Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G037802.288ON95795746390.0
NDAI0G006702.288ON96891834610.0
Suva_14.3242.288ON96891232010.0
KAFR0H033002.288ON96694931720.0
Smik_14.3082.288ON96591331390.0
YNL023C (FAP1)2.288ON96591331300.0
Skud_14.3062.288ON97091831220.0
TDEL0G021902.288ON93690430510.0
KNAG0H019902.288ON97397330120.0
TBLA0B059502.288ON99591328640.0
CAGL0M06919g2.288ON95690528040.0
ZYRO0A01936g2.288ON95389227830.0
SAKL0E07634g2.288ON97490726580.0
TPHA0D015302.288ON96290426520.0
Kpol_1039.452.288ON96890926450.0
KLTH0G10406g2.288ON96389726020.0
Kwal_27.115182.288ON95388625380.0
KLLA0E08317g2.288ON92189623700.0
Ecym_33272.288ON92689822850.0
ADL213W2.288ON90890022430.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G03780
         (957 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1791   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1337   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1237   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1226   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1213   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1210   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1207   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1179   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1164   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1107   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1084   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1076   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1028   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...  1026   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1023   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1006   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   982   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   917   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   884   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   868   0.0  

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1791 bits (4639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 898/957 (93%), Positives = 898/957 (93%)

Query: 1   MGKDHISTGDEPDPKSLVXXXXXXXXXXXXXXXXXXXXXXXFAGMDDDAMHYYERAIQEI 60
           MGKDHISTGDEPDPKSLV                       FAGMDDDAMHYYERAIQEI
Sbjct: 1   MGKDHISTGDEPDPKSLVLELSDDDSNGESGNSDSSEYESDFAGMDDDAMHYYERAIQEI 60

Query: 61  AKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHV 120
           AKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHV
Sbjct: 61  AKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHV 120

Query: 121 NKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHLGPHPECTRIIT 180
           NKKVPPKNRPTCWCGKVV          SCGQTCNAHTCVHGCSKICHLGPHPECTRIIT
Sbjct: 121 NKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIIT 180

Query: 181 IKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILN 240
           IKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILN
Sbjct: 181 IKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILN 240

Query: 241 TKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCH 300
           TKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCH
Sbjct: 241 TKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCH 300

Query: 301 EHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGK 360
           EHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGK
Sbjct: 301 EHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGK 360

Query: 361 PLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCR 420
           PLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCR
Sbjct: 361 PLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCR 420

Query: 421 RHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCH 480
           RHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCH
Sbjct: 421 RHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCH 480

Query: 481 PGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTC 540
           PGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTC
Sbjct: 481 PGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTC 540

Query: 541 HPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLG 600
           HPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLG
Sbjct: 541 HPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLG 600

Query: 601 EXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATST 660
           E            RINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATST
Sbjct: 601 ECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATST 660

Query: 661 IPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKVATTFEELQL 720
           IPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKVATTFEELQL
Sbjct: 661 IPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKVATTFEELQL 720

Query: 721 PYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYA 780
           PYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYA
Sbjct: 721 PYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYA 780

Query: 781 EAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXXXXARTTTRLIN 840
           EAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQT              ARTTTRLIN
Sbjct: 781 EAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLIN 840

Query: 841 VEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALI 900
           VEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALI
Sbjct: 841 VEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALI 900

Query: 901 YPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGERLETPILEE 957
           YPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGERLETPILEE
Sbjct: 901 YPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGERLETPILEE 957

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1337 bits (3461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/918 (69%), Positives = 741/918 (80%), Gaps = 6/918 (0%)

Query: 43  AGMDDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALK 102
           A   D+ M YYER IQEIAKGDSYVCMICTVEMDYTCQMYACK+CYRVFDY+CIREWA+K
Sbjct: 51  ATAADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVK 110

Query: 103 STEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHG 162
           STEKTVDRIWKCPNCYHVNKKVPPKNR TCWCGKVV          SCGQTCNA  CVHG
Sbjct: 111 STEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHG 170

Query: 163 CSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHR 222
           C+ ICHLGPHPECTR+++I CRCGKHTKDI CYQS   +G  KFQC + CGLPL+CG+H+
Sbjct: 171 CTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHK 230

Query: 223 CQKKCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEK 282
           C++KCHSGLCG+CPE L   E     ++CYCGS+ + ++KC+D+ +P SA  S + +G K
Sbjct: 231 CKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNK 290

Query: 283 WVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVE 342
           W+GVF C  IR V Y C +HSF+E+CIAPPT+   KPCP+SPKLLKTCPCGKTPL++L +
Sbjct: 291 WIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAK 350

