIR 442
           KSLA+GNL VVLEGGYNLD+IA SALSVAK LIG                A+E+I KVI+
Sbjct: 355 KSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIK 414

Query: 443 LQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLK 502
           +QSKYWKCFKRR+GN   NF +  +++L +K FPLQ AIR+QQ   L +++ F   P   
Sbjct: 415 IQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTAN 474

Query: 503 PELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWAN 562
            +LP D +LCSPN++ ++TVII  HDTP+IW ++D+I  T+DP SSII+DSTLDF+KWA+
Sbjct: 475 LKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAH 534

Query: 563 EKKYGVIDINIPQNLF----EQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDA 618
            +KYG+ID+NIPQ+L       +NYS+++ +QE+L ++WDN++K+   V K+AFIG+GD+
Sbjct: 535 NRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDS 594

Query: 619 YSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWG 678
            SG+VHLLGHRDT+  VK+VINF+A KQL+ LVPLVDESLSDWYFKNSLVFS+++H  WG
Sbjct: 595 VSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWG 654

Query: 679 DKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           DKENKKPRKKYGR+LRC+TDG+N+ +EERF+EATDFILDSFEEWSDSE
Sbjct: 655 DKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/697 (70%), Positives = 588/697 (84%), Gaps = 8/697 (1%)

Query: 32  SDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAK 91
           +DT    NM     +  + +QK      RP+IVP    ++ Y PLKTGLCYDVRMRYHAK
Sbjct: 16  NDTIGVENMKTAVSKLTVAQQK------RPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAK 69

Query: 92  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEI 151
           IFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSG++DIG+LMLKIP+R+ATE+EI
Sbjct: 70  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEI 129

Query: 152 LEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEG 211
           L VHSKEH +F++ T+TM+RE+LLK TE GDSVY+NNDS  SAKL  GG+IEACKAVVEG
Sbjct: 130 LLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG 189

Query: 212 RVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNG 271
           RVKN+LAVVRPPGHHAEP+ AGGFCLFSNVA+AA+NILKNYPESVR++MILDWDIHHGNG
Sbjct: 190 RVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNG 249

Query: 272 TQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEY 331
           TQ+AFY+D+RVLY+SLHR+ELG+YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDAEY
Sbjct: 250 TQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEY 309

Query: 332 IWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLC 391
           +WAFEQ+V+PM REFQPDLVIISSGFDAADGD+IGQCHV+P+CYGHMTHMLKSLAKGN+C
Sbjct: 310 MWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMC 369

Query: 392 VVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCF 451
           VVLEGGYNLD+IA+SAL V K+LIG                AI  I+ VIR Q+KYW CF
Sbjct: 370 VVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCF 429

Query: 452 KRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVL 511
           K ++GN G N+K+ ++ESL  KNFPLQ A+R++Q   LS+++KF TLPLL  EL  DT++
Sbjct: 430 KSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTII 489

Query: 512 CSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDI 571
           CSPN++++ T+IIC HDTPE+WAKR+ + G IDPS+SIIVD+TL    WA  + YG+IDI
Sbjct: 490 CSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDI 549

Query: 572 NIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDT 631
           NIPQ+LFE +NYSA++TSQEVL+Y+WD+YLK+F  + +VAF+GIGDAYSG VHLLGHRDT
Sbjct: 550 NIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDT 609

Query: 632 RSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKEN--KKPRKKY 689
           RS+VK  I+F  +KQLR LVPLVDES+SDWYFKNSL+F+ K H+ WG + N  KKPRKK+
Sbjct: 610 RSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKF 669

Query: 690 GRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           GR+L+C +DG+NNI+EERFEEATDFILDSFEEWSDSE
Sbjct: 670 GRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/693 (69%), Positives = 571/693 (82%), Gaps = 2/693 (0%)

Query: 36  QKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTS 95
           ++ ++  +K E         D S+RPVIVPP   ++ Y+ LKTG+CYDVRMRYHAKIFTS
Sbjct: 12  ERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTS 71

Query: 96  YFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVH 155
           YFEYIDPHPEDPRRIYR+YKILAENGLI+DPTLSG + IGDLM+K+PVR+A EEEIL+VH
Sbjct: 72  YFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVH 131

Query: 156 SKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKN 215
           S++H DFI +T  + RE LLK TE GDSVYFNNDS+ SAKL  GG+IEACKAVVEGRVKN
Sbjct: 132 SRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKN 191

Query: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKA 275
           S+AVVRPPGHHAEP+ AGGFCLFSNVA+AA N+LK+YPESVR+IMI+DWDIHHGNGTQKA
Sbjct: 192 SIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKA 251

Query: 276 FYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAF 335
           FYDDDRVLY+SLHR++LGKYYPGTI+G YDQTGEGKGEGFNCNITWP GGVGDAEY+WAF
Sbjct: 252 FYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAF 311

Query: 336 EQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLE 395
           EQV+MPM REF+PDLV+ISSGFDAADGD+IGQCHVTP+CYGHMTHML SLAKGNLCVVLE
Sbjct: 312 EQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLE 371

Query: 396 GGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRY 455
           GGYNLD+IA+SAL V K+L+G                A ++I+ VIR QSKYW CFK R+
Sbjct: 372 GGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRH 431

Query: 456 GNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPN 515
           GN G NFKD I  +L ++NFPLQ AIRE Q++ LS  F F  LP+L   LP +T+LC+  
Sbjct: 432 GNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSG 491

Query: 516 VYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQ 575
           +  S+T+++  HDTPEIW++RD   G IDPSSSIIVD+ L  I WA +++YG+IDINIPQ
Sbjct: 492 IQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQ 551

Query: 576 NLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVV 635
            LFE  NY  + +SQE+L Y+WDNYLK+F N++KVAFIGIGDAY GIVHLLGHRDTRSVV
Sbjct: 552 TLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVV 611

Query: 636 KSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLL 693
           K  I+F+ +K L+ +VPL+DE+L DWYFKNSLVF+  +H+ WG    ENKK RKKYGR+L
Sbjct: 612 KCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVL 671

Query: 694 RCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           + + DG+ NI +ERFEEATDFILDSFEEWS+SE
Sbjct: 672 KADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1038 bits (2685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/701 (70%), Positives = 578/701 (82%), Gaps = 8/701 (1%)

Query: 34  TTQKRNMTAVKEEPELKKQKITD---VSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHA 90
           T QKR +     + E    + +    V +RPVIVPP   ++SY PLKTGLCYDVRMRYHA
Sbjct: 5   TQQKRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHA 64

Query: 91  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEE 150
           KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGI++IG+LM KIPVR+ATEEE
Sbjct: 65  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEE 124

Query: 151 ILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVE 210
           IL VHSKEH +F++ T+TM+RE+LLK TE GDSVY+NNDS  SA+L  GG+IEACKAVVE
Sbjct: 125 ILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVE 184

Query: 211 GRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGN 270
           GRVKN++AVVRPPGHHAEP  AGGFCLFSNVA+AA+NILKNYPESVRR+MILDWDIHHGN
Sbjct: 185 GRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGN 244

Query: 271 GTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAE 330
           GTQKAFY D+RVLY+SLHR+ELGKYYPGT  G YDQ G+GKGEGFNCNI W   GVGDAE
Sbjct: 245 GTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAE 304

Query: 331 YIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNL 390
           Y+WAFEQVV+PM REFQPDLVIISSGFDAADGD+IGQCHV+P+CYGH+THMLKSLA+GN+
Sbjct: 305 YMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNM 364

Query: 391 CVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIID-KVIRLQSKYWK 449
           CVVLEGGYNLD+IA+SAL VAK+LIG                AI  ID  +++ QSKYW 
Sbjct: 365 CVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWN 424

Query: 450 CFKRRYGNAGCNFKD-EINESLISKNFPLQQAIR-EQQLNTLSQDFKFATLPLLKPELPK 507
           CFK R+GN G N+++  +N+SL SKNFPLQ+      Q   L++++KF TLPLL  ELP 
Sbjct: 425 CFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPS 484

Query: 508 DTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYG 567
           DT++CSPN++ +  +IIC HDTPEIWA+RD + G IDPS+SIIVD+T+  I WA  + YG
Sbjct: 485 DTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYG 544

Query: 568 VIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLG 627
           VIDINIPQ+LFEQ+NYSA+++SQEV+TY+WD+YLK FP++ +VAF+GIGDAYSG VHLLG
Sbjct: 545 VIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLG 604

Query: 628 HRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKEN--KKP 685
           HRDTRSVVK  I F  +KQLR LVPLVDESL DWYFKNSLVF+   H  WG   N  KKP
Sbjct: 605 HRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKP 664

Query: 686 RKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           RKK+GR+LR   DG+NNIVEER EEATDFILDSFEEWS+SE
Sbjct: 665 RKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/656 (71%), Positives = 563/656 (85%)

Query: 69  AELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTL 128
           + LSYTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI+DP L
Sbjct: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62

Query: 129 SGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNN 188
           SGI+DIGDLM KIPVR+AT EEILEVH KE  +++EKT  +NR+ELL  TE GDSVYFNN
Sbjct: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122

