Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G037902.286ON49249223270.0
NDAI0G006602.286ON49649819930.0
TPHA0C034002.286ON49449617820.0
Suva_14.3252.286ON49049617590.0
TDEL0G021702.286ON48449517450.0
Kpol_1003.382.286ON49649717380.0
KAFR0H033102.286ON48849317370.0
Skud_14.3072.286ON49049617310.0
YNL022C2.286ON49049617230.0
KNAG0H020002.286ON49849817070.0
Smik_14.3092.286ON49049616810.0
SAKL0E07678g2.286ON47749516450.0
ZYRO0A01892g2.286ON46549416340.0
KLLA0E08361g2.286ON49149916260.0
TBLA0B069602.286ON50850816170.0
CAGL0M06941g2.286ON49250016090.0
Kwal_27.115322.286ON47949515630.0
Ecym_33252.286ON49649515640.0
KLTH0G10362g2.286ON52949415540.0
ADL215W2.286ON48449515070.0
ADL254W2.247ON6032791609e-11
KNAG0I018702.247ON6292481609e-11
KAFR0J009702.247ON6102431581e-10
SAKL0E08624g2.247ON6112791582e-10
Kpol_1002.1098.171ON6703041572e-10
CAGL0J10032g2.247ON6192791562e-10
ZYRO0A01562g2.247ON6172741536e-10
KLLA0F03399g2.247ON6192481528e-10
TPHA0H001508.171ON6493111528e-10
TBLA0E038502.247ON6322761528e-10
Kpol_1003.152.247ON6332191511e-09
KLTH0G09460g2.247ON6372791501e-09
NDAI0D010502.247ON6252791501e-09
NDAI0B018308.171ON6863141501e-09
NCAS0B043908.171ON6713041502e-09
Ecym_32842.247ON6062481492e-09
Kwal_23.48412.247ON6272811492e-09
AFR179C8.171ON7003031482e-09
NCAS0G030302.247ON4902741473e-09
KNAG0G015108.171ON6663021473e-09
KNAG0D020508.171ON6823031473e-09
TPHA0C031502.247ON6082191473e-09
Skud_14.2712.247ON6193021473e-09
Smik_14.2662.247ON6182481464e-09
Suva_2.978.171ON6703071464e-09
YNL061W (NOP2)2.247ON6182481464e-09
TDEL0C041502.247ON6142481456e-09
Suva_14.2802.247ON6202481446e-09
ZYRO0G08998g8.171ON6833031431e-08
TPHA0C028708.171ON6743031421e-08
Smik_2.928.171ON6743071412e-08
YBL024W (NCL1)8.171ON6843071384e-08
TDEL0B043908.171ON6733071366e-08
KLTH0H08096g8.171ON6883011367e-08
KAFR0B022208.171ON6863041341e-07
Skud_2.818.171ON6813071341e-07
Ecym_23538.171ON6903021332e-07
CAGL0K01991g8.171ON6722991332e-07
SAKL0H19448g8.171ON6913041313e-07
NCAS0B056408.171ON6593031313e-07
TBLA0A087408.171ON6863041251e-06
NDAI0B029808.171ON6793081117e-05
KLLA0F12562g8.171ON7043081109e-05
Kwal_14.20818.171ON272120850.053
Ecym_30036.1ON319109770.63
TBLA0H018805.370ON170849761.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G03790
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   900   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   772   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   691   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   682   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   676   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   674   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   673   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   671   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   668   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   662   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   652   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   638   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   634   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   630   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   627   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   624   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   606   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   607   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   603   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   585   0.0  
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    66   9e-11
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    66   9e-11
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    65   1e-10
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    65   2e-10
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    65   2e-10
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    65   2e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    64   6e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    63   8e-10
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    63   8e-10
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    63   8e-10
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    63   1e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    62   1e-09
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    62   1e-09
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    62   1e-09
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    62   2e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    62   2e-09
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    62   2e-09
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    62   2e-09
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    61   3e-09
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    61   3e-09
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    61   3e-09
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    61   3e-09
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    61   3e-09
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    61   4e-09
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    61   4e-09
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    61   4e-09
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    60   6e-09
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    60   6e-09
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    60   1e-08
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    59   1e-08
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    59   2e-08
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    58   4e-08
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    57   6e-08
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    57   7e-08
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    56   1e-07
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    56   1e-07
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    56   2e-07
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    56   2e-07
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    55   3e-07
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    55   3e-07
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    53   1e-06
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    47   7e-05
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    47   9e-05
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    37   0.053
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    34   0.63 
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    34   1.1  

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/492 (91%), Positives = 451/492 (91%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCDVEATKLEIQKKFPTRV 180
           LH                    NADSENDMTPVRWIRINPLRCDVEATKLEIQKKFPTRV
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCDVEATKLEIQKKFPTRV 180

Query: 181 ENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEND 240
           ENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEND
Sbjct: 181 ENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEND 240

Query: 241 VVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIKI 300
           VVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIKI
Sbjct: 241 VVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIKI 300

Query: 301 NVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXX 360
           NVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMN              
Sbjct: 301 NVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGDEEEE 360

Query: 361 XXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420
                  YNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVIDL
Sbjct: 361 VPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420

Query: 421 MLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSD 480
           MLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSD
Sbjct: 421 MLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSD 480

Query: 481 GGIGFFAVCFER 492
           GGIGFFAVCFER
Sbjct: 481 GGIGFFAVCFER 492

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/498 (74%), Positives = 414/498 (83%), Gaps = 8/498 (1%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE+VEQ++AKGRISGSLQTLV QSC +YKLKCNPKHVYAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMKKSGILD+IPK+KGKPMYSRLTLML+CHDLLFSK+KRIQMGK PIK YVLKHKSR
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176
           LH                    N DS  D+TPVRWIRINPLRC    DV A   E+ KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
           P RVENW+DIVPGSIYYDEYIP+L+GIHPQDKITSH LYKQGKIIIQDRASCFPAHIL+P
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSK-DPKIQIYAFEKNPERAKILDKMIKVAGCS 295
            ++D++ID CAAPGNKTTH ASYM  +  + DP +QIYAFEK+PERAKIL+KMIKVAGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 296 KNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXX 355
           KNI++ VGDFTK A P+K+KDVTGFIVDPSCSGSGIFGRK++DSLNR++ N         
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 356 XXXXXXX-XXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENE 414
                        YNK+EDLKTRL+KLSSFQFQV+KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 415 RVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIR 474
           RVV+DL+LDSKVKQWGWKVA +  VIPTWPRRGK+EEFEEVFR+D   +KC+ LA GCIR
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDD--PAKCQALADGCIR 478

Query: 475 ALPRSDGGIGFFAVCFER 492
           ALPR DGGIGFFAVCFER
Sbjct: 479 ALPRDDGGIGFFAVCFER 496

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/496 (65%), Positives = 399/496 (80%), Gaps = 8/496 (1%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLEF+E+EDAKG+ISGS+Q++V +SCK YK++ NPKH+YAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LE +MKKSGIL+ IPK+ GKP + RLT++L+CHDLLFSK+KRIQMGK P+K YVLK+K+ 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176
           L                     + D  ND+TPVRW RINP+R      VE    E++KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
           PTRV++WS I  G+IY+DE+IPNLFG+H +DKITSH LYKQGKIIIQDRASCFPAH+L+P
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296
            ++D+VID CAAPGNKTTHTA+Y++  PSKD KIQI+AFEK+PERAK+L KM++ AGC++
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXX 356
            I++NVGDFTKIA PEK+K+VTGFIVDPSCSGSGIFGRKFID+LN+KK            
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEG--EDVDEDDE 358

Query: 357 XXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416
                      ++K++DLKTRLSKL+SFQFQVVKHAM+FP A+K+VYSTCSIHAEENERV
Sbjct: 359 SESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418

Query: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476
           VIDL+LD  +K+ GW+VA R KVIPTWPRRG V+EF+EVFR+D    KC+E+AGGCIRAL
Sbjct: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDD--EEKCKEIAGGCIRAL 476

Query: 477 PRSDGGIGFFAVCFER 492
           P+ DGGIGFFAVCFER
Sbjct: 477 PKEDGGIGFFAVCFER 492

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/496 (69%), Positives = 397/496 (80%), Gaps = 11/496 (2%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCKRYKLK NPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMKK+ IL+EIPK+KGKP+++RLTL+L+CHDLL SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176
           LH                    + D  ND+ PVRWIRINPL+C    + E    E++KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
             +V+NWS++VPGSIY+DEYIPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHILHP
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296
             ND+VID C+APGNKTTHTASY+  EP KD KIQIYAFEK+PERAKIL KMIKVAGCS 
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXX 356
           NI +NVGDFTK+A PEK K VTGFIVDPSCSGSGIFGRKF DSLNR+K++          
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKID------EKDD 354

Query: 357 XXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416
                      +  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 355 EDDAVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERV 414

Query: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476
           VIDL+LD  V++WGWKVA R++V+P+WPRRGKVEEFEEVFR DG++   ++LA GCIRAL
Sbjct: 415 VIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFR-DGSAHDPQQLAEGCIRAL 473

Query: 477 PRSDGGIGFFAVCFER 492
           P+ DGGIGFFAVCF R
Sbjct: 474 PKEDGGIGFFAVCFVR 489

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/495 (65%), Positives = 384/495 (77%), Gaps = 14/495 (2%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE+VEQED KGR+SGS+QTLV +SC+RYKLK +PKH+YAV+DSCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEK+MK+S I D+IPK+KGKP+YSRLTL+LMCHDLL SK KRIQMGKLPIK YVLKHK+R
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC---DVEATKLEIQKKFP 177
           L+                      DS ND+TPVRWIRINPLRC   DVE    E+ KKFP
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKFP 180