Query: 343 SRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQ 402
            R  CTDPIPTC+S C KPLKCG+H CPF CH G CMDPCLQI+ +KCSC QQSFLVPCQ
Sbjct: 351 PRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQ 410

Query: 403 FHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLK 462
           F   P C  KCESLMSCRRHRC ERCC+GRP AE RKK LFRSQDLMDE+LVE +HICLK
Sbjct: 411 FTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLK 470

Query: 463 ECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCI 522
           ECNL+LSCG H+CQRKCHPGKCPPCLESDSNDLVCPCG+TI+EAPVRCGTKLPPCP+ CI
Sbjct: 471 ECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCI 530

Query: 523 KVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICG 582
           KVVR EYPCGHTPMPHTCHPL+EPCPPCTA VFKPCKCGKV +VRTLCFQNDVSCGKICG
Sbjct: 531 KVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICG 590

Query: 583 LPLENCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKI 642
           LPL++C H C KRCH+ G+            RINC+HTC +PCHG T+CPD+PC+VS K+
Sbjct: 591 LPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKV 650

Query: 643 TCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVD-SNRSTSLE 701
           TCECGR+ETYVTCGA S I SA T T +ECDEECE+LERHRQLKEAFGI +  + ST LE
Sbjct: 651 TCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLE 710

Query: 702 VEKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPM 761
            E+LKD+   A  FEELQLP+ E TLSI+++QE+WC QIEEI+NK MDDK+RPSLHFKPM
Sbjct: 711 FERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPM 770

Query: 762 RPPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXX 821
           RPPQRHFI E +K++NLY E+QD EPKRSVF+KK  + +SSKP  SL   LPLYQT    
Sbjct: 771 RPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKEL 828

Query: 822 XXXXXXXXXXARTTTRLINVEAPQ--EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFL 879
                     ART+ RL+NVE P+   DN Y A+ +GFLIK +SPGTTVEDL+RIFGQ+L
Sbjct: 829 EKERKLQEFEARTSKRLVNVEVPEGPTDN-YIAEANGFLIKDLSPGTTVEDLERIFGQYL 887

Query: 880 TSTLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELC 939
            STLI NPQYL++QDGK  +IYPE+Y  ++A VERD ++LVGHFD ++K+ FI++GVELC
Sbjct: 888 KSTLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELC 947

Query: 940 DVEVAMLGERLETPILEE 957
            ++  +  ERL TP ++E
Sbjct: 948 KIDDVLSTERLATPAIDE 965

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1237 bits (3201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/912 (65%), Positives = 701/912 (76%), Gaps = 5/912 (0%)

Query: 47  DDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEK 106
           DD M YYERAIQEIAKGDSY+CMICTVEMDYTCQM+ACK+CYRVFDY CIREWALKSTEK
Sbjct: 51  DDDMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEK 110

Query: 107 TVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKI 166
           TVD+IWKCPNCYH+ KKVP +NRPTCWCGKVV          SCGQTCNA TCVHGCSKI
Sbjct: 111 TVDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKI 170

Query: 167 CHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKK 226
           CHLGPHPECTR + IKCRCGKH+K I CYQS  +  K  F C E CGLPL+CG+H+C+KK
Sbjct: 171 CHLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAM--KKHFDCQEECGLPLSCGIHKCKKK 228

Query: 227 CHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGV 286
           CHSGLCG CPE++ +++     I+CYCG   +D+IKC +V+ P S   S++  G +W+GV
Sbjct: 229 CHSGLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGV 288

Query: 287 FKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKK 346
           F C +IR VDY CH+HSF+E CI+PPT++G K CPF P LLKTCPCG+T L+EL + RK 
Sbjct: 289 FACKDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKH 348

Query: 347 CTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQD 406
           CTDPIPTC SRC KPLKCG+H+CPFICH G CMDPCLQ D  KC+C Q +FLVPC F + 
Sbjct: 349 CTDPIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEK 408

Query: 407 PQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNL 466
           P C  KCESLMSCRRHRC +RCC+GRP A  RKKR+FRSQDLMDESLVE QHICLK CNL
Sbjct: 409 PHCNIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNL 468

Query: 467 MLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVR 526
            LSCG HKCQRKCHPGKCPPCLESDSNDLVCPCG+T+I APVRCGTKLP C Y CIKVVR
Sbjct: 469 TLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVR 528

Query: 527 GEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLE 586
           GE  CGH PMPHTCHPL+  CPPCT +VFKPCKCGK DKVRT+CFQ DVSCG  CG PL 
Sbjct: 529 GESECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLS 588

Query: 587 NCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCEC 646
            C+HTCQK CHL               R NC+H C KPCHG+++CPD+PC+  +KITC+C
Sbjct: 589 GCHHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKC 648