Query: 189 DSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNI 248
           DS+ SAKL  GG+IEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVA+A KNI
Sbjct: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182

Query: 249 LKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTG 308
           LKNYP+ V+++MI+DWDIHHGNGTQKAFY+DDRVLY+SLHRFELGKYYPGTI+GQYDQ G
Sbjct: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242

Query: 309 EGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQC 368
           EGKGEGFNCNI W VGG+GDAEYIWAFEQ+VMPM REF+PDLVI+SSGFDAADGD+IG+C
Sbjct: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302

Query: 369 HVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXX 428
           HVTPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+VAK+LIG            
Sbjct: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362

Query: 429 XXXXAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNT 488
               AIE+ID+VI L+SKYWKCFKR+  N+ C +K  I+ES  +K FP+Q AIR QQ+  
Sbjct: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422

Query: 489 LSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSS 548
           L+ D+    LPL+   LP+DTV+CS ++ QS   II  HDTPEIW+KRD I G ID S+S
Sbjct: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482

Query: 549 IIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVE 608
           + +D++L F  WA ++ YG+ID+NIPQ L+EQ+NYSA +T+QEVL  +WDN LKYFPNV 
Sbjct: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542

Query: 609 KVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLV 668
           K+A+IG+G+AYSG+VHLLGHRDTRSVVKSVI F+ +K L+ALVPLV+ESL+DWYFK SL+
Sbjct: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602

Query: 669 FSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSD 724
           F+DK+H+ WG+ ++KKPRK+YGR+LRC++DGI +++EERFEEATDFI+DS +EW++
Sbjct: 603 FADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/691 (67%), Positives = 563/691 (81%), Gaps = 9/691 (1%)

Query: 43  VKEEPELKKQKITD-------VSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTS 95
           +K+E E     I D       + +RPVIVP +   L YTPLKTG+CYDVRMRYHAKIFTS
Sbjct: 11  LKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTS 70

Query: 96  YFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVH 155
           YFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+G+ DIGDLMLKIPVR+AT+EEIL+VH
Sbjct: 71  YFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVH 130

Query: 156 SKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKN 215
           ++EH  F+E T  M REELL  TEKGDSVY NNDS+ SA+L  GG+IEACKAVVEGRVKN
Sbjct: 131 TEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKN 190

Query: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKA 275
           +LA+VRPPGHHAEPQAAGGFCLFSNV++AAK+ILK YPESVR+I+I+DWDIHHGNGTQKA
Sbjct: 191 ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKA 250

Query: 276 FYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAF 335
           FY+DD VLYISLHRFELGK+YPG   G YD+ G+GKG+GFNCNITWPV GVGD EYIWAF
Sbjct: 251 FYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAF 310

Query: 336 EQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLE 395
           EQ+V+PMAREF+PDLVI+SSGFDAA GD+IGQCHVTP+CYG+MTHMLKSLA+GNLCVVLE
Sbjct: 311 EQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLE 370

Query: 396 GGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRRY 455
           GGYNLD+I+ SAL+VAKILIG                 +E+I+KVIR+QSKYWKCF+R++
Sbjct: 371 GGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKF 430

Query: 456 GNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPN 515
           GN G  +++ I ES I K FPLQ AIR  QL+    DF   +L L    LPK++++CS N
Sbjct: 431 GNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSN 489

Query: 516 VYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQ 575
            +++K++ +  HDTPE+W  RD+I G IDPS+SII DS+L FI WA E++  VIDINIP+
Sbjct: 490 FFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPR 549

Query: 576 NLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVV 635
           + FE +NYS+ + SQ+V+  +WDN+ KY  ++EK+ FIGIG+A SGIVHLLG RDTR+V 
Sbjct: 550 SAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVT 609

Query: 636 KSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRC 695
           K+ INF+    L+ +VP +DESL DWYFKNSLVF+D  H  W + + KKPRKKYGR+LRC
Sbjct: 610 KAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRC 668

Query: 696 ETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           +TDGI+NI+EERFEEATDFILD+F+EWSD+E
Sbjct: 669 DTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/487 (73%), Positives = 404/487 (82%), Gaps = 9/487 (1%)

Query: 14  KTKESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSY 73
           K ++++  L + +++          N    K  P  KKQ         +IVP +  ++ Y
Sbjct: 4   KVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQ---------IIVPVQAPKIHY 54

Query: 74  TPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIED 133
            PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+++
Sbjct: 55  VPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDN 114

Query: 134 IGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFAS 193
           IGDLMLK+P+R+AT  EILEVHS EH+ ++EKTS  NRE+LLK TE GDSVYFNNDSF S
Sbjct: 115 IGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQS 174

Query: 194 AKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
           AKL  GG+IEACKAVVEGRVKN++AVVRPPGHH+EP++AGGFCLFSNVA+A KNILKNYP
Sbjct: 175 AKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYP 234

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
           ESVR+++ILDWDIHHGNGTQKAFY+DD VLYISLHRFELGKYYPGTI GQYDQTGEGKGE
Sbjct: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
           GFNCNITWP+G VGDAEY+WAFEQVVMPM+REFQPDLVIISSGFDAADGD+IGQCHV+PS
Sbjct: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXA 433
           CYGHMTHMLKSLA+GNLCVVLEGGYNLDAIARSALSV+KILIG                 
Sbjct: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEV 414

Query: 434 IEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDF 493
           IE+IDK+IRLQSKYWKCF+RR+GN GCNFK+ IN+SLISKNFPLQ AIR  Q   L  + 
Sbjct: 415 IEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDEL 474

Query: 494 KFATLPL 500
            F TLP+
Sbjct: 475 NFLTLPI 481

 Score =  347 bits (889), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 192/222 (86%)

Query: 505 LPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEK 564
           L ++T+LCSP + +SKT+++  HD+P++W KRDV  G +D SS+II+DSTLDFIKW+ ++
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 565 KYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVH 624
            YGVIDINIPQ LFEQ+NYS+I+ +QE L   WDNYLKYFP +EK+ FIG GDA++GIVH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 625 LLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKK 684
           LLGHRDTRSVVKSVINF+ +K L+ALVPLVDE+LSDWYFKNSLVF+DK+H +W D ENKK
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753

Query: 685 PRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           PRKK+GR+LR + DGI N++EERF+EATDFILDSFEEWSD E
Sbjct: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  522 bits (1344), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 238/307 (77%), Positives = 271/307 (88%)

Query: 50  KKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRR 109
           K      + +R VIVP R  +L YTPLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR
Sbjct: 43  KNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRR 102

Query: 110 IYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTM 169
           +YRIYKILAENGLIKD  LSG++DIGD+MLKIPVR ATEEEIL VH++EH DFIE   + 
Sbjct: 103 VYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQ 162

Query: 170 NREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEP 229
           +REEL+K TEK DSVY+NNDS+ SAKL  GG IEAC+AVVEGRVKNSLA+VRPPGHHAEP
Sbjct: 163 SREELIKLTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEP 222

Query: 230 QAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHR 289
           QAAGGFCLFSNV++AA++IL+ YPESVR+I+ILDWDIHHGNGTQKAFY+D+ VLYISLHR
Sbjct: 223 QAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHR 282

Query: 290 FELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPD 349
           +E   +YPGTI+G+YDQ GEGKGEGFNCNITWPVGGVGDAEY+WAFE VVMP+ REF+PD
Sbjct: 283 YESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPD 342

Query: 350 LVIISSG 356
           LVI+SSG
Sbjct: 343 LVIVSSG 349

 Score =  261 bits (667), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 166/217 (76%)

Query: 510 VLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVI 569
           VL S  +++++T++I  HDTPE+W  RD+I G +DPS+S+++D+++ FIKWA ++ Y ++
Sbjct: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419

Query: 570 DINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHR 629
           DINIP++  E+E +S+   + E++  +WDN+L+Y   + K+ FIGIG++Y GIVHL+G R
Sbjct: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479

Query: 630 DTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKY 689
           D R + K+VINF+    L++L    DE++ DWYFKNSLVF++ SH  W + E K+PRKK+
Sbjct: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKF 539

Query: 690 GRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726
           GR+L+ ++DGI +I+ ERF+EATDFILD+FEEWSD E
Sbjct: 540 GRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 102/354 (28%), Positives = 176/354 (49%), Gaps = 37/354 (10%)

Query: 57  VSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 116
            +++P+     D   SYTP         R+ YH     S + Y   HP  P R+     +
Sbjct: 12  AAKQPLFEESFDNSSSYTP---------RVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHL 62

Query: 117 LAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLK 176
           ++  GL K            +M     R AT EE+++ HS+++ DF+ K +  N  ++ +
Sbjct: 63  VSSYGLHK------------IMDLYETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPR 110

Query: 177 AT-EK---GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQA 231
            T EK   GD      + +  + L  G S++A + ++    ++ +A+    G HHA+   
Sbjct: 111 GTLEKFNIGDDCPIFQNLYDYSTLYTGASLDATRKLIND--QSDIAINWSGGLHHAKKNN 168