Query: 178 TRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPD 237
            RV +WSDI  G++YYDE++PNLFG+HP+DKITSH LY+QGKIIIQDR+SCFPAHIL+P 
Sbjct: 181 QRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPG 240

Query: 238 ENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKN 297
           +NDVVID CAAPGNKTTH A++++ E +++   +IYAFEK+P RA IL KM  VAGC + 
Sbjct: 241 KNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQT 300

Query: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXX 357
           ++I+VGDFTK+A+P  +KDVTG IVDPSCSGSGIFGRK +DS N  K             
Sbjct: 301 VEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIPDEE 360

Query: 358 XXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417
                         +D+  RLSKL+SFQFQVVKHAMS PNAKKIVYSTCSIHAEENERVV
Sbjct: 361 EKMVG---------DDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVV 411

Query: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477
           IDL+LD  +K+WGWKVA R +VIP WPRRGKV+EFE+VFR+D    KC ELA GCIRALP
Sbjct: 412 IDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDD--PVKCNELADGCIRALP 469

Query: 478 RSDGGIGFFAVCFER 492
           + DGGIGFFAVCF+R
Sbjct: 470 QEDGGIGFFAVCFKR 484

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/497 (67%), Positives = 397/497 (79%), Gaps = 7/497 (1%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M+FYRD+TWVLE++E+E+AK +ISGSLQ LV +SCK+YK+K NP+HVYA + SCWK KPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMK+SGILD+IP +KGKP + RLTL+L+CHDLL SK+KRIQMGK PIKTY+LK+K+R
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCD----VEATKLEIQKKF 176
           LH                    + +S +D+TPVRWIRINP+R      +E    E+ KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
           PTRV +WSDIVPG+IY+D+YIPNLFG+H +DKITSH LYK GK+IIQDRASCFPAHIL+P
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296
            +ND+VID CAAPGNKTTHTASY++  P KD   QIYAFEK+PERAKIL  MIKVAGCS 
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXX 356
            I++NVGDFTKIA PEK+++VTGFIVDPSCSGSGIFGRK++DS+N+KK            
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 357 XXXXXXXXXXXYN-KREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENER 415
                      ++ KR+DLKTRLSKL+SFQFQVVKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 416 VVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRA 475
           VVIDL+LD KV++WGWKVAPRS+VIPTWPRRG   EF +VFR++    KC+ELA GCIR 
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDE--DEKCQELADGCIRV 478

Query: 476 LPRSDGGIGFFAVCFER 492
           LP+ DGGIGFFAVCFER
Sbjct: 479 LPKEDGGIGFFAVCFER 495

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/493 (67%), Positives = 387/493 (78%), Gaps = 8/493 (1%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           MEFYRDATWVLE++EQ+D+KGRISGSLQ+LV +SC++YKLK NPKH+YAVLDSCWKYKP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVM KSGIL +IPK+KGKP+Y+RLTL+L+ HDLL SK KRIQMGK PIK +VL++KSR
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC-DVEATKLEIQKKFPTR 179
           LH                      DS ND+TPVRW RINPLRC D  A   E++KKFP R
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASAVMKELEKKFPQR 180

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           VE+W  IVPGSIY+DE+IP LFGIHPQDKITSH LYKQG+IIIQDRASCFPAHIL+P   
Sbjct: 181 VESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLE 240

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           D +ID C+APGNKTTH ASYM      D  ++I+AFEK+PERAK+L KMIKVAGCSK I 
Sbjct: 241 DKIIDACSAPGNKTTHVASYMFGNGLVD-DVRIFAFEKDPERAKVLQKMIKVAGCSKQIS 299

Query: 300 INVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXX 359
           +NVGDFTK+A P K+ DVTGFIVDPSCSGSGIFGRK+IDSLNR+K               
Sbjct: 300 VNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQE 359

Query: 360 XXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVID 419
                     +  +L+ RLSKLSSFQFQVVKHAMSFP AK+IVYSTCSIHAEENERV +D
Sbjct: 360 EMAE-----KENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALD 414

Query: 420 LMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRS 479
           L+LD KVKQWGWK+A R  VIP WPRRG V EF+E+FR D  +S+C+E+A GCIRALPR 
Sbjct: 415 LLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFR-DKTASECQEMADGCIRALPRE 473

Query: 480 DGGIGFFAVCFER 492
           DGGIGFFA+CFER
Sbjct: 474 DGGIGFFAICFER 486

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/496 (68%), Positives = 390/496 (78%), Gaps = 11/496 (2%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCK+YKLK NPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMKK+ IL++IPK+KGKP++SRLTL+L+CHDLL SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176
           LH                    + D  ND+ PVRWIRINPL+C    D E    E++KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
             +V  WSD+VPGSIYYDEYIPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHILHP
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296
             +D+VID C+APGNKTTHTASY+   P KD  I+IYAFEK+PERAKIL KM+KVAGCS 
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXX 356
           NI + VGDFTK+A P+K K  TGFIVDPSCSGSGIFGRKF DSLN++KM+          
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMD------EKDD 354

Query: 357 XXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416
                      +  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 355 DNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414

Query: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476
           VIDL+LD  V++WGWKVAPR++VIP+WPRRGKVEEF EVFR DG +    +LA GCIRAL
Sbjct: 415 VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFR-DGTAHNPRQLAEGCIRAL 473

Query: 477 PRSDGGIGFFAVCFER 492
           P+ DGGIGFFAVCFER
Sbjct: 474 PKEDGGIGFFAVCFER 489

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/496 (68%), Positives = 395/496 (79%), Gaps = 11/496 (2%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCKRYKLK NPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMKK+ IL++IPK+KGKP++SRLTL+L+CHDLL SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176
           LH                    + D  ND+ PVRWIRINPL+C    + E    E++KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
             +V+ WS++VPGSIYYDE+IPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296
             +D+VID C+APGNKTTHTASY+  EP KD   +IYAFEK+PERAK+L KMIK+AGCS 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXX 356
           NI +NVGDFTK+A PEKYKDVT FIVDPSCSGSGIFGRKF DS NR+K++          
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKID------DKDD 354

Query: 357 XXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416
                      +  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 355 DGGIVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414

Query: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476
           VIDL+LD  V++WGWKVAP+ +VIP+WPRRGKVEEFEEVFR DG +   ++LA GCIRAL
Sbjct: 415 VIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFR-DGVTYDPQQLAEGCIRAL 473

Query: 477 PRSDGGIGFFAVCFER 492
           P+SDGGIGFFAVCFER
Sbjct: 474 PKSDGGIGFFAVCFER 489

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/498 (64%), Positives = 395/498 (79%), Gaps = 8/498 (1%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M+FYRDATWVLE +E +DAKG++SGSLQTLV  SCKR+K+K NPKH+YAV+ SCW+YKP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMKKS ILDE+P++KG P++ RLTL+L+CHDLL SK+KRIQMGK PIK +VLK+K+R
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCD----VEATKLEIQKKF 176
           L+                    + D  ND+TPVRW R+NPLRC     V++   E++KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
             +V++W D+VPGSIYYDEYIPNLF +HPQDKITSH LYKQGKIIIQDRASCFPAHIL+P
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKD--PKIQIYAFEKNPERAKILDKMIKVAGC 294
             +D+VID CAAPGNKTTH A++M ++ + D  PK+QIYAFEK+PERA++L+KMIK+AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 295 SKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
           SK I++ VGDFTK+A P+   +V G IVDPSCSGSGIFGRK+IDS+N KK +        
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENE 414
                         +  ++LKTRLSKLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENE
Sbjct: 361 ELDAVPEEQEEQELD--DNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENE 418

Query: 415 RVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIR 474
           RVVIDL+LD KVK+ GW+VAPRSKVIPTW RRG V+EF++VFRED  SS C+E+A GCIR
Sbjct: 419 RVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIR 478

Query: 475 ALPRSDGGIGFFAVCFER 492
           ALPR DGGIGFFAVCFER
Sbjct: 479 ALPREDGGIGFFAVCFER 496

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/496 (68%), Positives = 389/496 (78%), Gaps = 11/496 (2%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCKRYKLK NPKHVYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEKVMKK+ IL++IPK+KGKP++SRLTL+L+CHDLL SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176
           LH                    + D  ND+ PVRWIRINPL+C      E    E++KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
             +VE WS++VP SIYYDEYIPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296
             ND+VID C+APGNKTTHTASY+  EP KD + +IYAFEK+PERAKIL KMIK+AGCS 
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXX 356
           NI ++VGDFTK+A PEK+KD TGFIVDPSCSGSGIFGRKF DSLNRKKM+          
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMD------DKDD 354

Query: 357 XXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416
                      +  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 355 DNDIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERV 414

Query: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476
           VIDL+LD  V++WGW+VAPRS+VIP WPRRGKVEE  E    +G +   +ELA GCIRAL
Sbjct: 415 VIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEE-FEEVFREGAAHDPQELAEGCIRAL 473

Query: 477 PRSDGGIGFFAVCFER 492
           P+ DGGIGFFAVCFER
Sbjct: 474 PKDDGGIGFFAVCFER 489

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/495 (64%), Positives = 381/495 (76%), Gaps = 22/495 (4%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M  YRDATWV E+VEQE++KG+I+GSLQTLV  SCKRYKLK NPKH+YA++ SCWKYKP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEK++KKSGIL +IPK+KG+P +S  T++L+ HDLL SK KRIQMGK PIK +VLKHK R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCD--VEATKLEIQKKFPT 178
           L                       D  NDMTPVRWIRINP+RC+  V+  K E+QKKFPT
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVK--DDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPT 178

Query: 179 RVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDE 238
           +V NWS+IVPG+IY+DE+IPNLFG+HP DKITSH LYK+GKIIIQDRASCFPAHIL+P  
Sbjct: 179 KVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTP 238