Query: 647 GRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIV-DSNRSTSLEVEKL 705
           GR E  V CGA S + S      ++C+EECE L+R ++L+EAFGI  +SN ST+ E++ L
Sbjct: 649 GRIEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTL 708

Query: 706 KDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQ 765
           K L  VATTFEELQLP+ ET LS+YAKQE WC QIE I+NKLM DK R SLHFKPMRPPQ
Sbjct: 709 KKLVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQ 768

Query: 766 RHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXX 825
           RHFI+E AK++NLY+E+QDREP RSVF+KKE++  SS+PI+SL +A PLY++        
Sbjct: 769 RHFIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKER 828

Query: 826 XXXXXXARTTTRLINVEA-PQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLI 884
                 ARTT +LIN E    E  V  AK +GFL++K+  G  V+DL+R F   L  TL+
Sbjct: 829 KIQEFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLV 888

Query: 885 VNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVA 944
           V PQYLII DGK AL+YPENYQE+S   ERD++ LVGHFDF++KE F+AD + LC ++  
Sbjct: 889 VKPQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSID-E 947

Query: 945 MLGERLETPILE 956
            LG RL+ P+ +
Sbjct: 948 ELGRRLDPPVTQ 959

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1226 bits (3172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/949 (62%), Positives = 708/949 (74%), Gaps = 14/949 (1%)

Query: 12  PDPKSLVXXXXXXXXXXXXXXXXXXXXXXXFAGMDDDAMHYYERAIQEIAKGDSYVCMIC 71
           PDPKSLV                           D+D M YYERAIQEIA GDSY+CMIC
Sbjct: 19  PDPKSLVLEFSEDDTSSAASSDDEEMDVLS----DNDDMMYYERAIQEIAAGDSYICMIC 74

Query: 72  TVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKNRPT 131
           TVEMDYTC+MYACK+C R+FDY+CIREWALKSTEKT +RIWKCPNCYHVNKKVP KNR T
Sbjct: 75  TVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPTKNRAT 134

Query: 132 CWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKHTKD 191
           CWCGKVV          SCGQTCNA  C+HGCSKICHLGPHPEC R IT+KC CGKH + 
Sbjct: 135 CWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCGKHERQ 194

Query: 192 ISCYQSSLLRGK-DKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEYLDAHIR 250
           ISC+QS    G+ ++F C+E CGLPL+CG+H C+KKCHSGLCG CPE+L   E   A I+
Sbjct: 195 ISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNEEKCATIK 254

Query: 251 CYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQCIA 310
           CYCG + + +  C+DV  P   +LS++ +G KWVGVF C+ IRNV+Y C +HSFVE C+A
Sbjct: 255 CYCGLETKKSFPCKDVKAP--TTLSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVESCVA 312

Query: 311 PPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHTCP 370
           PPT+ GTK CPFSP LLKTCPCG+TPL  L + R KCTDP+PTC++ C KPLKCG+H CP
Sbjct: 313 PPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKHRCP 372

Query: 371 FICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERCCA 430
           F CH GPCMDPC+QIDKK CSC+Q  FL PCQF  +P C  KCESLMSCRRHRCTERCC+
Sbjct: 373 FTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTERCCS 432

Query: 431 GRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCLES 490
           GRP AE RKK LFRS D+ DE+LVE QH+CLKECNLMLSCGKH+CQRKCHPGKCPPCLES
Sbjct: 433 GRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPCLES 492

Query: 491 DSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCPPC 550
           DSNDLVCPCG+T++EAPVRCGTKL PC +PCIKV+R E  CGH P+PH+CHPL++PCPPC
Sbjct: 493 DSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPCPPC 552

Query: 551 TASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLGEXXXXXXXXX 610
           TA+VFKPCKCGK DKVRT+CFQ DVSCGKICGLPL  C+H CQK CH  GE         
Sbjct: 553 TATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHPNGECQVKCKQVC 612

Query: 611 XXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPSAATKTHI 670
              R+NC H CLK CHG T+C D PC VS KI+C CGR+E+YVTC ATSTI SAA  T +
Sbjct: 613 RKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDSAALITRL 672

Query: 671 ECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKVATTFEELQLPYNETTLSIY 730
           +C+EECE+++RHR+L+EAFGIV+     +L  E+L+  A+ AT +++LQLPY E  L  Y
Sbjct: 673 DCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQSATNYDDLQLPYTEPALVAY 732

Query: 731 AKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPKRS 790
            KQ  WC+QIEE+L K MDD +RPSLHFKPMRPPQR+FI E AK+FNLYAE+QDREPKRS
Sbjct: 733 TKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAESQDREPKRS 792