Query: 232 AGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFE 291
             GFC  +++ ++  N+L+ +P    R++ +D D+HHG+G Q+AFY  DRV  IS H+F 
Sbjct: 169 PSGFCYINDIVLSIVNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN 224

Query: 292 LGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLV 351
            G+++PGT  G YD+TG  KG+ F  N+     G+ D  YI  F+ ++ P+   ++P ++
Sbjct: 225 -GEFFPGT--GDYDETGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVI 280

Query: 352 IISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
           +   G D+   D +G  ++    +G     +KS     L VV  GGY    ++R
Sbjct: 281 VQQCGADSLGHDRLGCFNLNIKGHGECVKFIKSFGIPML-VVGGGGYTPRNVSR 333

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  145 bits (367), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 168/333 (50%), Gaps = 30/333 (9%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGLHK------------VM 68

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSFASA 194
                R AT+EE+L  H++++ DF+   +  N  +L + + EK   GD        F  +
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYS 128

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
            L  G S++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 MLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 239

Query: 314 GFNCNITWPVG-GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTP 372
            F+ N+  P+  G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 240 HFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNI 297

Query: 373 SCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
             +G     +KS     LCV   GGY    ++R
Sbjct: 298 RAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/335 (29%), Positives = 170/335 (50%), Gaps = 34/335 (10%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLS--GIEDIGD 136
           G  Y  R+ YH     S + Y   HP  P R            ++ D  +S  G+ +I D
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRF-----------MLTDHLVSSYGLHNIMD 70

Query: 137 LMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT----EKGDSVYFNNDSFA 192
           L      R+AT+EE+L+ HS+++ +F+ K S  N  ++ + T      GD      + + 
Sbjct: 71  LY---ETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYE 127

Query: 193 SAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKN 251
             KL  G S++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ 
Sbjct: 128 YCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRY 185

Query: 252 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGK 311
           +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G YD+ G  +
Sbjct: 186 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAE 238

Query: 312 GEGFNCNITWPVG-GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHV 370
           G+ F  N+  P+  G+ D  YI  F+ V+ P+   F+P  +I   G D+   D +G  ++
Sbjct: 239 GKHFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNL 296

Query: 371 TPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
               +G     ++S     + VV  GGY    ++R
Sbjct: 297 NIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSR 330

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/339 (28%), Positives = 169/339 (49%), Gaps = 28/339 (8%)

Query: 72  SYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGI 131
           +Y P + G  Y   + YH     S + Y   HP  P R+     +++  GL K       
Sbjct: 13  TYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGLHK------- 65

Query: 132 EDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFN 187
                +M     R+AT +E+LE HS ++ +F+ K S     ++ + + EK   GD     
Sbjct: 66  -----IMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIF 120

Query: 188 NDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAK 246
              F  + L  G S++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  
Sbjct: 121 QGIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAIL 178

Query: 247 NILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQ 306
           N+L+ +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G +D+
Sbjct: 179 NLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDE 231

Query: 307 TGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIG 366
            G  +G+ F  N+     G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G
Sbjct: 232 IGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLG 290

Query: 367 QCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
             ++    +G     +KS     L VV  GGY    ++R
Sbjct: 291 CFNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 328

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 166/332 (50%), Gaps = 28/332 (8%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y+  + YH     S F Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSFASA 194
                R AT EE+ E H+ ++ +F+ K S  N  +L + T EK   GD        +  +
Sbjct: 69  DLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
            L  G S++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+TG  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
            F  N+     G+ D  YI  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            +G     +KS     L V+  GGY    ++R
Sbjct: 299 AHGECVRFVKSFGIPML-VLGGGGYTPRNVSR 329

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 168/334 (50%), Gaps = 32/334 (9%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTS--TMN---REELLKATEKGDSVYFNNDSFAS 193
                R+AT+EE+ + HS ++ DF+EK S  T+N   R  L K     D   F N  +  
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 194 AKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNY 252
           + L  G S++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 253 PESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKG 312
           P    R++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G YD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 313 EGFNCNITWPVG-GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVT 371
           + F  N+  P+  G+ D  YI  F+ ++ P+   +QP ++I   G D+   D +G  ++ 
Sbjct: 241 KHFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLN 298

Query: 372 PSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
              +G     + S     + VV  GGY    ++R
Sbjct: 299 IKAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSR 331

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/329 (29%), Positives = 164/329 (49%), Gaps = 28/329 (8%)

Query: 82  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKI 141
           Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M   
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 142 PVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK----GDSVYFNNDSFASAKLP 197
             R AT +E+LE HS+++ +F+ K S  N  +L + T +    GD      + +    L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 198 VGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESV 256
            G S++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 257 RRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFN 316
            RI+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 317 CNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYG 376
            N+     G+ D  YI  F+ +V P+   F+P L++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 377 HMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
                +KS     L VV  GGY    ++R
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/332 (29%), Positives = 166/332 (50%), Gaps = 28/332 (8%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRLLLTDHLVSSYGLHK------------IM 68

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSFASA 194
                R AT EEI E H++++ DF+ K +  N  ++ + T EK   GD      + F   
Sbjct: 69  DLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQNLFNYC 128

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
           KL  G S++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 KLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G +D+ G   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANGK 239

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
            F  N+     G+ D  YI  F+ ++ P+   ++P ++I   G D+   D IG  ++T  
Sbjct: 240 HFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTIK 298

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            +G     ++S     L VV  GGY    ++R
Sbjct: 299 GHGECVKFIRSFGIPML-VVGGGGYTPRNVSR 329

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  143 bits (360), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 95/330 (28%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 81  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLK 140
            Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 141 IPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK----GDSVYFNNDSFASAKL 196
              R AT +E+L+ HS+++ +F+ K S  N  +L + T +    GD      + +    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 197 PVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPES 255
             G S++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 256 VRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGF 315
             RI+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 316 NCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCY 375
             N+     G+ D  YI  F+ +V P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 376 GHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  142 bits (359), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 172/339 (50%), Gaps = 29/339 (8%)

Query: 73  YTPL-KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGI 131
           + PL + G  Y  R+ YH     S++ Y   HP  P R+     +++  GL K       
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRLMLTDHLVSGYGLHK------- 66

Query: 132 EDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFN 187
                +M     R AT EE+ E HS+++ +F+ K +  N  +L + T EK   GD     
Sbjct: 67  -----IMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 188 NDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAK 246
            + F  + L  G S++A + ++    ++ +A+    G HHA+  +  GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 247 NILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQ 306
           N+L+ +P    R++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G+ D+
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDE 232

Query: 307 TGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIG 366
           TG   G+ F  N+     G+ D  YI  F+ ++ P+   F+P +++   G D+   D +G
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLG 291

Query: 367 QCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
             ++    +G     ++S     L VV  GGY    ++R
Sbjct: 292 CFNLNIKAHGECVKFVRSFGIPML-VVGGGGYTPRNVSR 329

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  142 bits (359), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 96/332 (28%), Positives = 167/332 (50%), Gaps = 28/332 (8%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSFASA 194
                R+AT EE+ + HS+++ +F+ K +  N  ++ + T EK   GD      + +  +
Sbjct: 71  DLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNIYDYS 130

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
            L  G S++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 131 TLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYHP 188

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  IS H+F  G+++PGT  G +D+ G  KG+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKGK 241

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
            F  N+     G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 242 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            +G     +KS     L VV  GGY    ++R
Sbjct: 301 AHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 331

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  142 bits (359), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 95/330 (28%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 81  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLK 140
            Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 141 IPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK----GDSVYFNNDSFASAKL 196
              R AT +E+L+ HS+++ +F+ K S  N  +L + T +    GD      + +    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 197 PVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPES 255
             G S++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 256 VRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGF 315
             RI+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 316 NCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCY 375
             N+     G+ D  YI  F+ +V P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 376 GHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 167/332 (50%), Gaps = 28/332 (8%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 72

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSFASA 194
                R AT++E+L+ HS ++  F++K +  N  ++ + T EK   GD      + +  +
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
            L  G S++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 133 ALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYHP 190

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G YD+ G  +G+
Sbjct: 191 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQGK 243

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
            F  N+     G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 244 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNIK 302

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            +G     ++S     L VV  GGY    ++R
Sbjct: 303 AHGECVKFIRSFGIPML-VVGGGGYTPRNVSR 333

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/332 (27%), Positives = 168/332 (50%), Gaps = 28/332 (8%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y  R+ YH     S + +   HP  P R+     +++  GL K            +M
Sbjct: 23  GSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRLMLTDHLVSGYGLHK------------IM 70

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT----EKGDSVYFNNDSFASA 194
                R A+++E+LE H+ ++ +F++K +  N  ++ + T      GD     ++ +  +
Sbjct: 71  DLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDCPIFHNLYEYS 130

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
            L  G S++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P
Sbjct: 131 SLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIVLSILNLLRFHP 188

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G YD+TG   G+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNYDETGCSNGK 241

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
            F  N+     G+ D  YI  F+ ++ P+   + P ++I   G D+   D +G  ++   
Sbjct: 242 HFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            +G     +KS     L VV  GGY    ++R
Sbjct: 301 AHGECVKFVKSFGIPML-VVGGGGYTPKNVSR 331