Query: 239 NDVVIDGCAAPGNKTTHTASYMIKEPSKDPKI-QIYAFEKNPERAKILDKMIKVAGCSKN 297
            DV+ID C+APGNKTTH A++M  +P   PK  QI+AFEK+PERAK L KMI+VAGC K+
Sbjct: 239 EDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297

Query: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXX 357
           I+++VGDFTK+A P+K+  VTGFIVDPSCSGSGIFGRK ID  N K              
Sbjct: 298 IEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKN------------- 344

Query: 358 XXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417
                         +DLKTRL+KLSSFQFQ++KHAMSFPNAKK+VYSTCSIHAEENERVV
Sbjct: 345 EVLPEEEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVV 404

Query: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477
           IDL+LD KV+QWGW+V  R+ VIPTW RRG VEEF++V+++     + +ELA GCIRALP
Sbjct: 405 IDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD---KQQAQELADGCIRALP 461

Query: 478 RSDGGIGFFAVCFER 492
           + DGGIGFFAVCFER
Sbjct: 462 KEDGGIGFFAVCFER 476

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/494 (60%), Positives = 375/494 (75%), Gaps = 31/494 (6%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M+FYRD+TW+LE++E E+ KG++SGSLQ+ V ++C +YK+K NPKH+YAV+ SCWKY+ Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LE++M KSGIL  IP++KGKP +SRLT+ML+CHDLL SK KRIQMGK PIK YVLK+K+R
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCDVEATKLEIQKKFPTRV 180
           LH                    + D  +D TPVRWIRINPL+CD+     ++ KKFP RV
Sbjct: 121 LHAELVKLKVKLKVKELSELV-DQDDGDDATPVRWIRINPLKCDIPVVVEQLNKKFPHRV 179

Query: 181 ENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEND 240
           ++W  + PGSIYYDEY+PNLFGIHP +KITSH+LYKQGK+IIQDRASC PAHIL+P + D
Sbjct: 180 DHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKED 239

Query: 241 VVIDGCAAPGNKTTHTASYMIKEP--SKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNI 298
           VV+D CAAPGNKTTH A+++I     S   + QI+AFEK P RAK+L KM   AGC   +
Sbjct: 240 VVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLV 299

Query: 299 KINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXX 358
           KI+VGDFT++A+P++++DVT  +VDPSCSGSGIFGRK ++S N                 
Sbjct: 300 KIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSND---------------- 343

Query: 359 XXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVI 418
                     ++ + L+ RLSKLSSFQFQVVKHAMS PNA+KIVYSTCS+HAEENERVVI
Sbjct: 344 ----------SQDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVI 393

Query: 419 DLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPR 478
           DL+LDSKVK+WGW+++PRS+V+PTWPRRG  EEFEEVFR+D    KC+ LA  CIRALPR
Sbjct: 394 DLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD--KPKCQLLAESCIRALPR 451

Query: 479 SDGGIGFFAVCFER 492
            DGGIGFFAVCF+R
Sbjct: 452 EDGGIGFFAVCFQR 465

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/499 (62%), Positives = 376/499 (75%), Gaps = 16/499 (3%)

Query: 1   MEFYRDATWVLEFVEQEDAKG-RISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKP 59
           MEFYRDATWVLEFVEQE +K  R++GSLQTLV  SCKRYKLK NP+H+YA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKS 119
           YL+K++KKSGIL+++PK+KGKP++++ T+ L+ HDLL SK+KRIQMGK PIKT++LKH++
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC-----DVEATKLEIQK 174
           RL                       D E D+TPVRWIRINP+       DV A   E+ K
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGE-DVTPVRWIRINPILVKERYDDVLA---ELNK 176

Query: 175 KFPTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHIL 234
           KFP RV +W  IVPGSIYYDEYIPNLFGIHP DKITSH  YK+GKIIIQDRASCFPAHIL
Sbjct: 177 KFPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHIL 236

Query: 235 HPDENDVVIDGCAAPGNKTTHTASYMIKE-PSKDPKIQIYAFEKNPERAKILDKMIKVAG 293
           +P+  DVVID CAAPGNKTTH A+++  +  +K   ++I+AFEK+PERAK L  M+  AG
Sbjct: 237 NPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAG 296

Query: 294 CSKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXX 353
           C+K +KI+VGDFTK+  PE +++VTGFIVDPSCSGSGIFGRK ID +N  K         
Sbjct: 297 CAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTG-SSNTDE 355

Query: 354 XXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEEN 413
                         + K +DLK RL+KLSSFQ+Q+VKHAMSFP+AKKI YSTCSIHAEEN
Sbjct: 356 DQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEEN 415

Query: 414 ERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCI 473
           ERVVIDL+LDSKVK+WGWKV  R+ VIPTWPRRG   EFEEVF ++    + +ELA GCI
Sbjct: 416 ERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKE----EAKELAEGCI 471

Query: 474 RALPRSDGGIGFFAVCFER 492
           RALP+ DGGIGFFAVCFER
Sbjct: 472 RALPKEDGGIGFFAVCFER 490

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/508 (62%), Positives = 385/508 (75%), Gaps = 18/508 (3%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE +E +D KGR+SGSL +LV +SCK++K++ NPKHVYAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           +E++M KSGILD+IPK+KGKP+Y RLTL+L+ HDL+FSK++RIQMGK PIKT+VL +K+R
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHXXXXXXXX----XXXXXXXXXXXXNADSENDMTPVRWIRINPLRCDVEATK----LEI 172
           LH                        + DS +D+TPVRWIRINP+R   + +     LE+
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 173 QKKFPTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAH 232
           +KKF T+V++WS I PG IYYDEYIPNLFGI P DKITSH LYK GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 233 ILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKI-----QIYAFEKNPERAKILDK 287
           IL+   +D +ID CAAPGNKTTH ASY++   + D  I     +++AFEK+PER+KILDK
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIM-SLNNDTHINFDKKRVFAFEKDPERSKILDK 299

Query: 288 MIKVAGCSKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLN-RKKMN 346
           M+K+AGC K ++IN GDFTKIA PEKY +VTGFIVDPSCSGSGIFGRKFID++N  KK+ 
Sbjct: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359

Query: 347 XXXXXXXXXXXXX--XXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYS 404
                                     ++DL+TRLSKLSSFQFQVVKHAMSFP+AKKIVYS
Sbjct: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419

Query: 405 TCSIHAEENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSK 464
           TCSIHAEENERVVIDL+LD KVK+WGWKV PRS  IPTW RRG V EFE+VF+ D  +  
Sbjct: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDP-AMD 478

Query: 465 CEELAGGCIRALPRSDGGIGFFAVCFER 492
            ++LA GCIR LP+ DGGIGFFAVCFER
Sbjct: 479 PKQLAEGCIRTLPKEDGGIGFFAVCFER 506

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/500 (63%), Positives = 382/500 (76%), Gaps = 17/500 (3%)

Query: 1   MEFYRDATWVLEFVE-QEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKP 59
           MEFYRD+TWVLE++E Q +  GR+SGSLQT+V + CK+Y++K NPKH+YA++ SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKS 119
           YL+K+MKKSG+LD IP++KGKP +S+LTL+L+CHDLL SKAKRIQMGK PIK YVLK+K+
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRC---DVEATKLEIQKKF 176
            L+                      D+ +DMTPVRWIRINPLR    D +    E++KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236
           PTRV  W DI+PGSIYYDE+IPNL+GIH  DKITSH LYKQGKIIIQDRASCFPAHIL+P
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPS--KDPKIQIYAFEKNPERAKILDKMIKVAGC 294
             +DVVID C+APGNKTTH A+++  +P   ++  +QIYAFEK+PERA+IL KMIK AGC
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300

Query: 295 SKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNR--KKMNXXXXXX 352
            KNI +NVGDFT+IA P KY DVTGFI+DPSCSGSGIFGRK +D LN   KK N      
Sbjct: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360

Query: 353 XXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEE 412
                           +K E LK RLSKL+SFQFQ+V+HAMSFPNAKKIVYSTCSIHAEE
Sbjct: 361 NDAEETTD--------SKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEE 412

Query: 413 NERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGC 472
           NERVVIDL+LD KV+ WGW+VA +  V+PTW RRG  EEF+EVF  D    +C+ELA GC
Sbjct: 413 NERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVF-TDKTEQECQELADGC 471

Query: 473 IRALPRSDGGIGFFAVCFER 492
           +RALP+ DGGIGFFAVCF R
Sbjct: 472 VRALPKEDGGIGFFAVCFVR 491

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/495 (59%), Positives = 369/495 (74%), Gaps = 20/495 (4%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE+VE+ ++ GR++GSLQTLV  SCK+Y LK NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           LEK++KKS IL ++PK+KGK +++  T+ L+ HDLLF+K KRIQMGK P+K +VLKHK+R
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCDV--EATKLEIQKKFPT 178
           L+                      D  NDMTPVRW RINP+RC    E    E+ KKFPT
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLK--DDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPT 178

Query: 179 RVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDE 238
           RV++W D+VPGSIY+DEYIPNLFG+HP DKITSH LYK GKIIIQDRASCFPAHIL+P  
Sbjct: 179 RVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSP 238

Query: 239 NDVVIDGCAAPGNKTTHTASYM-IKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKN 297
           +DV+ID CAAPGNKTTH A++M + +  ++P   I+AFEK+PERAK L  M+K AGCSK 
Sbjct: 239 SDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCSKG 296

Query: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXX 357
           I I+VGDFTK+A P  + +V+GFIVDPSCSGSGIFGR+ ID  N+ +             
Sbjct: 297 INIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQ 356