Query: 791 VFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXXXXARTTTRLINVEAPQEDNVY 850
           VF+KK +DG+S KP + L D LP+YQ               ARTT RL+N+    +D + 
Sbjct: 793 VFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITL--DDTLE 850

Query: 851 HAK---YSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENYQE 907
             K    +G +IK +S G T+E L   F +F  STLI NPQYLII++  + LIYPE++ E
Sbjct: 851 ERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIEN--NGLIYPESHNE 908

Query: 908 MSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGERLETPILE 956
           ++ GV  DL+ LVGHF+ I KE  I D VE+C++E  +  ERLETP LE
Sbjct: 909 ITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELPEERLETPRLE 957

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1213 bits (3139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/913 (63%), Positives = 698/913 (76%), Gaps = 5/913 (0%)

Query: 47  DDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEK 106
           DD M YYER+IQEI+KGDSY+CMICTVEMDYTCQM+ACK+CYRVFDY CIREWA+KSTEK
Sbjct: 47  DDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEK 106

Query: 107 TVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKI 166
           TVDRIWKCPNCYHV KKVP  NRPTCWCGKVV          SCGQTC+A  C+HGCSK 
Sbjct: 107 TVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKT 166

Query: 167 CHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKK 226
           CHLGPHPECTR++ I C CGKH++ I CYQS  +  K  F+C E CGLPL+C +H C++K
Sbjct: 167 CHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM--KKNFKCQEECGLPLSCSVHNCKRK 224

Query: 227 CHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGV 286
           CH+GLCG CPE++ +K+  +  I+CYCG+  R +IKC +   P S   S++  G +W+GV
Sbjct: 225 CHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGV 284

Query: 287 FKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKK 346
           F C +IR VD+ C +HSF+E C++PP+++G K CPF P LLKTCPCG+T L EL + RK 
Sbjct: 285 FACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKH 344

Query: 347 CTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQD 406
           C DPIPTC+SRC KPLKCG+H+CPFICH   CMDPCLQID  KC+C Q +F VPC F   
Sbjct: 345 CDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGR 404

Query: 407 PQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNL 466
           P+C  KCESLMSCRRHRCT+RCC+GRP A  R+K  FRSQDL+DESLVE +HICLK CNL
Sbjct: 405 PRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNL 464

Query: 467 MLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVR 526
            LSCG HKCQRKCHPGKCPPCLESDSNDL+CPCG+T++ APVRCGT+LP C +PCIKVVR
Sbjct: 465 TLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVR 524

Query: 527 GEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLE 586
           GE  CGH PMPHTCHPL  PCPPCT +VFKPCKCGK DKVRT+CFQ DVSCG  CGL L 
Sbjct: 525 GESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLH 584

Query: 587 NCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCEC 646
            C HTCQK CHL G             R++C HTC KPCHGKT+CPD+PC   +KITC+C
Sbjct: 585 FCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKC 644

Query: 647 GRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIV-DSNRSTSLEVEKL 705
           GR E  VTC A S +  A   + ++CDEECE L+R ++L+EAFGI  +SN  TS E++ L
Sbjct: 645 GRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDAL 704

Query: 706 KDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQ 765
           K L  VATTFEEL LP+ ETTLS+Y+KQE+WC QIE ILNKLMDDK R SLHFKPMRPPQ
Sbjct: 705 KKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQ 764

Query: 766 RHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXX 825
           RHFI+E AK++ LY+E+QDREP RSVF+KKE++G+S+KP++SL +ALPLY++        
Sbjct: 765 RHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKER 824

Query: 826 XXXXXXARTTTRLINVEAPQ-EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLI 884
                 +RTT +LIN E    +  V  AK +GFL++ +  G TVEDL+R F   L  TL+
Sbjct: 825 KVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLV 884

Query: 885 VNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVA 944
           VNPQYLI+ DGK AL+YPENY+  S   ERD+E LVGHFDF++KE F+AD + LC  +  
Sbjct: 885 VNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTD-E 943

Query: 945 MLGERLETPILEE 957
            +G+RL+TP+++E
Sbjct: 944 EVGKRLDTPVIQE 956

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1210 bits (3130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/913 (63%), Positives = 690/913 (75%), Gaps = 5/913 (0%)

Query: 47  DDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEK 106
           DD M YYERAIQEI+ GDSYVCMICTVEMDYTCQM+ACK+CYRVFDY CIREWALKSTEK
Sbjct: 47  DDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEK 106

Query: 107 TVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKI 166
           TVDRIWKCPNCY+V+K+VP KNRPTCWCGKVV          SCGQTCNA TC+HGCSKI
Sbjct: 107 TVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKI 166