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 167/335 (49%), Gaps = 28/335 (8%)

Query: 76  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIG 135
            + G    +R+ YH     S++ Y   HP  P R+     +++  G+ K           
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSGYGMHK----------- 67

Query: 136 DLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSF 191
            +M     R AT +E+ E H++++  F++K S  N  +L + T EK   GD      + +
Sbjct: 68  -VMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 192 ASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILK 250
             A L  G S++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 251 NYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEG 310
            +P    R++ +D D+HHG+G Q+AFY  DRV  IS H++  G ++PGT  G  D+TG  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 311 KGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHV 370
            GE F  N+     G+ D  YI  F+ V+ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 371 TPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
               +G     +KS     L VV  GGY    ++R
Sbjct: 297 NIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  141 bits (356), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 95/336 (28%), Positives = 171/336 (50%), Gaps = 28/336 (8%)

Query: 75  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDI 134
           P + G  Y  ++ YH     S + Y   HP  P      ++++  + L+   +  G+  I
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLV---SCYGLHKI 103

Query: 135 GDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDS 190
            DL      R+AT+EE+LE H+ ++ +F+   +  N  +L + + EK   GD        
Sbjct: 104 MDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQGM 160

Query: 191 FASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNIL 249
           F  + L  G S++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++L
Sbjct: 161 FDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISLL 218

Query: 250 KNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGE 309
           + +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ G 
Sbjct: 219 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGC 271

Query: 310 GKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCH 369
            KG+ F+ N+     G+ D  YI  F+ ++ P+   ++P ++I   G D+   D +G  +
Sbjct: 272 SKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFN 330

Query: 370 VTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
           +    +G     +KS     LCV   GGY    ++R
Sbjct: 331 LNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 96/332 (28%), Positives = 165/332 (49%), Gaps = 28/332 (8%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGLHK------------VM 71

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTS--TMNR--EELLKATEKGDSVYFNNDSFASA 194
                R AT++E+ + HS+++ +F+ K +  T+N+     L+    GD        F  A
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
            L  G S++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
            F  N+     G+ D  YI  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 243 HFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            +G     +KS     L VV  GGY    ++R
Sbjct: 302 AHGECVRFVKSFGVPML-VVGGGGYTPRNVSR 332

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  139 bits (351), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 164/329 (49%), Gaps = 28/329 (8%)

Query: 82  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKI 141
           Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 142 PVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK----GDSVYFNNDSFASAKLP 197
             R AT++E+ E H++++ +F+ K S  N  +L + T +    GD      + +    L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 198 VGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESV 256
            G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 257 RRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFN 316
            R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 317 CNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYG 376
            N+     G+ D  YI  F+ +V P+   F+P +++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 377 HMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
                +KS     L VV  GGY    ++R
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 168/335 (50%), Gaps = 28/335 (8%)

Query: 76  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIG 135
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL K           
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGLHK----------- 65

Query: 136 DLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSF 191
            +M     R AT EE+   HS+E+ DF+++ +  N  +L + T EK   GD      + +
Sbjct: 66  -IMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 192 ASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILK 250
             + L  G S++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 251 NYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEG 310
            +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G +D+ G  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 311 KGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHV 370
           +G+ F  N+     G+ D  YI  F+ ++ P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 371 TPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
               +G   + ++S     L VV  GGY    ++R
Sbjct: 295 NVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSR 328

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 164/332 (49%), Gaps = 28/332 (8%)

Query: 79  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLM 138
           G  +   + YH     S F Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 139 LKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKAT-EK---GDSVYFNNDSFASA 194
                R AT EE+ E HS+++ +F+ + S  N  +L + + EK   GD        +  +
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
            L  G S++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
               R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373
            F  N+     G+ D  YI  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            +G     +KS     L VV  GGY    ++R
Sbjct: 299 AHGECVKYVKSFGLPML-VVGGGGYTPRNVSR 329

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  137 bits (345), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 95/350 (27%), Positives = 166/350 (47%), Gaps = 42/350 (12%)

Query: 61  PVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 120
           P++V P D +              R+ Y        + Y   HP  P RI   + ++   
Sbjct: 10  PIVVKPNDKK--------------RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNY 55

Query: 121 GLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK 180
           GL K             M     + AT++E+ + H+ E+ DF+ + +  N +   K + K
Sbjct: 56  GLYKK------------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVK 103

Query: 181 ---GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFC 236
              GD     +  +    +  GGS+E    +  G+    +A+    G HHA+   A GFC
Sbjct: 104 FNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFC 161

Query: 237 LFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYY 296
             +++ +    +L+ +P    R++ +D D+HHG+G ++AFY  DRV+  S H++  G+++
Sbjct: 162 YLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFF 215

Query: 297 PGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSG 356
           PGT  G+   TG GKG+ +  N+     G+ DA Y   FE V+  +   +QP  V++  G
Sbjct: 216 PGT--GELRDTGVGKGKNYAVNVPLR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCG 272

Query: 357 FDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARS 406
            D+  GD +G  +++   + +  + +KS     L VV  GGY +  +AR+
Sbjct: 273 GDSLSGDRLGCFNLSMRGHANCVNFVKSFGI-PLMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 97/341 (28%), Positives = 165/341 (48%), Gaps = 28/341 (8%)

Query: 70  ELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLS 129
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL K     
Sbjct: 5   QLPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 130 GIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYF 186
                   M     + AT++E+ + HS E+ DF+ + +  N E   K + K   GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 187 NNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAA 245
            +  +    +  GGS+E    +  G  K  +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 246 KNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYD 305
             +L+ +P    R++ +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+  
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 306 QTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSI 365
            TG GKG+ ++ N+     G+ D  Y   FE V+  +   +QP  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYSVNVPLR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 366 GQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARS 406
           G  +++   + +  + +KS     L VV  GGY +  +AR+
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  135 bits (341), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 96/341 (28%), Positives = 165/341 (48%), Gaps = 28/341 (8%)

Query: 70  ELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLS 129
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL K     
Sbjct: 5   QLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 130 GIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYF 186
                   M     + AT++E+ + H+ E+ DF+ + +  N E   K + K   GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 187 NNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAA 245
            +  +    +  GGS+E    +  G  K  +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 246 KNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYD 305
             +L+ +P    R++ +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+  
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 306 QTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSI 365
            TG GKG+ +  N+     G+ D+ Y   FE V+  +   +QP  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 366 GQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARS 406
           G  +++   + +  + +KS     L VV  GGY +  +AR+
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  135 bits (341), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 96/350 (27%), Positives = 166/350 (47%), Gaps = 42/350 (12%)

Query: 61  PVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 120
           P+ V PRD +              R+ Y        + Y   HP  P RI   + ++   
Sbjct: 10  PITVNPRDKK--------------RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNY 55

Query: 121 GLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK 180
           GL K             M     + AT++E+ + H+ E+ DF+ + +  N +   K + K
Sbjct: 56  GLYKK------------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVK 103

Query: 181 ---GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFC 236
              GD     +  +    +  GGS+E    +  G  K  +A+    G HHA+   A GFC
Sbjct: 104 FNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRG--KCDVAINYAGGLHHAKKTEASGFC 161

Query: 237 LFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYY 296
             +++ +    +L+ +P    R++ +D D+HHG+G ++AFY  DRV+  S H++  G+++
Sbjct: 162 YLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFF 215

Query: 297 PGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSG 356
           PGT  G+   TG GKG+ +  N+     G+ DA Y   FE VV  +   +QP  V++  G
Sbjct: 216 PGT--GELRDTGVGKGKYYAVNVPL-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCG 272

Query: 357 FDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARS 406
            D+  GD +G  +++   + +  + +KS     + +V  GGY +  +AR+
Sbjct: 273 GDSLSGDRLGCFNLSIRGHANCVNFVKSFGL-PMMIVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N +   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  134 bits (337), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N +   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     L +V  GGY +  +AR+
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  134 bits (337), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   K + K   GD     +  +    +  GGS
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 129 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVART 322

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  134 bits (337), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K+            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N +   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   TG G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  134 bits (337), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N +   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  134 bits (337), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   + + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE VV  +   +QP  V++ +G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  133 bits (335), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  133 bits (335), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N     K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   + + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MESAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N +   K + K   GD     +  F    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/350 (26%), Positives = 164/350 (46%), Gaps = 42/350 (12%)

Query: 61  PVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 120
           P+ V P D +              R+ Y        + Y   HP  P RI   + ++   
Sbjct: 10  PITVKPNDKK--------------RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNY 55

Query: 121 GLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK 180
           GL K             M     + AT++E+ + H+ E+ DF+ + +  N E   K + K
Sbjct: 56  GLYKK------------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVK 103

Query: 181 ---GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFC 236
              GD     +  +    +  GGS+E    +  G+    +A+    G HHA+   A GFC
Sbjct: 104 FNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFC 161

Query: 237 LFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYY 296
             +++ +    +L+ +P    R++ +D D+HHG+G ++AFY  DRV+  S H++  G+++
Sbjct: 162 YLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFF 215