Query: 358 XXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417
                       + +D+K RL+KL+SFQF++VK+A+SFP+AKK+VYSTCSIHAEENER+V
Sbjct: 357 EI----------EGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIV 406

Query: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477
           IDL+LDSKVK+WGW+V  R+  IPTWPRRG   EFE+VFRE G+++K  ELA  CIR  P
Sbjct: 407 IDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFRE-GDTAK--ELAEACIRVAP 463

Query: 478 RSDGGIGFFAVCFER 492
           + DGGIGFFAVCFER
Sbjct: 464 KEDGGIGFFAVCFER 478

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/495 (59%), Positives = 370/495 (74%), Gaps = 16/495 (3%)

Query: 1   MEFYRDATWVLEFVEQEDAK-GRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKP 59
           MEFYRD++WVLE++EQE +K  RISGSLQTLV +SCKRYKLK NPKH+YA++ SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKS 119
           YLEK++K SG+L ++P +KG+P++S+ T+ML+ HDLL SK KRI MGK PIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCD--VEATKLEIQKKFP 177
           RL                     + D+  DM+PVRWIRINP RC   V+    E++KKFP
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDA--DMSPVRWIRINPFRCQGKVDDVLKELRKKFP 191

Query: 178 TRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPD 237
            +V++W+ IVPGSIY DEYIPNL+G+HP DKITSH LYK+GKIIIQDRASCFPA+IL+P 
Sbjct: 192 KQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPT 251

Query: 238 ENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKN 297
            +DVVID C+APGNKTTH A+++  + +    ++IYAFE++ +RA+IL+KM+  AGC   
Sbjct: 252 PHDVVIDACSAPGNKTTHIAAHIFPDGNAS-DVKIYAFERDAKRAEILEKMVTSAGCESC 310

Query: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXX 357
           I+I+VGDFT++A P+ +KDVTGFI+DPSCSGSGIFGR+ +D  N+ K+            
Sbjct: 311 IQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQ 370

Query: 358 XXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417
                     Y      KTRL+KLSSFQFQ+VKHAMSFPNAKK+VYSTCSIHAEENERVV
Sbjct: 371 DPKEMEQNELY------KTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVV 424

Query: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477
           IDL+LD  +KQ+GWKVA R  VIP W RRG + EFEEVF  +    + +ELA GCIRALP
Sbjct: 425 IDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE----QAQELADGCIRALP 480

Query: 478 RSDGGIGFFAVCFER 492
           + DGGIGFFAVCFER
Sbjct: 481 KEDGGIGFFAVCFER 495

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/494 (57%), Positives = 365/494 (73%), Gaps = 14/494 (2%)

Query: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60
           M FYRDATWVLE+VE  +  GR++GSLQTLV  SCK+Y+LK NPKH+YA + SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120
           L+K++K+SGIL +IPK+KGK +++  T+ L+ HDLLFSK KRIQMGK P+K +VLK+K+R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINPLRCDVEATKL--EIQKKFPT 178
           L                       D  NDMTPVRW R+NP+RC  ++  +  E+ KKFPT
Sbjct: 167 LSSELVRLKIKLKVTDLQQLLK--DDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPT 224

Query: 179 RVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDE 238
           RV +W++I PG IY+DEYIP LFG+HP DKITSH LYK GK+IIQDRASCFPAHIL+   
Sbjct: 225 RVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASS 284

Query: 239 NDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNI 298
            D++ID CAAPGNKTTH A+++ ++ + +  ++I+AFEK+PERAK L  MI  AGC+K I
Sbjct: 285 EDLIIDACAAPGNKTTHVAAHIFQDQAVE-SVRIHAFEKDPERAKTLRTMINTAGCTKGI 343

Query: 299 KINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXX 358
           +++VGDFT++A P K+ DVTGFI+DPSCSGSGIFGRK ID  N+ K +            
Sbjct: 344 EVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEKEE 403

Query: 359 XXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVI 418
                        +DLK RL KL+SFQF++VKHAMSFP+AKK+VYSTCS+HAEENER+V+
Sbjct: 404 EREDISD------KDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVV 457

Query: 419 DLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPR 478
           DL+LDSKVK+WGW+V  R+ VIPTW RRG  +EFEEVFR++  +   +ELA  CIR  P+
Sbjct: 458 DLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTA---KELAEACIRVAPK 514

Query: 479 SDGGIGFFAVCFER 492
            DGGIGFFAVCFER
Sbjct: 515 EDGGIGFFAVCFER 528

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/495 (57%), Positives = 354/495 (71%), Gaps = 15/495 (3%)

Query: 1   MEFYRDATWVLEFVEQEDA-KGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKP 59
           MEFYRDA+WVLE++EQE A K +++GSL +LV QS K+YKLK + +HVYA++ S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKS 119
           YL+++++KSG+L ++P++KG+P + R TL L+ HDLL SK KRI MGK P+K +VLKH++
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLHXXXXXXXXXXXXXXXXXXXXNADSENDMTPVRWIRINP--LRCDVEATKLEIQKKFP 177
           RL                       D   D TPVRWIR+NP  +R   E    E+QKKFP
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQ--DEREDATPVRWIRLNPFRIRGQREEVLQELQKKFP 178

Query: 178 TRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPD 237
            RV +W ++ PGSIY DEY+  L+G+HP DKITSH LYK+GKIIIQDRASCFPA IL P 
Sbjct: 179 RRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPG 238

Query: 238 ENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKN 297
            +DV+ID CAAPGNKTTH A+++  E   D   QI+AFE++P+RAK L KMI  AGC   
Sbjct: 239 RSDVIIDACAAPGNKTTHVAAHIFPEGGAD-HAQIHAFERDPQRAKTLRKMIATAGCDNA 297

Query: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXX 357
           I+++VGDFT+ A PE +K+VTGFIVDPSCSGSGIFGR+ +D+    +             
Sbjct: 298 IEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADVPE 357

Query: 358 XXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417
                          +LK RL+KLSSFQFQ+VKHAMSFP+AKK++YSTCS+HAEENERVV
Sbjct: 358 EETFEATKSAV----ELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVV 413

Query: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477
           IDL+LDSKV++ GWKVA RSKVIP WPRRG   EFEEVF       + EELAGGCIR LP
Sbjct: 414 IDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVF-----PDQAEELAGGCIRVLP 468

Query: 478 RSDGGIGFFAVCFER 492
           + DGGIGFFAVCFER
Sbjct: 469 KEDGGIGFFAVCFER 483

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 110/279 (39%), Gaps = 77/279 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 286 IGSWTKV--GLQIFDSQVP--VGATPE--------YLAGHYILQAASSFLPVIALDPHEN 333

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 334 ERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKARTKSLIANIHRLGCTNTIV 387

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+ G+     +NR + +        
Sbjct: 388 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIGKDQSVKVNRTEKD-------- 431

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIH 409
                                    ++   Q Q++  A+   ++       IVYSTCS+ 
Sbjct: 432 -----------------------FMQIPHLQKQLILSAIDSVDSNSKHGGVIVYSTCSVA 468

Query: 410 AEENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGK 448
            EENE VV           +  +  P  K++ T    GK
Sbjct: 469 VEENEAVV----------DYALRKRPNVKLVETGLAIGK 497

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 103/248 (41%), Gaps = 67/248 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + NW+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 311 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 358

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 359 ERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKNRTKSLIANIHRLGCTNTIV 412

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+ G+     ++R + +        
Sbjct: 413 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------- 456

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSF--PNAKK---IVYSTCSIH 409
                                    ++   Q Q++  A+     N+KK   IVYSTCS+ 
Sbjct: 457 -----------------------FIQIPHLQKQLLLSAIDSVDANSKKGGIIVYSTCSVA 493

Query: 410 AEENERVV 417
            EE+E VV
Sbjct: 494 VEEDEAVV 501

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 99/243 (40%), Gaps = 57/243 (23%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + NW+ +  G   +D  +P   G  P+        Y  G+ I+Q  +S  P   L P EN
Sbjct: 294 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGQYILQAASSFLPVIALDPQEN 341

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  +APG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 342 ERILDMASAPGGKTTYISALMKNTGC------VFANDANKNRTKSLIANIHRLGCTNTI- 394

Query: 300 INVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXX 359
             V ++     P+        ++D  CSG+G+ G+     ++R + +             
Sbjct: 395 --VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD------------- 439

Query: 360 XXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENE 414
                               ++   Q Q++  A+   +A       IVYSTCS+  EE+E
Sbjct: 440 ------------------FIQIPHLQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVEEDE 481

Query: 415 RVV 417
            VV
Sbjct: 482 AVV 484

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 109/279 (39%), Gaps = 77/279 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 293 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 340

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC   I 
Sbjct: 341 ERILDMAAAPGGKTTYISALMKNTGC------VFANDANKARTKSLIANIHRLGCHNTIV 394

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+ G+     ++R + +        
Sbjct: 395 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------- 438

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIH 409
                                    ++   Q Q++  A+   +A       IVYSTCS+ 
Sbjct: 439 -----------------------FMQIPHLQKQLILSAIDSVDAHSKTGGVIVYSTCSVA 475

Query: 410 AEENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGK 448
            EENE VV           +  +  P  K++ T    GK
Sbjct: 476 VEENEAVV----------NYALRKRPNVKLVETGLAIGK 504

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 120/304 (39%), Gaps = 67/304 (22%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      +  E   +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHME-DDEPSGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPE---KYKDVTGF---IVDPSCSGS 329
           + +R+ +L   +K    +  + +N     F +I L E   + KDV  F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 264 GTM---------RKNVNVWRD-----------------WNTQSGLG-----LHTVQLNIL 292