Query: 167 CHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKK 226
           CHLGPHPECTR++ I C CGKH+K I CYQS ++  K  F C E CGLPL+C +H C+KK
Sbjct: 167 CHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVM--KKNFNCQEVCGLPLSCSIHTCKKK 224

Query: 227 CHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGV 286
           CH GLCG CPE++ +K+     I+CYCG+  R  IKC +   P S   S++  G +W+GV
Sbjct: 225 CHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGV 284

Query: 287 FKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKK 346
           F C + R VDY C +HSF+E CI+PPTI+G K CPF P  LKTCPCG+T L+EL + RK 
Sbjct: 285 FACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKH 344

Query: 347 CTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQD 406
           C DPIPTCDSRCGKPLKCG+H+CPF CH   CM+PCLQID  KC+C Q +F VPC F   
Sbjct: 345 CDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGR 404

Query: 407 PQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNL 466
           P+C  KCESLMSCRRHRCT+RCC+GRP A  RKK LFR+QDL+DESLVE +HICLK CNL
Sbjct: 405 PRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNL 464

Query: 467 MLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVR 526
            LSCG HKCQRKCHPGKCPPCLESDSNDLVCPCG T++ APVRCGTKLP C +PCIKVVR
Sbjct: 465 TLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVR 524

Query: 527 GEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLE 586
           GE  CGH PMPHTCH L+  CPPCT +VFKPCKCGK  KVRT+CFQ DVSCG  CG+PL 
Sbjct: 525 GESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLS 584

Query: 587 NCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCEC 646
            C HTCQK CHL G             R+NC H C KPCHGKT+CPD+PC+  +KI C+C
Sbjct: 585 YCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKC 644

Query: 647 GRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIV-DSNRSTSLEVEKL 705
           GR +  VTCGA S   S    + ++C+EECE L+R ++LKEAFGI  ++N  TS E++ L
Sbjct: 645 GRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDAL 704

Query: 706 KDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQ 765
           K L  VATTFEELQLP+ E  LS+Y+KQE+WC QIE ILNKLMDDK R SLHFKPMRPPQ
Sbjct: 705 KKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQ 764

Query: 766 RHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXX 825
           RHFI+E AK++ LY+E+QDREP RSVF+KKE++G+S+KP++SL +A PLY++        
Sbjct: 765 RHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKER 824

Query: 826 XXXXXXARTTTRLINVEAPQ-EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLI 884
                 ARTT +LIN E    E  V  AK +GFL++ +  G T EDL+R F   L  TL+
Sbjct: 825 KAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLV 884

Query: 885 VNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVA 944
           VNPQYLI+ DGK AL+YPENY+  S   ERD+E LVGHFDF++KE F+AD + LC  E  
Sbjct: 885 VNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTE-E 943

Query: 945 MLGERLETPILEE 957
            L  RL+TP+++E
Sbjct: 944 ELERRLDTPVIQE 956

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1207 bits (3122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/918 (62%), Positives = 688/918 (74%), Gaps = 5/918 (0%)

Query: 42  FAGMDDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWAL 101
           F    DD + YYERAIQEIAKGDSY+CMICTVEMDYTCQM+ACK+CYRVFDY CIREWAL
Sbjct: 47  FEEESDDDLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWAL 106

Query: 102 KSTEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVH 161
           KSTEKTVD+IWKCPNCYHV KKVP +NRPTCWCG VV          SCGQTCNA TCVH
Sbjct: 107 KSTEKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVH 166

Query: 162 GCSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLH 221
           GC KICHLGPHPECTR++ IKC CG+H+K I CYQS  +R   +F C E CGL L+CG+H
Sbjct: 167 GCFKICHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMR--RRFNCQEECGLSLSCGVH 224

Query: 222 RCQKKCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGE 281
           +C+KKCHSGLCG CPE +   +     I+CYCG+  +++IKC +   P S   S++  G 
Sbjct: 225 KCKKKCHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGN 284

Query: 282 KWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELV 341
           +W GVF C +IR VDY CH+HSF+E C++PPTI G K CPF P LLKTCPCG+T L+EL 
Sbjct: 285 EWAGVFACADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELT 344

Query: 342 ESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPC 401
           + RK C DPIPTC+SRC KPLKCG+H CPF CH G CMDPCLQID   CSC Q +F +PC
Sbjct: 345 KPRKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPC 404

Query: 402 QFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICL 461
            F + P+C  KCESLMSCRRHRC +RCC+GRP A  RKK  FRSQDL+DESLVE +HICL
Sbjct: 405 GFQESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICL 464