Query: 297 PGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSG 356
           PGT  G+    G GKG+ +  N+     G+ DA Y   FE V+  +   +QP  V++  G
Sbjct: 216 PGT--GELRDIGVGKGKYYAVNVPL-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCG 272

Query: 357 FDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARS 406
            D+  GD +G  +++   + +  + +KS     + VV  GGY +  +AR+
Sbjct: 273 GDSLSGDRLGCFNLSMEGHANCVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  132 bits (331), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N +   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   + + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  130 bits (328), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   + + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 85  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVR 144
           R+ Y        F Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 145 DATEEEILEVHSKEHYDFIEKTSTMNREELLKATEK---GDSVYFNNDSFASAKLPVGGS 201
            AT++E+ + H+ E+ DF+ + +  N E   K + K   GD     +  +    +  GGS
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 202 IEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIM 260
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 261 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 321 WPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTH 380
               G+ DA +   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 381 MLKSLAKGNLCVVLEGGYNLDAIARS 406
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 134/282 (47%), Gaps = 22/282 (7%)

Query: 128 LSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFN 187
           LS  + I D +   P + ++ E +L  H+ E  D     ST  R+ L +   +GD   F 
Sbjct: 114 LSKFKKIKDDLPPKPRKRSSLEALL--HADEDDDEKSNVSTGQRD-LKQFNLEGDCPLF- 169

Query: 188 NDSFAS--AKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIA 244
             SF     ++  G ++     V++G  + S+ +    G HHA  Q A GFC  +++ + 
Sbjct: 170 --SFIPMYCQVITGATLMLADKVIKG--ERSIGINWDGGRHHAFKQKASGFCYVNDIVLL 225

Query: 245 AKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQY 304
            + + +   +  ++I  +D+D+HHG+G +KAF     V  ISLH FE+G ++PGT N   
Sbjct: 226 IQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQTISLHLFEVG-FFPGTGN--- 278

Query: 305 DQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDS 364
               E        NI   + G+ D       EQ+V P+    +PD+++I  G D   GD 
Sbjct: 279 --LSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIERHEPDVLVIQCGGDGLMGDG 335

Query: 365 IGQCHVTPSCYGH-MTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
             +  ++       +T ++ +     + ++  GGYN+  ++R
Sbjct: 336 FNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLMSR 377

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 127/264 (48%), Gaps = 19/264 (7%)

Query: 146 ATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEAC 205
            TEE + +   KE+ +  EK   M RE+L     +GD   F+       ++ VG ++   
Sbjct: 156 TTEEPVNKRAEKENSNDNEKE--MIREKLKGYNLEGDCPIFSYLP-VYCQVIVGATLSLA 212

Query: 206 KAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDW 264
           K +     + ++AV    G HHA    A GFC  +++ +  + +  N     +RI  +D+
Sbjct: 213 KHITAVANERTIAVNWDGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDF 269

Query: 265 DIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVG 324
           D+HHG+G Q++F     V  IS H FE G ++P T  G   ++  GK      NI   + 
Sbjct: 270 DLHHGDGVQRSFQYSTSVQTISAHMFEPG-FFPCT--GSLKESKMGKNI---VNIPL-LH 322

Query: 325 GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKS 384
           GV D       E+V++P  + + P++++I  G D   GD   +  +T   +G + ++LK 
Sbjct: 323 GVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKL 380

Query: 385 LAKGNLCVVL---EGGYNLDAIAR 405
           L     C V+    GGYN   ++R
Sbjct: 381 LRIFPGCPVVLLGGGGYNETVMSR 404

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 94/183 (51%), Gaps = 13/183 (7%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HHA  Q A GFC  ++V +  + + K     + ++  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYI-WAFEQVVMPMA 343
           IS+H +E G ++PGT  G  + +  GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 344 REFQPDLVIISSGFDAADGDSIGQCHVTPSCYGH-MTHMLKSLAKGNLCVVLEGGYNLDA 402
           +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN   
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYNDLL 380

Query: 403 IAR 405
           ++R
Sbjct: 381 MSR 383

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 96/182 (52%), Gaps = 11/182 (6%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HH+  + A GFC  +++ +    I K   +  R+I  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAR 344
           IS+H FE G ++P T  G  ++T      GFN      + G+ D    +   +V++P+ +
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 345 EFQPDLVIISSGFDAADGDSIGQCHVTPS-CYGHMTHMLKSLAKGNLCVVLEGGYNLDAI 403
           + +P+ +++  G D   GD   +  +T S    ++  +L++  + ++ ++  GGYN   +
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYNERVM 468

Query: 404 AR 405
           +R
Sbjct: 469 SR 470

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 111/229 (48%), Gaps = 21/229 (9%)

Query: 186 FNNDSFASAKLPV------GGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLF 238
            ++D +  A LP+      G ++   +A    R + ++++    G HHA    A GFC  
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACL-RHERAISINWDGGRHHASRSRASGFCYI 234

Query: 239 SNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 298
           +++A+  + + +     +RRI  +D+D+HH +G ++AF     V  IS+H  E G ++PG
Sbjct: 235 NDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPG 290

Query: 299 TINGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGF 357
           T  G   +   GK       +  PV  G+ D       ++V+MP  R   P++++I  G 
Sbjct: 291 T--GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGG 343

Query: 358 DAADGDSIGQCHVT-PSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
           D   GD   +  +T      ++ ++++     N+ ++  GGYN   ++R
Sbjct: 344 DGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYNERLMSR 392

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 103/211 (48%), Gaps = 14/211 (6%)

Query: 198 VGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESV 256
           V G+  +    ++   + S+A+    G HHA    A GFC  +++ +  + I KN     
Sbjct: 187 VTGATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GF 243

Query: 257 RRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFN 316
           + I  +D+D+HHG+G QKAF     V  +SLH FE G ++P T + Q     E K     
Sbjct: 244 KNISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCTGSLQ-----EAKAGSSI 297

Query: 317 CNITWPVGGVGDAEYIWAFEQ-VVMPMAREFQPDLVIISSGFDAADGDSIGQCHVT-PSC 374
            NI  P+    D  ++    + +++P+  + +P++++I  G D   GD   +  +T    
Sbjct: 298 VNI--PLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDL 355

Query: 375 YGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            G +  ++ +    ++ ++  GGYN   ++R
Sbjct: 356 SGAIMKLINTFPSCSVVLLGGGGYNEKVMSR 386

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 93/183 (50%), Gaps = 13/183 (7%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HHA  Q A GFC  ++V +  + + K     + +I  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYI-WAFEQVVMPMA 343
           IS+H +E G ++PGT  G  +   +GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 344 REFQPDLVIISSGFDAADGDSIGQCHVTPSCYGH-MTHMLKSLAKGNLCVVLEGGYNLDA 402
           +   PD++II  G D   GD   +  +T       + +++K   + ++ ++  GGYN   
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYNDLL 380

Query: 403 IAR 405
           ++R
Sbjct: 381 MSR 383

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 100/216 (46%), Gaps = 19/216 (8%)

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
           ++  G ++   K +V      ++ +    G HHA  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
              ++I  LD+D+HHG+G +KAF     +  ISLH FE G ++PG        TG    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 314 GFNCNITWPVG-GVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTP 372
           G    I  P+  G+ D       +Q+++P       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 373 SCYGHMTHMLKSLAKGNLCVVL---EGGYNLDAIAR 405
              G    ++  + K + C ++    GGYN   ++R
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYNELLVSR 389

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 103/210 (49%), Gaps = 14/210 (6%)

Query: 199 GGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVR 257
           G S+     + +   + ++A+    G HHA    A GFC  +++ I  + + K   + + 
Sbjct: 196 GASLMLSDFIEKSSSQRTIAINWDGGRHHAIKNKASGFCYINDIVILIQKLRK---KGIS 252

Query: 258 RIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNC 317
           ++  +D+D+HHG+G +KAF     +  IS+H +E G ++P T  G  + T  GK      
Sbjct: 253 KVSYIDFDLHHGDGVEKAFRYSSNIQTISMHMYEPG-FFPCT--GSLEDTLNGKNI---- 305

Query: 318 NITWPV-GGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYG 376
            +  P+  GV D        +++ P+     P++++I  G D   GD   +  +T S   
Sbjct: 306 -VNVPLYHGVDDNYMTEIVNELIKPLIERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLT 364

Query: 377 -HMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
            ++ ++++   K ++ ++  GGYN   ++R
Sbjct: 365 RNIQNLIEWFPKSDIILLGGGGYNELVMSR 394

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 101/215 (46%), Gaps = 15/215 (6%)

Query: 194 AKLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNY 252
            ++  G +I+  +     R + +++V    G HHA    A GFC  +++AI  + + +  
Sbjct: 193 CQVVTGATIKLAR-YASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR-- 249

Query: 253 PESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKG 312
              + +I  LD+D+HHG+G ++AF     V  IS+H +E G ++PGT  G       G+ 
Sbjct: 250 -RGIHKISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRN 305