Query: 390 KHAMSFPNAK-KIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +     K ++VYSTCS++  ENE VV      + +++WG K+             RS
Sbjct: 293 NRGLHLLKPKGRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRS 347

Query: 438 KVIPTWP---------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGFFAV 488
           K I TWP         ++G     E  F      ++  +L+  CIR  P      GFF  
Sbjct: 348 KGISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLS-SCIRVYPHQQNTGGFFIT 406

Query: 489 CFER 492
            FE+
Sbjct: 407 VFEK 410

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 114/279 (40%), Gaps = 77/279 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 302 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVVALDPQEN 349

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + V+D  +APG KTT+ ++ M           ++A + N +R K L   I   GC+  I 
Sbjct: 350 ERVLDMASAPGGKTTYISALMKNTGC------VFANDANKKRTKSLIANIHRLGCTNTIV 403

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+ G+     ++R + +        
Sbjct: 404 CNYDAREFPKV--------IGGFDRVLLDAPCSGTGVIGKDQSVKVSRTEKD-------- 447

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSF--PNAKK---IVYSTCSIH 409
                                    ++   Q Q++  A+     N+KK   IVYSTCS+ 
Sbjct: 448 -----------------------FIQIPHLQKQLLLSAIDSVDANSKKGGVIVYSTCSVA 484

Query: 410 AEENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGK 448
            EE+E VV           +  +  P  K++ T  + GK
Sbjct: 485 VEEDEAVV----------DYALRKRPNVKLVDTGLQIGK 513

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 107/274 (39%), Gaps = 67/274 (24%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 300 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPQEN 347

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 348 ERILDMAAAPGGKTTYISALMKNTGC------VFANDANKSRTKSLVANIHRLGCTNTI- 400

Query: 300 INVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXX 359
             V ++     P         ++D  CSG+G+ G+     ++R + +             
Sbjct: 401 --VCNYDAREFPRVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD------------- 445

Query: 360 XXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENE 414
                               ++   Q Q++  A+   ++       IVYSTCS+  EE+E
Sbjct: 446 ------------------FMQIPHLQKQLLLSAIDSVDSHSKTGGIIVYSTCSVAVEEDE 487

Query: 415 RVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGK 448
           +VV           +  +  P  K+I T    GK
Sbjct: 488 QVV----------DYALRKRPNIKLIETGLAIGK 511

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 101/248 (40%), Gaps = 67/248 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 296 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 343

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 344 ERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKARTKSLIANIHRLGCTNTIV 397

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+ G+     ++R + +        
Sbjct: 398 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------- 441

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIH 409
                                    ++   Q Q++  A+   ++       IVYSTCS+ 
Sbjct: 442 -----------------------FMQIPHLQKQLLLSAIDSVDSNSKTGGVIVYSTCSVA 478

Query: 410 AEENERVV 417
            +ENE VV
Sbjct: 479 VDENEAVV 486

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 123/311 (39%), Gaps = 79/311 (25%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      +  + S +P   + A + 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHID-SDEPSGFVIANDA 198

Query: 278 NPERAKILDKMIKVAGCSK------------NIKINVGDFTKIALPEKYKDVTGFIVDPS 325
           + +R+ +L   +K    S             N+KIN    TK A  ++       + D  
Sbjct: 199 DNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKIN----TKDASSQEDLKFDRILCDVP 254

Query: 326 CSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQ 385
           CSG G           RK +N                     +N +  L      L + Q
Sbjct: 255 CSGDGTM---------RKNVNVWKN-----------------WNTQNALG-----LHNVQ 283

Query: 386 FQVVKHAMSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV----------- 433
           F ++   ++      K+VYSTCS++  ENE VV  ++     ++WG KV           
Sbjct: 284 FNILDRGLTLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKG 338

Query: 434 APRSKVIPTWPRRGKVEEFEEVFR---EDGNSSKC-----EELA----GGCIRALPRSDG 481
             RSK + TWP   +  + EEV R   +D  +  C     EE++      C+R  P    
Sbjct: 339 LIRSKGLTTWPVINR--DMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQN 396

Query: 482 GIGFFAVCFER 492
             GFF   FE+
Sbjct: 397 TGGFFITMFEK 407

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 108/276 (39%), Gaps = 77/276 (27%)

Query: 183 WSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDENDVV 242
           W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN+ V
Sbjct: 316 WTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPQENERV 363

Query: 243 IDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIKIN- 301
           +D  +APG KTT+ ++ M           I+A + N  R K L   I   GC+  I  N 
Sbjct: 364 LDMASAPGGKTTYISALMKNTGC------IFANDANKARTKSLIANIHRLGCTNTIVCNY 417

Query: 302 -VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXX 357
              +F K+        + GF   ++D  CSG+G+ G+     ++R + +           
Sbjct: 418 DAREFPKV--------IGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD----------- 458

Query: 358 XXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAM-----SFPNAKKIVYSTCSIHAEE 412
                                 ++   Q Q++  A+     +  N   +VYSTCS+  EE
Sbjct: 459 --------------------FIQIPHLQKQLILSAIDSLDSNSKNGGVLVYSTCSVAVEE 498

Query: 413 NERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGK 448
           +E VV           +  +  P  K++ T    GK
Sbjct: 499 DEAVV----------DYALRKRPNVKLVETGLAIGK 524

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 91/219 (41%), Gaps = 55/219 (25%)

Query: 209 ITSHNLYKQGKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDP 268
           I + + Y  G+ I+Q  +S  P   L P EN+ V+D  AAPG KTT+ ++ M        
Sbjct: 331 IGATSEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALMKNTGC--- 387

Query: 269 KIQIYAFEKNPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVD 323
              ++A + N  R K L   I   GC+  I  N    +F K+        + GF   ++D
Sbjct: 388 ---VFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLD 436

Query: 324 PSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSS 383
             CSG+G+ G+      +R + +                                 ++  
Sbjct: 437 APCSGTGVIGKDQSVKSSRTEKD-------------------------------FIQIPH 465

Query: 384 FQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENERVV 417
            Q Q++  A+   +A       IVYSTCS+  EE+E VV
Sbjct: 466 LQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEEDEAVV 504

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 108/279 (38%), Gaps = 63/279 (22%)

Query: 148 NDMTPVRWIRINPLRCDVEATKLEIQKKFPTRVENWSDIVP----GSIYYDEYIPNLFGI 203
           N+++    IR N L+      + ++ +    R  N   I P    G   +D  +P   G 
Sbjct: 276 NEVSRPVTIRTNSLKT----RRRDLAQTLVNRGVNLKPIGPWTKVGLQIFDSQVP--IGA 329

Query: 204 HPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKE 263
            P+        Y  G  I+Q  +S  P   L P EN+ ++D  AAPG KTT+ ++ M   
Sbjct: 330 TPE--------YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNT 381

Query: 264 PSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIKINVGDFTKIALPEKYKDVTGFIVD 323
                   ++A + N  R K L   I   GC+  I   V ++     P+        ++D
Sbjct: 382 GC------VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLD 432

Query: 324 PSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSS 383
             CSG+G+  +     ++R   +                                 ++  
Sbjct: 433 APCSGTGVIAKDQSVKVSRTDKD-------------------------------FMQIPH 461

Query: 384 FQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENERVV 417
            Q Q++  A+   +A       IVYSTCS+  EENE VV
Sbjct: 462 LQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEENEAVV 500

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 112/279 (40%), Gaps = 77/279 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 306 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 353

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M    +      ++A + N  R K L   I   GC+  I 
Sbjct: 354 ERILDMAAAPGGKTTYISALMKNTGT------VFANDANKNRTKSLIANIHRLGCTNTIV 407

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+ G+     ++R + +        
Sbjct: 408 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------- 451

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFP--NAKK---IVYSTCSIH 409
                                    ++   Q Q++  A+     N+K    IVYSTCS+ 
Sbjct: 452 -----------------------FIQIPHLQKQLLLSAIDSVDCNSKHGGIIVYSTCSVA 488

Query: 410 AEENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGK 448
            EE+E VV           +  +  P  K++ T    GK
Sbjct: 489 VEEDEAVV----------DYALRKRPNVKLVDTGLAIGK 517

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 120/314 (38%), Gaps = 87/314 (27%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + +  V+D CAAPG+KT      + K+ + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKD-TDEPTGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIAL---PEKYKDVTGF---IVDPSCSGS 329
           + +R+ +L   +K    +  + +N     F +I L    EK K++  F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 264 GTM---------RKNVN-----------------VWKDWNTQGGL-----GLHTVQLNIL 292

Query: 390 KHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVA-----------PRS 437
              ++   +  ++VYSTCS++  ENE VV + +     ++WG K+             RS
Sbjct: 293 NRGLNLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGSKIKLVNCDDKLVGLVRS 347

Query: 438 KVIPTWPRRGK-------------------VEEFEEVFREDGNSSKCEELAGGCIRALPR 478
           K I  WP   +                    EE  E+F  D            CIR  P 
Sbjct: 348 KGISNWPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLD-----------SCIRVYPH 396

Query: 479 SDGGIGFFAVCFER 492
                GFF   FE+
Sbjct: 397 QQNTGGFFITVFEK 410

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 119/304 (39%), Gaps = 67/304 (22%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  +    V+D CAAPG+KT      + K+ + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKD-TDEPTGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIAL---PEKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I L    EK +D+  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q+ ++
Sbjct: 264 GTM---------RKNVN-----------------VWKDWNAQGAL-----GLHTVQWNIL 292

Query: 390 KHAMSF--PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APR 436
              +    PN  ++VYSTCS++  ENE VV   +     ++WG K+             R
Sbjct: 293 NRGLHLLKPNG-RLVYSTCSLNPIENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLVR 346