Query: 462 KECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPC 521
           K CNL LSCG HKCQRKCHPGKCPPCLESDSNDL+C CG+T++ APVRCGTKLP C +PC
Sbjct: 465 KPCNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPC 524

Query: 522 IKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKIC 581
           IKVVRGE  CGH PMPHTCHP N  CPPCT +VFKPC+CGK DKVRT+CFQ DVSCG  C
Sbjct: 525 IKVVRGESWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSC 584

Query: 582 GLPLENCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIK 641
           G+PL  C HTCQK CHLLG+            R++C HTC KPCHGKT+CPD+PC+  +K
Sbjct: 585 GIPLSGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVK 644

Query: 642 ITCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDS-NRSTSL 700
           ITCECGR +  +TC A     S  T + ++C+EECE L+R ++L+EAFG+ +  N     
Sbjct: 645 ITCECGRIKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRN 704

Query: 701 EVEKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKP 760
           E++ L +L  VA TFEELQLP+ E TLS+Y+KQE+WC QIE ILNKLMD + R SLHFKP
Sbjct: 705 ELDALSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKP 764

Query: 761 MRPPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXX 820
           MRPPQRHFI E AK++NLYAE+QDREP RSVF+KKE++ +S KP++SL +A PLY++   
Sbjct: 765 MRPPQRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQ 824

Query: 821 XXXXXXXXXXXARTTTRLINVEAPQ-EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFL 879
                      ARTT +LIN E    E  +  AK +GFL++ +  G TVEDL+R F   L
Sbjct: 825 SQKERKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHL 884

Query: 880 TSTLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELC 939
             TL+ NPQYLI+ D + ALIYPENY+  S   ERD+E LVGHFDF++KE F+AD + LC
Sbjct: 885 KHTLVANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLC 944

Query: 940 DVEVAMLGERLETPILEE 957
            V+   +G+RL++P ++E
Sbjct: 945 SVD-EEIGKRLDSPAIQE 961

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1179 bits (3051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/904 (62%), Positives = 677/904 (74%), Gaps = 4/904 (0%)

Query: 46  DDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTE 105
           D+  M YYERA+QEIA GD YVCMICTVEMDYTC+MYAC+ CYRVFDYECIREWALKSTE
Sbjct: 34  DEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTE 93

Query: 106 KTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSK 165
           KT+DR+WKCPNCY VNK+VP KNRPTCWCGK V          SCGQTC+A  C HGCSK
Sbjct: 94  KTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSK 153

Query: 166 ICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQK 225
            CHLGPHP+C R IT KC+CGKHT++  CYQ+  ++GK +FQC+E CGLPLACG+H+C++
Sbjct: 154 QCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCER 213

Query: 226 KCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVG 285
            CHSG+CG CP +LN K      IRCYCG + RD+ KC+DV V  ++ LS++ KG+ W+G
Sbjct: 214 LCHSGICGPCPAVLNAKSN-KLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDSWIG 270

Query: 286 VFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRK 345
            F C  IR ++Y C EHSFVE+C   P+I G   CPFSPKLLKTCPCG+T LK L E RK
Sbjct: 271 AFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRK 330

Query: 346 KCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQ 405
            CT PIP CDS CGK L CGRHTCPF CH GPCMDPC+QI+  +CSC++  + VPCQF +
Sbjct: 331 SCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKE 390

Query: 406 DPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECN 465
            P+C TKCESLMSCRRHRCTERCC GRP AE R+K    S++LMDES VE +HICLK+CN
Sbjct: 391 QPRCDTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCN 450

Query: 466 LMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVV 525
           L LSCG HKCQRKCHPGKCPPCLESDSNDLVCPCG+T++EAPVRCGT+LPPC YPCI+V+
Sbjct: 451 LTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVI 510

Query: 526 RGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPL 585
           +  Y CGH PMPHTCHPLNEPCP CTA VFKPCKCGK DKVRTLCFQNDVSCG  CG PL
Sbjct: 511 QNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPL 570

Query: 586 ENCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCE 645
           +NC H CQK CH+ GE            RI C+H C   CHG   CPDIPC +S+KI CE
Sbjct: 571 DNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCE 630

Query: 646 CGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVD-SNRSTSLEVEK 704
           C  KE+++TCGA S  PS AT T + CDEECE  +RH QL+EAFGI + S+  +  +   
Sbjct: 631 CEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTAS 690

Query: 705 LKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPP 764
           L++LA VA +FEEL+LP++E  L  +AKQE WC QIE +LN  MD++ + SLHFKPMRP 
Sbjct: 691 LENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPA 750

Query: 765 QRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXX 824
           QRHFI E AKS+NLY E+QDREPKRSVFVKK+++G S KP+I L D+LP+YQ        
Sbjct: 751 QRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKE 810