Query: 313 EGFNCNITWPV-GGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVT 371
                 +  PV  G+ D        +VV+P      P++VII  G D   GD   +  +T
Sbjct: 306 I-----VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLT 360

Query: 372 -PSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIAR 405
                  +  +++     N+ ++  GGYN   ++R
Sbjct: 361 LKGLTDTIMKVVEDFPSSNIVLLGGGGYNEKLMSR 395

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 89/183 (48%), Gaps = 14/183 (7%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HH+    A GFC  +++ +A + + +N+      I  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPV-GGVGDAEYIWAFEQVVMPMA 343
           ISLH  E G ++PGT + +  Q G          I  P+  G  D   +   E VV+P  
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-------INIPLRHGADDDCLMKITESVVIPCI 349

Query: 344 REFQPDLVIISSGFDAADGDSIGQCHVT-PSCYGHMTHMLKSLAKGNLCVVLEGGYNLDA 402
           ++  P +++I  G D   GD   +  +T       +  +L SL   ++ ++  GGYN   
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRV 409

Query: 403 IAR 405
           ++R
Sbjct: 410 MSR 412

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 128/271 (47%), Gaps = 37/271 (13%)

Query: 144 RDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPV----- 198
           R A E E+ +V S    D + + ST+ +  LL            +D      LP+     
Sbjct: 131 RTALEAELSDVESG---DEVTRRSTLAKFNLL------------DDCPIFPYLPLYCYVS 175

Query: 199 -GGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESV 256
            G ++   + ++EG  + ++A+    G HH+    A GFC  +++A+    + +     V
Sbjct: 176 TGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---GV 231

Query: 257 RRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFN 316
            RI  +D+D+HHG+G +KAF    +V  ISLH +E G ++P   +G  +    GK     
Sbjct: 232 DRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFP--CSGSLEDNSSGKSI--- 285

Query: 317 CNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYG 376
            NI   + G+ D+      +++++P   + QP++++I  G D   GD   +  +  S  G
Sbjct: 286 VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQL--SIKG 342

Query: 377 HMTHMLKSLAKGNLCVVL--EGGYNLDAIAR 405
             + +   + + N  +VL   GGYN   ++R
Sbjct: 343 LTSTITSLIEQFNCHIVLLGGGGYNNLLMSR 373

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 93/183 (50%), Gaps = 13/183 (7%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HHA  Q A GFC  ++V +  + + K     + +I  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYI-WAFEQVVMPMA 343
           IS+H +E G ++PGT  G  D +  GK       +  P+    D  Y+     +++ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 344 REFQPDLVIISSGFDAADGDSIGQCHVTPSCYGH-MTHMLKSLAKGNLCVVLEGGYNLDA 402
            +  P+++II  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN   
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYNDLL 378

Query: 403 IAR 405
           ++R
Sbjct: 379 MSR 381

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 92/183 (50%), Gaps = 13/183 (7%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HHA  Q A GFC  ++V +  + + K     + +I  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAF-EQVVMPMA 343
           IS+H +E G ++PGT  G    + + K       +  P+    D  Y+     ++V P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 344 REFQPDLVIISSGFDAADGDSIGQCHVTPSCYGH-MTHMLKSLAKGNLCVVLEGGYNLDA 402
              +P+ +II  G D   GD   +  +T       + +++KS  + ++ ++  GGYN   
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLL 378

Query: 403 IAR 405
           ++R
Sbjct: 379 MSR 381

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 91/185 (49%), Gaps = 17/185 (9%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HHA  + A GFC  +++ +    I K   +  +R+  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYIWAFEQVVMPMA 343
           IS+H FE G ++P +  G  +   +GK      NI  P+  G+ D        QVV+P+ 
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 344 REFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVL---EGGYNL 400
               P ++II  G D   GD   +  +T    G   ++LK + +   C ++    GGYN 
Sbjct: 304 DRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYNP 361

Query: 401 DAIAR 405
             ++R
Sbjct: 362 TVMSR 366

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 101/214 (47%), Gaps = 16/214 (7%)

Query: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYP 253
           ++ VGG++   + +       S+A+    G HHA    A GFC  +++ +  +++ +   
Sbjct: 164 QVIVGGTLSLLQHI--DHQTPSIAINWDGGRHHALKHYASGFCYVNDIVLLIQSLRR--- 218

Query: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313
           +  +R+  +D+D+H+G+G  KAF   + V  IS+H +E G ++PGT  G  ++T   K  
Sbjct: 219 KGWKRVTYIDFDLHYGDGVAKAFRFSENVQTISVHLYEPG-FFPGT--GSLEETRNSKQM 275

Query: 314 GFNCNITWPV-GGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTP 372
                +  PV  G+ D   +     V+ P+   F  + ++I  G D   GD   +  ++ 
Sbjct: 276 -----VNLPVLHGMDDKYLLELISSVITPLIETFNAECIVIQCGSDGLSGDKYNEWQLSI 330

Query: 373 SCYGHMTHMLKSLAKGNLCVVL-EGGYNLDAIAR 405
               H    +  + +     +L  GGYN   ++R
Sbjct: 331 RGLTHAIISIMDMFRDKQVFLLGGGGYNELLVSR 364

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 97/207 (46%), Gaps = 19/207 (9%)

Query: 198 VGGSIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAIAAKNILKNYPESV 256
           V G+  A    +     ++LAV    G HHA    A GFC  +++A+  + + +   +  
Sbjct: 165 VAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGF 221

Query: 257 RRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFN 316
            R+  +D+D+HHG+G + AF     V   SLH FE G ++PG        TG  K    N
Sbjct: 222 LRVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTDN 272

Query: 317 CNITWP-VGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCY 375
             +  P + GV D+      + +V P  +   P+++II  G D   GD  G+  +  S +
Sbjct: 273 SVLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIH 330

Query: 376 GHMTHMLKSLAK---GNLCVVLEGGYN 399
           G   ++LK +       + ++  GGYN
Sbjct: 331 GLTRNILKLVQAHKFKKIALLGGGGYN 357

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/336 (24%), Positives = 138/336 (41%), Gaps = 77/336 (22%)

Query: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLA-----VVRPPGHHAEPQAAGGF 235
           GD +Y   ++  + +  +G       ++ +G V    A      +RPPGHH+      GF
Sbjct: 145 GD-IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGF 203

Query: 236 CLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ---------------------- 273
           CL +N  IA +     Y   V   +ILD+D+HHG+GTQ                      
Sbjct: 204 CLLNNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYN 261

Query: 274 ---KAFYDDDRVLYISLHRFELGKYYPGTIN-GQYDQTGEGKG---EGFNCNITWPVGGV 326
              K F +  +V Y S+H       +P  +N    D+  +      +  + NI W +  +
Sbjct: 262 EFDKKFAEFPKVGYFSMHDI---NSFPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLL 317

Query: 327 ---GDAEY----------IWA-----FEQVVMPMAREFQP--DLVIISSGFDAADGDSIG 366
               + E+          ++A     F+   + MA++ +P   LV++S+GFDA++ + + 
Sbjct: 318 PYETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVS 377

Query: 367 Q----CHVTPSCYGHMTHMLKSLAK----GNLCVVLEGGYNLDAIARSALSVAKILIGXX 418
                 +V  S Y   T     LA+    G +  +LEGGY+  AIA    S    LIG  
Sbjct: 378 MQRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIASGVFSH---LIG-- 432

Query: 419 XXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRR 454
                         + +++ +++R     WK +K R
Sbjct: 433 ---LQNQNWITEWGSAQVVKEIVRGCKPRWKPYKTR 465

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 94/188 (50%), Gaps = 24/188 (12%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HHA    A GFC  +++ +  + + K   +   ++  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 285 ISLHRFELGKYYP--GTINGQYDQTGEGKGEGFNCNITWPV-GGVGDAEYIWAFEQVVMP 341
           ISLH +E G ++P  G++ G           GF+  +  P+  G+ D+      +QVV P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 342 MAREFQPDLVIISSGFDAADGDSIGQCHVT----PSCYGHMTHMLKSLAKGNLCVVLEGG 397
           + +   P++++I  G D   GD+  +  ++      C   +  ++    + ++ ++  GG
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGG 368

Query: 398 YNLDAIAR 405
           YN   ++R
Sbjct: 369 YNPTLMSR 376

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 83/183 (45%), Gaps = 26/183 (14%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 284
           HHA    A GFC  +++ +  + + KN      R+  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 285 ISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVG-----GVGDAEYIWAFEQVV 339
            SLH FE G ++PGT            G   NC  T  V      G+ D       + ++
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 340 MPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSL---AKGNLCVVLEG 396
           +P   +  P++++I  G D   GD   +  +T   +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 397 GYN 399
           GYN
Sbjct: 357 GYN 359

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 115/292 (39%), Gaps = 63/292 (21%)

Query: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 273
           +   +RPPGHH +     GFCL +N  I+ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 274 -----------------------KAFYDDDRVLYISLH---RFELGKYYPGTINGQYDQT 307
                                  K F +  +V Y S+H    F     Y   +N +   T
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 308 GEGKGEGFNC-NITW-PVGGVGDAEYIWA-------------FEQVVMPMAREFQP--DL 350
               G   N  NI   P     D + ++              F      MA+E +P   L
Sbjct: 305 CIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGL 364