Query: 437 SKVIPTWPRRGKVEEFEEVFREDGNSS---KCEELAG-----GCIRALPRSDGGIGFFAV 488
           SK I  WP   +  E +    E    S     EE A       CIR  P      GFF  
Sbjct: 347 SKGISQWPVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFIT 406

Query: 489 CFER 492
            FE+
Sbjct: 407 VFEK 410

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 99/248 (39%), Gaps = 67/248 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           +  W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 288 IGTWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 335

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 336 ERILDMAAAPGGKTTYISALMKNTGC------VFANDANKARTKSLIANIHRLGCTNTIV 389

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+  +     ++R + +        
Sbjct: 390 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIAKDQSVKVSRTEKD-------- 433

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIH 409
                                    ++   Q Q++  A+   ++       IVYSTCS+ 
Sbjct: 434 -----------------------FMQIPHLQKQLILSAIDSVDSNSKTGGIIVYSTCSVA 470

Query: 410 AEENERVV 417
            EENE VV
Sbjct: 471 VEENEAVV 478

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 110/281 (39%), Gaps = 74/281 (26%)

Query: 156 IRINPLRCDVEATKLEIQKKFPTRVENWSDIVP----GSIYYDEYIPNLFGIHPQDKITS 211
           IR N L+      + ++ +    R  N   I P    G   +D  +P   G  P+     
Sbjct: 282 IRTNSLKT----RRRDLAQTLVNRGVNLKPIGPWTKVGLQIFDSQVP--IGATPE----- 330

Query: 212 HNLYKQGKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQ 271
              Y  G  I+Q  +S  P   L P EN+ ++D  AAPG KTT+ ++ M           
Sbjct: 331 ---YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------ 381

Query: 272 IYAFEKNPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVDPSC 326
           ++A + N  R K L   I   GC+  I  N    +F K+        + GF   ++D  C
Sbjct: 382 VFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPC 433

Query: 327 SGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQF 386
           SG+G+  +     ++R + +                                 ++   Q 
Sbjct: 434 SGTGVIAKDQSVKVSRTEKD-------------------------------FIQIPHLQK 462

Query: 387 QVVKHAMSFPNAKK-----IVYSTCSIHAEENERVVIDLML 422
           Q++  A+   +A       IVYSTCS+  EENE  VID  L
Sbjct: 463 QLLLSAIDSVDANSKTGGVIVYSTCSVAVEENE-AVIDYAL 502

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 116/303 (38%), Gaps = 68/303 (22%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P ++L  + +  V+D CAAPG+KT       +     +P   + A + 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVE-ALHANGPEPSGFVVANDA 204

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIF 332
           +  R+ +L   +K    +  I +N     F +I   E  KD   F   + D  CSG G  
Sbjct: 205 DYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTM 264

Query: 333 GRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLS-KLSSFQFQVVKH 391
                    RK +N                         +D  T     L + Q  ++  
Sbjct: 265 ---------RKNINVW-----------------------KDWGTGSGLGLHTVQLNILNR 292

Query: 392 AMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVA-----------PRSKV 439
            ++   N  ++VYSTCS++  ENE VV      + +++WG K+             RS  
Sbjct: 293 GLTLLKNGGRLVYSTCSLNPIENEAVVA-----AALRKWGAKIKLVNCDDQLLGLVRSTG 347

Query: 440 IPTWPRRGKVEEFEEVFREDGNS-----SKCEELAG-----GCIRALPRSDGGIGFFAVC 489
           I +WP   K   +EE  + D  +        EE A       CIR  P      GFF   
Sbjct: 348 ISSWPVLDK--NYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISV 405

Query: 490 FER 492
           FE+
Sbjct: 406 FEK 408

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 106/274 (38%), Gaps = 67/274 (24%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 171 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 218

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 219 ERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKNRTKSLIANIHRLGCTNTI- 271

Query: 300 INVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXX 359
             V ++     P+        ++D  CSG+G+ G+     ++R + +             
Sbjct: 272 --VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD------------- 316

Query: 360 XXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENE 414
                               ++   Q Q++  A+   +        IVYSTCS+  EE+E
Sbjct: 317 ------------------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEEDE 358

Query: 415 RVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGK 448
            VV           +  +  P  K++ T    GK
Sbjct: 359 AVV----------DYALRKRPNVKLVDTGLAIGK 382

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 110/302 (36%), Gaps = 65/302 (21%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + N  V+D CAAPG+KT      + K+ + +P   I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKD-TDEPTGIIVANDS 217

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVT----GFIVDPSCSGSGI 331
           +  R+ +L   +K    S  + +N     F  I       ++T      + D  CSG G 
Sbjct: 218 DMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGT 277

Query: 332 FGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKH 391
             RK I+  N  +                                    L   Q  ++  
Sbjct: 278 L-RKNINIWNDWRFQNAL------------------------------GLHRLQNNILNR 306

Query: 392 AMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVAP-----------RSKV 439
            +    N  ++VYSTCS++  ENE V+ + +     + W  +V+            RS+ 
Sbjct: 307 GLQLLRNGGRLVYSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPGLIRSRG 361

Query: 440 IPTWP---------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGFFAVCF 490
           I +WP          RG  E  +  F    +  K   L   CIR  P       FF   F
Sbjct: 362 ISSWPVIDRNGEMRERGDPETLDSWFPPTADEQKTFNLE-KCIRVYPHQQDTGAFFIAVF 420

Query: 491 ER 492
           E+
Sbjct: 421 EK 422

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 115/303 (37%), Gaps = 65/303 (21%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  +    V+D CAAPG+KT      + ++ + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRD-TDEPTGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALP---EKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  I +N     F +I      EK  D+  F   + D  CSG 
Sbjct: 204 DNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L   Q  ++
Sbjct: 264 GTM---------RKNVNVWRD-----------------WNTQNALG-----LHQVQANIL 292

Query: 390 KHAMSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +       ++VYSTCS++  ENE VV   +     ++WG KV             R+
Sbjct: 293 NRGLHLLKKGGRLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRN 347

Query: 438 KVIPTWPRRGKVEEFEEVFREDGNSS---KCEELA-----GGCIRALPRSDGGIGFFAVC 489
           K I  WP   +  E  E  +E  N S     EE A       CIR  P      GFF   
Sbjct: 348 KGISKWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITV 407

Query: 490 FER 492
           FE+
Sbjct: 408 FEK 410

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 91/219 (41%), Gaps = 55/219 (25%)

Query: 209 ITSHNLYKQGKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDP 268
           I + + Y  G+ I+Q  +S  P   L P  N+ V+D  AAPG KTT+ ++ M        
Sbjct: 311 IGATSEYLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALMKNTGC--- 367

Query: 269 KIQIYAFEKNPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVD 323
              ++A + N  R K L   I   GC+  I  N    +F K+        + GF   ++D
Sbjct: 368 ---VFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLD 416

Query: 324 PSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSS 383
             CSG+G+ G+     ++R + +                                 ++  
Sbjct: 417 APCSGTGVIGKDQSVKVSRTEKD-------------------------------FIQIPH 445

Query: 384 FQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENERVV 417
            Q Q++  A+   +A       IVYSTCS+  EE+E VV
Sbjct: 446 LQKQLLLSAIDSVDANSKTGGFIVYSTCSVAVEEDEAVV 484

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 114/302 (37%), Gaps = 73/302 (24%)

Query: 156 IRINPLRCDVEATKLEIQKKFPTRVENWSDIVP----GSIYYDEYIPNLFGIHPQDKITS 211
           IR N L+      + ++ +    R  N   I P    G   +D  +P   G  P+     
Sbjct: 274 IRTNTLKT----RRRDLAQTLVNRGVNLQPIGPWTKVGLQIFDSQVP--IGATPE----- 322

Query: 212 HNLYKQGKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQ 271
              Y  G  I+Q  +S  P   L P EN+ ++D  AAPG KTT+ ++ M           
Sbjct: 323 ---YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------ 373

Query: 272 IYAFEKNPERAKILDKMIKVAGCSKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGI 331
           ++A + N  R K L   I   GC+  I   V ++     P+        ++D  CSG+G+
Sbjct: 374 VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGV 430

Query: 332 FGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKH 391
            G+     ++R + +                                 ++   Q Q++  
Sbjct: 431 IGKDQSVKVSRTEKD-------------------------------FIQIPHLQKQLLLS 459

Query: 392 AMSFPNAKK-----IVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRR 446
           A+   +        IVYSTCS+  EE+E VV           +  +  P  K++ T    
Sbjct: 460 AIDSVDCNSKHGGVIVYSTCSVAVEEDEAVV----------NYALRKRPNVKLVETGLAI 509

Query: 447 GK 448
           GK
Sbjct: 510 GK 511

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 99/248 (39%), Gaps = 58/248 (23%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 299 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 346

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 347 ERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKSRTKSLIANIHRLGCTNTI- 399

Query: 300 INVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXX 359
             V ++     P+        ++D  CSG+G+ G+     ++R + +             
Sbjct: 400 --VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD------------- 444

Query: 360 XXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENE 414
                               ++   Q Q++  A+   +        IVYSTCS+  EE+E
Sbjct: 445 ------------------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEEDE 486

Query: 415 RVVIDLML 422
             VID  L
Sbjct: 487 -AVIDYAL 493

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 117/307 (38%), Gaps = 73/307 (23%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      + K+ + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKD-TDEPSGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPE---KYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I L E   K  DV  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 264 GTM---------RKNVN-----------------VWKDWNTQAGL-----GLHTVQLNIL 292

Query: 390 KHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +    +  ++VYSTCS++  ENE V+ + +     ++WG K+             RS
Sbjct: 293 NRGLHLLKDGGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLSGLVRS 347