Query: 825 XXXXXXXARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLI 884
                  A+TTT  +N    +E  +  AK + F +K +S GTT EDL+RIF   L  TL+
Sbjct: 811 KKAQRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870

Query: 885 VNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVA 944
            NPQ+ I    K+ LIYPE+Y E+S  VERDLE LVGHFD++ KE+FI DG+ELC +++ 
Sbjct: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLK 930

Query: 945 MLGE 948
           +L E
Sbjct: 931 VLQE 934

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/973 (58%), Positives = 699/973 (71%), Gaps = 24/973 (2%)

Query: 6   ISTGDEPDPKSLVXXXXX--XXXXXXXXXXXXXXXXXXFAGMD---DDAMHYYERAIQEI 60
           I+   +PDPKSLV                          A  D   D  + YYERA++EI
Sbjct: 2   IADDGKPDPKSLVLNFSSDDEDSATEANITYSEEEEEEIATSDTEEDQDLPYYERAVREI 61

Query: 61  AKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHV 120
           AKGD Y CMICTVEMDYTC+M+AC++CYRVFDY+C+REWA+KST+KTVDRIWKCPNCY V
Sbjct: 62  AKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLV 121

Query: 121 NKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHLGPHPECTRIIT 180
           NKKVP KNRPTCWCGKVV          SCGQTC+A  C+HGCSKICHLGPHPEC R  +
Sbjct: 122 NKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTS 181

Query: 181 IKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILN 240
           +KCRCGK TK+I C+++   RG++ FQC+EPC   L CG+HRCQK CHSGLCG CPE L 
Sbjct: 182 VKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLT 241

Query: 241 TKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCH 300
            KE  D  I CYCG   R++IKC+DV+V  +   S+N  G++W+GV+ C +IR+V+Y C 
Sbjct: 242 VKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYACKDIRSVEYSCR 299

Query: 301 EHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGK 360
           +HSF E+CIAPPT+ GTK CPFSPK LKTC CGKTPL+ L ++R++C DPIP C+SRC K
Sbjct: 300 QHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDK 359

Query: 361 PLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCR 420
            LKCG+HTCPF CH GPCMDPC+QIDK KC+C + +FLVPC F   P C  KCESL+SCR
Sbjct: 360 LLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCR 419

Query: 421 RHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCH 480
           RH+C ERCC+GRP AE R+K   R QD+ DE+L+E +H+CLK CNL LSCG+H+CQRKCH
Sbjct: 420 RHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCH 479

Query: 481 PGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTC 540
           PGKCPPCLESDSNDLVCPCG+TI+ APVRCGTKLP C +PCIKVV G   CGH P+PH C
Sbjct: 480 PGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHAC 539

Query: 541 HPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLG 600
           HPL++PCPPCTA+VFKPCKCGK  +VRT+CFQ DVSCG+ CG PL NC+H CQK CHL G
Sbjct: 540 HPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPG 599

Query: 601 EXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATST 660
           +             +NC H C K CHG+  CPDI C   +KI C CGRKE  VTCGATST
Sbjct: 600 QCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATST 659

Query: 661 IPSAATKTHIECDEECELLERHRQLKEAFGIVD--SNRSTSLEVE--KLKDLAKVATTFE 716
           + S+     +ECDEECE   RHRQLKEAFGI D  +N S   E E  +L+ LA  ATTFE
Sbjct: 660 LSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFE 719

Query: 717 ELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSF 776
           ELQ P+ E+T+S Y +Q KWC +IEE LN  MD++ + SLHFKPM+PPQR FI+E AK++
Sbjct: 720 ELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAY 779

Query: 777 NLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXXXXARTTT 836
           NLY+EAQD EPKRSVFVKK +DGSS+KPI SL +  PLYQ+              A+TTT
Sbjct: 780 NLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTT 839

Query: 837 RLINVEAPQEDNVYHAKYSG----FLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLII 892
            LINV+   +D    A++SG    FLIK IS GTT++DL+ +FG+++  TLI NPQY  +
Sbjct: 840 HLINVKL-NDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQEL 898

Query: 893 QDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAM------- 945
            +   A++YPE+Y+ +SA    D+E LVGH +FI  + F+AD  ELCD    +       
Sbjct: 899 PEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISEN 958

Query: 946 -LGERLETPILEE 957
            + ERLETP ++E
Sbjct: 959 DISERLETPEVQE 971

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1107 bits (2864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/913 (58%), Positives = 662/913 (72%), Gaps = 5/913 (0%)

Query: 47  DDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEK 106
           ++ + YYERA++EIAKGDSY CMICTVEMD+TC+MYAC+ CYRVFDY+CIREWALKST+K
Sbjct: 66  EEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQK 125