Query: 351 VIISSGFDAADGDSIG----QCHVTPSCYGHMTHMLKSLA----KGNLCVVLEGGYNLDA 402
           V+IS+GFDA++ +         +V  + Y   T     LA    +G +  +LEGGY+  A
Sbjct: 365 VVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDKA 424

Query: 403 IARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRR 454
           +     +    LIG                  +++ +++R    +WK +K +
Sbjct: 425 LTSGVFAH---LIGFQNQNWINEWGSE-----QVVKEIVRGCKPHWKPYKTK 468

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 114/305 (37%), Gaps = 64/305 (20%)

Query: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 273
           +   +RPPGHH+      GFCL +N  IA +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 274 ---------------KAFYDD--------DRVLYISLHRF-----ELGKYYPGTING--- 302
                           A YDD         +V Y SLH       E G  +  +I     
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 303 -----------QYDQTGEGKGEGFNCNITWPVGGV-GDAEYIWAFEQVVMPMAREFQPDL 350
                          T     E FN         +   A+      Q  M    +    L
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYKGL 361

Query: 351 VIISSGFDAADGDSIGQ----CHVTPSCYGHMTHMLKSLA----KGNLCVVLEGGYNLDA 402
           +IIS+GFDA++ + +       HV  S Y   T     LA    +G L  +LEGGY+  A
Sbjct: 362 IIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYSDAA 421

Query: 403 IARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFK-RRYGNAGCN 461
           +     S    LIG                + ++I +V R     WK +K +R  +   N
Sbjct: 422 LVSGVFSH---LIG-----MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTKRSRDVIRN 473

Query: 462 FKDEI 466
           + +E+
Sbjct: 474 WAEEV 478

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/337 (23%), Positives = 134/337 (39%), Gaps = 80/337 (23%)

Query: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLA-----VVRPPGHHAEPQAAGGF 235
           GD +Y +  + A+ +  +G       ++ +G  +  +A      VRPPGHH+      GF
Sbjct: 146 GD-IYLSQQTIAALEGSIGALETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGF 204

Query: 236 CLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ---------------------- 273
           CL +N  IA +     +  +V   ++LD+D+HHG+GTQ                      
Sbjct: 205 CLLNNAHIAIEYAADTF--NVTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDE 262

Query: 274 --KAFYDDDRVLYISLHRF-----ELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVG-- 324
             K F +  +V Y S+H       ELG  Y    N +   T        N    W V   
Sbjct: 263 FGKKFAEFPKVGYFSMHDINSFPTELG--YATKENIKNASTCIMNAHDLNI---WNVHLS 317

Query: 325 ---------GVGDAEYIWAFEQV----------VMPMAREFQPDLVIISSGFDAADGDSI 365
                     +  ++Y   F +           +    ++F+  LV+IS+GFDA++ +  
Sbjct: 318 HYETEEDFVKLYQSKYRSLFAKADEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQP 376

Query: 366 G-QCH--VTPSCYGHM-----THMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGX 417
             Q H    P+C+ +M       + +    G +  V+EGGY+  AI+    S    LIG 
Sbjct: 377 SMQRHGVNVPTCFYNMFTKDALKLAQMHTSGKVLSVMEGGYSDGAISSGVFS---HLIG- 432

Query: 418 XXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRR 454
                          + +++ ++IR     WK +K +
Sbjct: 433 ----LQNQNWINEWGSAQVVKEIIRGCKPQWKPYKTK 465

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 98/252 (38%), Gaps = 61/252 (24%)

Query: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 273
           +   +RPPGHH       GFCL +N  IA +   + Y   V   +ILD+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 274 -------------------KAFYDD--------DRVLYISLH---RFELGKYYPGTINGQ 303
                              K  YDD         +V Y S+H    F     Y    N +
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMHDINSFPTESGYATKDNIK 303

Query: 304 YDQTGEGKGEGFNC-NI---TWPV----GGVGDAEYIWAFEQV----------VMPMARE 345
              T        N  N+   TW        +   +Y   F +           +  M + 
Sbjct: 304 NASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKP 363

Query: 346 FQPDLVIISSGFDAADGDSIG----QCHVTPSCYGHMTHMLKSLAK----GNLCVVLEGG 397
           F+  LV+IS+GFDA++ +         +V  S Y   T     LA+    G +  VLEGG
Sbjct: 364 FK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGG 422

Query: 398 YNLDAIARSALS 409
           Y+  AIA    S
Sbjct: 423 YSDKAIASGVFS 434

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 112/287 (39%), Gaps = 61/287 (21%)

Query: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGF 235
           GD +Y ++ +  + +  +G       ++ EG     V N +  V+RPPGHH       GF
Sbjct: 145 GD-IYLSSKTIEALQGSIGALETGVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGF 203

Query: 236 CLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ---------------------- 273
           CL +N  ++ +     Y   +   ++LD+D+HHG+GTQ                      
Sbjct: 204 CLLNNAHVSIEYAHDTY--GITHAVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYD 261

Query: 274 ---KAFYDDDRVLYISLH---RFELGKYYPGTINGQYDQTGEGKGEGFNC-NI---TWPV 323
              K F +  RV Y S+H    F     Y    N +   T    G   N  N+    W  
Sbjct: 262 EFGKKFAEFPRVGYFSMHDINSFPTESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWET 321

Query: 324 GG-------------VGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIG-QCH 369
                             A+  +   ++ M    +    LV+IS+GFDA++ + +  Q H
Sbjct: 322 EEDFNKLYQSKYRTLFAKADEFFKNAKIEMSAKGKKFKGLVVISAGFDASEFEQVSMQRH 381

Query: 370 ---VTPSCYGHMTHMLKSLAK----GNLCVVLEGGYNLDAIARSALS 409
              V  + Y   T     LA+    G +  VLEGGY+  AI     +
Sbjct: 382 GVNVPTNFYTMFTKDALKLAQMHSEGKVLSVLEGGYSDKAITSGVFA 428

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 115/302 (38%), Gaps = 69/302 (22%)

Query: 209 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHH 268
           VE     +   +RPPGHH+      GFCL +N  IA +     Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 269 GNGTQ-------------------------KAFYDDDRVLYISLHRF-----ELGKYYPG 298
           G+GTQ                         K F +  +V Y SLH       ELG  Y  
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELG--YAT 293

Query: 299 TINGQYDQTGEGKGEGFNC-NITWPVGGVGDA-----------------EYIWAFEQVVM 340
             N +   T        N  N+        +A                 EY    +Q + 
Sbjct: 294 KENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQNMR 353

Query: 341 PMAREFQPDLVIISSGFDAADGDSIGQ----CHVTPSCYGHMTHMLKSLAK----GNLCV 392
            + + F+  LV+IS+GFDA++ +         +V    Y   T     LA+    G L  
Sbjct: 354 ALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGKLLS 412

Query: 393 VLEGGYNLDAIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFK 452
           VLEGGY+  AI+    +    LIG                + +++ +++R     WK +K
Sbjct: 413 VLEGGYSDGAISSGVFA---HLIG-----LQNQNWINEWGSAQVVKEIVRGCKPQWKPYK 464

Query: 453 RR 454
            +
Sbjct: 465 TK 466

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 173 ELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGR-----VKNSLAVVRPPGHHA 227
           E+ ++   GD +Y N+D+  + K  +G       ++  G         +   +RPPGHH 
Sbjct: 138 EVPESWNAGD-IYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHC 196

Query: 228 EPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ 273
                 GFCL +N  I  +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 197 HVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 108/293 (36%), Gaps = 65/293 (22%)

Query: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ-- 273
           +   +RPPGHH       GFCL +N  IA +     Y   +   +ILD+D+HHG+GTQ  
Sbjct: 185 AFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDI 242

Query: 274 -----------------------KAFYDDDRVLYISLH---RFELGKYYPGTINGQYDQT 307
                                  K F +  +V Y S+H    F     Y    N +   T
Sbjct: 243 CWKRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMHDINSFPTESQYATKENIRNAST 302

Query: 308 GEGKGEGFNC-NI---TWPVGGVGDA--------------EYIWAFEQVVMPMAREFQPD 349
                   N  NI    W      D               E+    ++ +  + + FQ  
Sbjct: 303 CVMNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-G 361

Query: 350 LVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLA--------KGNLCVVLEGGYNLD 401
           LV+IS+GFDA++ +       + +   H   M    A         G +  ++EGGY+  
Sbjct: 362 LVVISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDK 421

Query: 402 AIARSALSVAKILIGXXXXXXXXXXXXXXXXAIEIIDKVIRLQSKYWKCFKRR 454
           AIA    S    LIG                  +++ +++R    +WK +K +
Sbjct: 422 AIASGVFSH---LIGLQNQNWIKEWGSE-----QVVKEIVRGCKPHWKPYKTK 466

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 209 VEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHH 268
           VE     +   +RPPGHH+      GFCL +N  IA +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 269 GNGTQ 273
           G+GTQ
Sbjct: 234 GDGTQ 238