Query: 438 KVIPTWP------------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGF 485
           K +  WP              G +E F     E+ +    +     C+R  P      GF
Sbjct: 348 KGVSKWPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQ----NCMRVYPHQQNTGGF 403

Query: 486 FAVCFER 492
           F   FE+
Sbjct: 404 FITVFEK 410

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 99/248 (39%), Gaps = 58/248 (23%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 299 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 346

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 347 ERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKSRTKSLIANIHRLGCTNTI- 399

Query: 300 INVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXX 359
             V ++     P+        ++D  CSG+G+ G+     ++R + +             
Sbjct: 400 --VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD------------- 444

Query: 360 XXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIHAEENE 414
                               ++   Q Q++  A+   +        IVYSTCS+  EE+E
Sbjct: 445 ------------------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEEDE 486

Query: 415 RVVIDLML 422
             VID  L
Sbjct: 487 -AVIDYAL 493

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 101/248 (40%), Gaps = 67/248 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 296 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 343

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 344 ERILDMAAAPGGKTTYISALMKNTGC------VFANDANKARTKSLIANIHRLGCTNTIV 397

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  C+G+G+ G+     ++R + +        
Sbjct: 398 CNYDAREFPKV--------IGGFDRILLDAPCTGTGVIGKDQSVKVSRTEKD-------- 441

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKK-----IVYSTCSIH 409
                                    ++   Q Q++  A+   ++       IVYSTCS+ 
Sbjct: 442 -----------------------FIQVPHLQKQLLLSAIDSVDSNSKTGGIIVYSTCSVA 478

Query: 410 AEENERVV 417
            EE+E VV
Sbjct: 479 VEEDEMVV 486

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 102/248 (41%), Gaps = 67/248 (27%)

Query: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239
           + +W+ +  G   +D  +P   G  P+        Y  G  I+Q  +S  P   L P EN
Sbjct: 301 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 348

Query: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299
           + ++D  AAPG KTT+ ++ M           ++A + N  R K L   I   GC+  I 
Sbjct: 349 ERILDMAAAPGGKTTYISAMMKNTGC------VFANDANKSRTKSLIANIHRLGCTNTIV 402

Query: 300 IN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIFGRKFIDSLNRKKMNXXXXXXXX 354
            N    +F K+        + GF   ++D  CSG+G+ G+     ++R + +        
Sbjct: 403 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------- 446

Query: 355 XXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHAMSFP--NAKK---IVYSTCSIH 409
                                    ++   Q Q++  A+     N+K    IVYSTCS+ 
Sbjct: 447 -----------------------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVA 483

Query: 410 AEENERVV 417
            EE+E VV
Sbjct: 484 VEEDEAVV 491

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 118/303 (38%), Gaps = 65/303 (21%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT     Y+ ++ + +P   + A + 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRD-NDEPSGFVVANDA 200

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKI-ALPEKY--KDVTGF---IVDPSCSGS 329
           + +R+ +L   +K    +  I +N     F ++ A P+    KD+  F   + D  CSG 
Sbjct: 201 DAKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSGD 260

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                        R+        L + Q  ++
Sbjct: 261 GTM---------RKNVNVW----------------------RDWTTQNGLALHNVQLNIL 289

Query: 390 KHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +    +  ++VYSTCS++  ENE VV + +     ++WG KV             RS
Sbjct: 290 NRGLHLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRS 344

Query: 438 KVIPTWPRRGKVEEFEEVFREDGNSS----KCEELA----GGCIRALPRSDGGIGFFAVC 489
             I  WP   +  E +E   +  N S      EE A      C+R  P      GFF   
Sbjct: 345 NGINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITV 404

Query: 490 FER 492
            E+
Sbjct: 405 LEK 407

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 109/303 (35%), Gaps = 65/303 (21%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + N  V+D CAAPG+KT       +     +P   + A + 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIE-ALHTNEDEPTGIVVANDA 202

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF------IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +IAL E   D   F      + D  CSG 
Sbjct: 203 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGD 262

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                        R+        L + Q  ++
Sbjct: 263 GTM---------RKNVNVW----------------------RDWTSQGGLGLHNIQLNIL 291

Query: 390 KHAMSFPNAK-KIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +     K ++VYSTCS++  ENE V+      + +++WG K+             RS
Sbjct: 292 NRGLHLLKPKGRLVYSTCSMNPIENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRS 346

Query: 438 KVIPTWP--------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGFFAVC 489
           K I +WP        R+   +     +       K +     CIR  P       FF   
Sbjct: 347 KGIDSWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITV 406

Query: 490 FER 492
            E+
Sbjct: 407 IEK 409

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 115/307 (37%), Gaps = 73/307 (23%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      + K+ + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKD-TDEPSGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIAL---PEKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I L        DV  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 264 GTM---------RKNVNVWKD-----------------WNTQAGLG-----LHTVQLNIL 292

Query: 390 KHAMSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +    N  ++VYSTCS++  ENE VV + +     ++WG K+             RS
Sbjct: 293 NRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRS 347

Query: 438 KVIPTWP------------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGF 485
           K +  WP              G +E F     E+ +    +     C+R  P      GF
Sbjct: 348 KGVSKWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQ----NCMRVYPHQQNTGGF 403

Query: 486 FAVCFER 492
           F   FE+
Sbjct: 404 FITVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 115/307 (37%), Gaps = 73/307 (23%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      + K+ + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKD-TDEPSGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIAL---PEKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I L        DV  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 264 GTM---------RKNVNVWKD-----------------WNTQAGLG-----LHAVQLNIL 292

Query: 390 KHAMSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +    N  ++VYSTCS++  ENE VV + +     ++WG K+             RS
Sbjct: 293 NRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRS 347

Query: 438 KVIPTWP------------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGF 485
           K +  WP              G ++ F     E+ +    +     C+R  P      GF
Sbjct: 348 KGVSKWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQ----NCMRVYPHQQNTGGF 403

Query: 486 FAVCFER 492
           F   FE+
Sbjct: 404 FITVFEK 410

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 114/307 (37%), Gaps = 72/307 (23%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + +  V+D CAAPG+KT      + K+ + +P   + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKD-TDEPTGFVVANDA 201

Query: 278 NPERAKILDKMIKVAGCSK------------NIKINVGDFTKIALPEKYKDVTGFIVDPS 325
           + +R+ +L   +K    +              IK +  D +  A   K+  V   + D  
Sbjct: 202 DSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVP 258

Query: 326 CSGSGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQ 385
           CSG G           RK +N                        R+        L + Q
Sbjct: 259 CSGDGTM---------RKNVNVW----------------------RDWTPQGGLGLHTVQ 287

Query: 386 FQVVKHAMSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV----------- 433
           F ++   +    N  ++VYSTCS++  ENE VV + +     ++WG K+           
Sbjct: 288 FNILNRGLHLLKNKGRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKLPG 342

Query: 434 APRSKVIPTWP---RRGKVEEFEEVFREDGNSSKCEELAG-----GCIRALPRSDGGIGF 485
             RSK +  WP   R     E  +    D      EE A       CIR  P      GF
Sbjct: 343 LVRSKGVSQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGF 402

Query: 486 FAVCFER 492
           F   FE+
Sbjct: 403 FITVFEK 409

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 112/301 (37%), Gaps = 64/301 (21%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + +  V+D CAAPG+KT       +     +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIE-ALHSSEDEPTGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIF 332
           +  R+ +L   +K    +  + +N     F ++   ++      F   + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTM 263

Query: 333 GRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLS-KLSSFQFQVVKH 391
                    RK +N                         +D  T     L + Q  ++K 
Sbjct: 264 ---------RKNVNVW-----------------------KDWGTASGLGLHTVQLNILKR 291

Query: 392 AMSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVA-----------PRSKV 439
            ++      ++VYSTCS++  ENE VV      + ++QWG K+             RSK 
Sbjct: 292 GLNLLKKGGRLVYSTCSMNPIENEAVVA-----AALRQWGDKIKLVDCSDKLPGLVRSKG 346

Query: 440 IPTWPRRGKVEEFEEVFREDGNSS----KCEELA----GGCIRALPRSDGGIGFFAVCFE 491
           I  WP   K  E +E   E    S      EE A      CIR  P      GFF    E
Sbjct: 347 ISNWPVIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIE 406

Query: 492 R 492
           +
Sbjct: 407 K 407

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 115/304 (37%), Gaps = 67/304 (22%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  +    V+D CAAPG+KT      +  + + +P   + A + 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMD-TDEPTGFVVANDA 204

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIAL---PEKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I +    +K KD+  F   + D  CSG 
Sbjct: 205 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSGD 264

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q+ ++
Sbjct: 265 GTM---------RKNVN-----------------VWKDWNTQSGL-----GLHTVQYNIL 293

Query: 390 KHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVA-----------PRS 437
              ++   +  ++VYSTCS++  ENE VV   +     + WG K+             RS
Sbjct: 294 NRGLNLLKSGGRLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLVRS 348

Query: 438 KVIPTWP---------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGFFAV 488
           + I  WP          +G     E  F      +K   L   CIR  P      GFF  
Sbjct: 349 QGISQWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLE-NCIRVYPHQQNTGGFFIT 407

Query: 489 CFER 492
             E+
Sbjct: 408 VIEK 411

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 116/307 (37%), Gaps = 73/307 (23%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      + K+ + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKD-TDEPSGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIAL---PEKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I L     K  D+  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 264 GTM---------RKNVN-----------------VWKDWNTQAGL-----GLHTVQLNIL 292

Query: 390 KHAMSFPNAK-KIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +    +  ++VYSTCS++  ENE V+ + +     ++WG K+             RS
Sbjct: 293 NRGLHLLKSNGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLIRS 347