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 126/316 (39%), Gaps = 65/316 (20%)

Query: 151 ILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKL--PVGGSIEACKAV 208
           +L+VH       + +   M   +LLK   +    + + D + S+K    + G+I A +  
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 209 VEGRVKN---------SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRI 259
           V+   K          +   +RPPGHH       GFCL +N  +A +     Y  +V  +
Sbjct: 170 VDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 260 MILDWDIHHGNGTQ------------------------KAFYDDDRVLYISLH---RFEL 292
           ++LD+D+HHG+GTQ                        K F +  +V Y S+H    F  
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFPT 287

Query: 293 GKYYPGTINGQYDQTGEGKGEGFNC-NI---TWPVGGVGDAEY------IWA-----FEQ 337
              +    N +   T        N  NI    W      +  Y      ++A     F  
Sbjct: 288 ESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFRS 347

Query: 338 VVMPMAREFQP--DLVIISSGFDAADGDSIG----QCHVTPSCYGHMTHMLKSLAK---- 387
             + M ++ +P   LV+IS+GFDA++ +         +V  S Y   T     LA+    
Sbjct: 348 AKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCH 407

Query: 388 GNLCVVLEGGYNLDAI 403
           G +  ++EGGY+  AI
Sbjct: 408 GKVLSLMEGGYSDKAI 423

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 73/151 (48%), Gaps = 12/151 (7%)

Query: 225 HHAEPQAAGGFCLFSNVAIAAKNILKNYPESV---RRIMILDWDIHHGNGTQKAFYDDDR 281
           HHA    A GFC  +++ ++  N L+  P      R++  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 282 VLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVG-GVGDAEYIWAFEQVVM 340
           +  IS+H FE G +YP T   ++     GK +  N  I  PV  G+ ++        +++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 341 PMAREFQPDLVIISSGFDAADGDSIGQCHVT 371
           P+    Q D ++I  G D  + D   +  +T
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT 348

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 113/291 (38%), Gaps = 60/291 (20%)

Query: 171 REELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEG----RVKN-SLAVVRPPGH 225
           +E  + A+     +Y ++ +  + +  +G    A  ++ +G     + N +   +RPPGH
Sbjct: 132 KEVEVPASWNAGDIYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGH 191

Query: 226 HAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ------------ 273
           H       GFCL +N  +A +     +   V    ILD+D+HHG+GTQ            
Sbjct: 192 HCHVATPSGFCLLNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQDICWKRAGFRPD 249

Query: 274 -------------KAFYDDDRVLYISLH---RFELGKYYPGTINGQYDQTGEGKGEGFNC 317
                        K F +  RV Y S+H    F     Y    N +   T        N 
Sbjct: 250 EEDEDSPGYDSFGKKFAEYPRVGYFSMHDINSFPTESGYATKENVKNASTCIMNAHDVNI 309

Query: 318 -NITW-PVGGVGDAEYIWA-------------FEQVVMPMAREFQP--DLVIISSGFDAA 360
            NI   P     D   ++              F+Q  + MA + +P   LV+ISSGFDA+
Sbjct: 310 WNIHLSPWETEEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDAS 369

Query: 361 DGDSIG-QCHVTPSCYGHMTHMLKSLAK-------GNLCVVLEGGYNLDAI 403
           + +    Q H T       T   K   K       G +  ++EGGY+  AI
Sbjct: 370 EFEQTSMQRHGTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAI 420

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 114/311 (36%), Gaps = 91/311 (29%)

Query: 173 ELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLA-----VVRPPGHHA 227
           E+ K    GD +Y ++ +  + +  +G        +  G     ++     VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 228 EPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ-------------- 273
                 GFCL +N  I+ +     Y   V    ILD+D+HHG+GTQ              
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRAGFKPDGA 252

Query: 274 -----KAFYDD--------DRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNIT 320
                +  YDD         +V Y S+H           IN    ++G    E    NI 
Sbjct: 253 TREENEEPYDDFGKRTAAFPKVGYFSMH----------DINSFPTESGYATSE----NIR 298

Query: 321 WPVGGVGDAEYI---------WAFEQVVMPMAR-------------------EFQPD--- 349
                + D+  +         WA E+  M + R                   E Q     
Sbjct: 299 NASTCIMDSHDLNIWNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTP 358

Query: 350 ---LVIISSGFDAADGDSIG----QCHVTPSCYGHMTHMLKSLA----KGNLCVVLEGGY 398
              LV+IS+GFDA++ +         +V    Y   T  +  LA    +G +  V+EGGY
Sbjct: 359 FKGLVVISAGFDASEFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGY 418

Query: 399 NLDAIARSALS 409
           +  AI     +
Sbjct: 419 SDKAITSGVFA 429

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 13/134 (9%)

Query: 151 ILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKL--PVGGSIEACKAV 208
           +L+VH       + +   M   +LLK   +    + + D + S+K    + G+I A +  
Sbjct: 110 VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIETG 169

Query: 209 VEGRVK---------NSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRI 259
           V+   K          +   +RPPGHH       GFCL +N  +A +     Y   V  +
Sbjct: 170 VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHV 227

Query: 260 MILDWDIHHGNGTQ 273
           ++LD+D+HHG+GTQ
Sbjct: 228 VVLDFDLHHGDGTQ 241

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 63/134 (47%), Gaps = 13/134 (9%)

Query: 151 ILEVHSKEHYDFIEKTSTMNREELLKA------TEKGDSVYFNNDSFASAKLPVGGSIEA 204
           +L+VH       + +   M   +LLK       T     +Y ++ +  + +  +G     
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 205 CKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRI 259
             ++ EG     + N +   +RPPGHH       GFCL +N  +A +     Y  +V  +
Sbjct: 170 VDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 260 MILDWDIHHGNGTQ 273
           ++LD+D+HHG+GTQ
Sbjct: 228 VVLDFDLHHGDGTQ 241

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ 273
           +   +RPPGHH+      GFCL +N  IA +     Y  +V   ++LD+D+HHG+GTQ
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQ 242

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 8/98 (8%)

Query: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGF 235
           GD +Y ++ +  + +  +G    A  ++ +G     + N +   +RPPGHH       GF
Sbjct: 145 GD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGF 203

Query: 236 CLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ 273
           C+ +N  +A +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 204 CVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 8/106 (7%)

Query: 173 ELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEG----RVKN-SLAVVRPPGHHA 227
           E+ ++   GD +Y ++ +  + +  +G       ++ +G     + N +   +RPPGHH 
Sbjct: 137 EVPESWNAGD-IYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAFVAIRPPGHHC 195

Query: 228 EPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ 273
                 GFCL +N  +A +     Y   V  + +LD+D+HHG+GTQ
Sbjct: 196 HFATPSGFCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 8/98 (8%)

Query: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEG----RVKN-SLAVVRPPGHHAEPQAAGGF 235
           GD +Y ++ +  + +  +G       ++ +G     + N +   +RPPGHH       GF
Sbjct: 147 GD-IYLSSKTIKALQGTIGAIETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGF 205

Query: 236 CLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ 273
           CL +N  +A +     Y  +V  +++LD+D+HHG+GTQ
Sbjct: 206 CLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQ 241

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 8/98 (8%)

Query: 181 GDSVYFNNDSFASAKLPVGGSIEACKAVVEG----RVKNSLAV-VRPPGHHAEPQAAGGF 235
           GD +Y  + +  + +  +G       ++  G     + N + V +RPPGHH       GF
Sbjct: 143 GD-IYLTSRTIEALQGTIGAVETGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGF 201

Query: 236 CLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQ 273
           CL +N  I  +     Y   V   +ILD+D+HHG+GTQ
Sbjct: 202 CLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQ 237

>TDEL0A06990 Chr1 (1223513..1223827) [315 bp, 104 aa] {ON} Anc_6.285
           YPL250C
          Length = 104

 Score = 30.8 bits (68), Expect = 4.0,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 461 NFKDE-INESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVY 517
           +F+DE + E L+    PL   + + ++ T+ +D+K+A  P++ P+ P+  V    +V+
Sbjct: 31  DFEDEQLYEELLETQ-PLVVPVDDDRIFTVDEDYKYAEQPVVAPQRPRKAVGFDEDVF 87

>CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P38818 Saccharomyces cerevisiae
           YHR109w CTM1 cytochrome c methyltransferase
          Length = 551

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 246 KNILKNYPESVRRIMILDWDIHHGNGTQK-AFYDDDR-----VLYISLHRFELGKYYPGT 299
           +N + NY  +   + ILD+ ++HG+ T + A+YD DR     +LY+ L     GK  P T
Sbjct: 208 ENYMDNYVVTPSLVPILDY-VNHGDKTSRNAYYDVDRRKGDIILYLDLTVVNPGKLKPNT 266

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,709,013
Number of extensions: 3629349
Number of successful extensions: 10866
Number of sequences better than 10.0: 114
Number of HSP's gapped: 10955
Number of HSP's successfully gapped: 123
Length of query: 726
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 609
Effective length of database: 40,065,477
Effective search space: 24399875493
Effective search space used: 24399875493
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)