Query: 438 KVIPTWP------------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGF 485
           K +  WP              G +E F     E+ +    +     C+R  P      GF
Sbjct: 348 KGVSKWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLK----NCMRVYPHQQNTGGF 403

Query: 486 FAVCFER 492
           F   FE+
Sbjct: 404 FISVFEK 410

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 117/302 (38%), Gaps = 66/302 (21%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYM-IKEPSKDPKIQIYAFE 276
           G I  Q+  S  P  +L  +    V+D CAAPG+KT      +  K P  +P   + A +
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGP--EPSGFVVAND 202

Query: 277 KNPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGI 331
            +  R+ +L   +K    +  I +N     F +I   E  KD   F   + D  CSG G 
Sbjct: 203 ADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGT 262

Query: 332 FGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLS-KLSSFQFQVVK 390
                     RK +N                         +D  T     L + Q  ++ 
Sbjct: 263 M---------RKNINVW-----------------------KDWATASGLGLHTVQVNILN 290

Query: 391 HAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVAP-----------RSK 438
             ++   +  ++VYSTCS++  ENE VV      + +++WG K+             RS+
Sbjct: 291 RGLNLLKDGGRLVYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRSQ 345

Query: 439 VIPTWPRRGKVEEFEEVFREDGNSS----KCEELAG----GCIRALPRSDGGIGFFAVCF 490
            I  WP   K    ++   E  ++S      EE++      C+R  P      GFF   F
Sbjct: 346 GISQWPVYDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVF 405

Query: 491 ER 492
           E+
Sbjct: 406 EK 407

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 117/299 (39%), Gaps = 69/299 (23%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + +  V+D CAAPG+KTT     + K+ + +P   + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKD-TDEPTGFVVANDA 201

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIAL---PEKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I L   P K K    F   + D  CSG 
Sbjct: 202 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGD 261

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 262 GTM---------RKNVN-----------------VWKDWNTQGAL-----GLHTVQLNIL 290

Query: 390 KHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRS 437
              +    N  ++VYSTCS++  ENE VV + +     ++WG KV             RS
Sbjct: 291 DRGLHLLQNNGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVRLVDCSEKLPGLIRS 345

Query: 438 KVIPTWPRRGKVEEFEEVFREDGNSSKC------EELAG----GCIRALPRSDGGIGFF 486
           + I  WP   +    EE  +ED            EE++      C+R  P      GFF
Sbjct: 346 QGITQWPVIDR--NMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 111/304 (36%), Gaps = 70/304 (23%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    N  V+D CAAPG+KT      +  +   +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQ-EDEPTGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIF 332
           + +R+ +L   +K    +  + +N     F +I      K+   F   + D  CSG G  
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGTM 263

Query: 333 GRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVVKHA 392
                    RK +N                        R+        L + Q  ++   
Sbjct: 264 ---------RKNVNVW----------------------RDWGTASGLGLHTVQLNILNRG 292

Query: 393 MSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APRSKVI 440
           ++   +  ++VYSTCS++  ENE V+      + +++WG K+             RSK I
Sbjct: 293 LNLLKDGGRLVYSTCSLNPIENESVIA-----AALRKWGDKIRLVNCDEKLPGLVRSKGI 347

Query: 441 PTWP------------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGFFAV 488
             WP              G +E +     E+      E     CIR  P      GFF  
Sbjct: 348 TQWPVYDKNFALKEKGDEGVIETWFPPTEEEATRFHLE----NCIRVYPHQQNTGGFFIT 403

Query: 489 CFER 492
            FE+
Sbjct: 404 VFEK 407

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 114/303 (37%), Gaps = 65/303 (21%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + +  V+D CAAPG+KT      + ++ S +P   + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRD-SNEPTGFVVANDS 197

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF------IVDPSCSGS 329
           +  RA +L   +K    +  + +N     F KI L     + +G       + D  CSG 
Sbjct: 198 DSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSGD 257

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q  ++
Sbjct: 258 GTM---------RKNVN-----------------VWKDWNTQNAL-----GLHNVQLNIL 286

Query: 390 KHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVA-----------PRS 437
              +    +  ++VYSTCS++  ENE VV      + +++WG K+             RS
Sbjct: 287 NRGLQLLKDNGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRS 341

Query: 438 KVIPTWPRRGK--------VEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGFFAVC 489
             I  W    +         E  +  + E  ++ K       C+R  P      GFF   
Sbjct: 342 NGISHWSVYDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAV 401

Query: 490 FER 492
           FE+
Sbjct: 402 FEK 404

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 108/304 (35%), Gaps = 67/304 (22%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      +  E + +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHME-NAEPTGFVVANDS 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALP---EKYKDVTGF---IVDPSCSGS 329
           +  R+ +L   +K    +  + +N     F +I L     K KD   F   + D  CSG 
Sbjct: 204 DYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGDNKAKDALKFDRILCDVPCSGD 263

Query: 330 GIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQVV 389
           G           RK +N                     +N +  L      L + Q+ ++
Sbjct: 264 GTM---------RKNVN-----------------VWKDWNTQAGL-----GLHTIQYNIL 292

Query: 390 KHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKVA-----------PRS 437
              +       ++VYSTCS++  ENE VV   +     + WG K+             RS
Sbjct: 293 NRGLHLLKTGGRLVYSTCSLNPIENEAVVARAL-----RTWGSKIKIINCDDKLPGLIRS 347

Query: 438 KVIPTWP---------RRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIGFFAV 488
             +  WP          +G     E  F           L   C+R  P      GFF  
Sbjct: 348 NGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQ-NCMRVYPHQQNTGGFFIT 406

Query: 489 CFER 492
             E+
Sbjct: 407 VIEK 410

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 109/308 (35%), Gaps = 74/308 (24%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      +  +   +P   + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMD-GPEPSGFVVANDS 197

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALP-------EKYKDVTGFIVDPSCSG 328
           + +R+ +L   +K    +  + +N     F KI L        ++Y      + D  CSG
Sbjct: 198 DSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCSG 257

Query: 329 SGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQV 388
            G           RK +N                     +N +  L      L + Q  +
Sbjct: 258 DGTI---------RKNVN-----------------IWKDWNTQNSL-----GLHNVQLNI 286

Query: 389 VKHAMS-FPNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWG----------------- 430
           +   +    +  ++VYSTCS+   ENE V+      + +++WG                 
Sbjct: 287 LNRGIQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLIS 341

Query: 431 ------WKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRSDGGIG 484
                 W+V  R+  I +       + + +   E+ N          CIR  P      G
Sbjct: 342 SPGISKWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSH----CIRVFPHQQNTGG 397

Query: 485 FFAVCFER 492
           FF    E+
Sbjct: 398 FFIAVLEK 405

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 115/308 (37%), Gaps = 74/308 (24%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      +  E S +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAE-SDEPSGFVIANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKINVG---------DFTKIALPEKYKDVTGFIVDPSCSG 328
           + +R+ +L   +K    +  + +N           D T+ +   ++      + D  CSG
Sbjct: 204 DYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCSG 263

Query: 329 SGIFGRKFIDSLNRKKMNXXXXXXXXXXXXXXXXXXXXXYNKREDLKTRLSKLSSFQFQV 388
            G           RK +N                     +N    L      L   Q  +
Sbjct: 264 DGTM---------RKNVNVWKD-----------------WNTGSGLG-----LHIVQLNI 292

Query: 389 VKHAMSF-PNAKKIVYSTCSIHAEENERVVIDLMLDSKVKQWGWKV-----------APR 436
           ++  ++      K+VYSTCS++  ENE V+      + +++WG KV             R
Sbjct: 293 LERGLNLLKEGGKLVYSTCSLNPIENEAVIA-----AALRRWGDKVRLVNCDDQLPGLVR 347

Query: 437 SKVIPTWPRRGKVEEFEEVFREDGNSS--------KCEELAG----GCIRALPRSDGGIG 484
           SK I  W    KV + +   RE G+ +          EE+       C+R         G
Sbjct: 348 SKGITEW----KVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGG 403

Query: 485 FFAVCFER 492
           FF   FE+
Sbjct: 404 FFITVFEK 411

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 49/120 (40%), Gaps = 6/120 (5%)

Query: 218 GKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEK 277
           G I  Q+  S  P  +L  + +  V+D CAAPG+KT       +     +P   + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIE-ALHATEDEPTGFVVANDA 203

Query: 278 NPERAKILDKMIKVAGCSKNIKIN--VGDFTKIALPEKYKDVTGF---IVDPSCSGSGIF 332
           +  R+ +L   +K    +  + +N     F ++ L         F   + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGTM 263

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 22/109 (20%)

Query: 209 ITSHNLYKQGKIIIQDRASCFPAHILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDP 268
           I  + L  QG   I D+A   P+        D+V++     GN TT      I E ++  
Sbjct: 38  ILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTTR-----ILEKAR-- 79

Query: 269 KIQIYAFEKNPERAKILDKMIKVAGCSKNIKINVGDFTKIALPEKYKDV 317
             ++ A E +P  A  L K +      K ++I +GDFTK  LP  Y DV
Sbjct: 80  --KVVAVEFDPRMAAELTKRVHGTAAEKKLEIILGDFTKTELP--YFDV 124

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
           YHR080C
          Length = 1708

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 193 YDEYIPNLFGIHPQDKIT-------SHNLYKQGKIIIQDRASCFPAHIL 234
           +  +  N+ GI P +K+        S ++ +QGK+ I DR  CF A+IL
Sbjct: 826 FHSFFKNINGISPDEKLIIDITCALSRDILQQGKMYITDRNICFNANIL 874

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,803,913
Number of extensions: 2107470
Number of successful extensions: 4948
Number of sequences better than 10.0: 66
Number of HSP's gapped: 4939
Number of HSP's successfully gapped: 88
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)