Query: 107 TVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKI 166
           TVD+ WKCPNCYH +KKVP K+RPTCWCGKVV          SCGQTCNA+ C H C K 
Sbjct: 126 TVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQ 185

Query: 167 CHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKK 226
           CHLG HPECT+++ I CRCG+ TKDI C++S   R K  F CD+ CGL L CG+H+C++K
Sbjct: 186 CHLGSHPECTQLLKITCRCGRETKDIYCHESR--RQKSIFHCDQECGLTLPCGIHKCRRK 243

Query: 227 CHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGV 286
           CHSGLCG CPE+L   E +   I+CYCG      + C+DV  P S  +S+N + ++WVG+
Sbjct: 244 CHSGLCGSCPELL-IDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGI 302

Query: 287 FKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKK 346
           F C  +R+V Y C+EH FVE CIAPPT+  T  CPFSP LLKTCPCGKT L+++   R K
Sbjct: 303 FDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTK 362

Query: 347 CTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQD 406
           CTDPIPTCD+ C K LKCG+H CPF CH G CMDPC+QIDK  C+C +++FLVPCQF   
Sbjct: 363 CTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGK 422

Query: 407 PQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNL 466
           P C  KCESLMSCRRHRC E CC+GRP AE RKK + RS D  DE+LVE +H+CLK+CNL
Sbjct: 423 PVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNL 482

Query: 467 MLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVR 526
            LSCG H CQRKCHPG CPPCLESDSNDLVCPCG+T+I APVRCGT LPPC YPCIKV+R
Sbjct: 483 KLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIR 542

Query: 527 GEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLE 586
           GE  CGH PMPH+CH L++PCP CTA VFKPCKCGK DKVRT+CFQ DVSCG  CGLPL+
Sbjct: 543 GESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLK 602

Query: 587 NCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCEC 646
           +C H CQKRCHL GE            R NC H C + CH    CPDIPC+V + + C+C
Sbjct: 603 DCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDC 662

Query: 647 GRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVD--SNRSTSLEVEK 704
           GR++    C +TSTI S    +H+ECDEEC LL R  +LK AFGIV+   +  TS+ +E+
Sbjct: 663 GRRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIER 722

Query: 705 LKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPP 764
           +++   VA  +EEL+LP+ E  L++YAKQ KWC QIE ILNK MD+K + SLHFK M+ P
Sbjct: 723 IQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAP 782

Query: 765 QRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXX 824
           QR F+   A ++ +Y+E+QD EP RSVFVKK  +G+SSKPI++L +ALPLY++       
Sbjct: 783 QRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKE 842

Query: 825 XXXXXXXARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLI 884
                  ART   LINVEA  +      KY+GFLIK +  GTT EDL+RIFG+ L  TL+
Sbjct: 843 KKKQEYEARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLV 902

Query: 885 VNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVA 944
            +PQYL++ +     I P +Y E+S  VERD+E L+G FD + KE+FI D VELC+++ A
Sbjct: 903 KDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEA 962

Query: 945 MLGERLETPILEE 957
           +L E ++    EE
Sbjct: 963 LLQENVDLEDSEE 975

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/905 (57%), Positives = 650/905 (71%), Gaps = 10/905 (1%)

Query: 46  DDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTE 105
           D+  M YYE+A+QEI KGDSY C+ICTVE+DYTC++YAC++CYRV+DYECIREWA KST 
Sbjct: 55  DEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTS 114

Query: 106 KTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSK 165
           K  D++W CPNC++  K +P KNRPTCWCG+ V          SCGQTCNA  C HGCS+
Sbjct: 115 KRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQ 174

Query: 166 ICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQK 225
           ICHLGPH ECTR+++IKC CGK TKDI C+Q  L      F C+  C   L CG+H+C +
Sbjct: 175 ICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLY--SKGFNCETVCDKLLPCGIHKCNR 232

Query: 226 KCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVG 285
           KCH+GLCG CPE + +K   +  IRCYCG   +D IKC+DV  P +A+ S++ KG++W+G
Sbjct: 233 KCHTGLCGSCPETIISKN-TNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIG 291

Query: 286 VFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRK 345
           VF CD IR V Y+C EHSF E+C APP+I G   C FSPK LKTCPCGK  L +L + R 
Sbjct: 292 VFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRS 351

Query: 346 KCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQ 405
           KCTD IPTC   CGK LKCG+H CPF CH+G CMDPC QI+K +C+C Q+ F +PC F+ 
Sbjct: 352 KCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFND 411

Query: 406 DPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRL-FRSQDLMDESLVEPQHICLKEC 464
             +C  KCESLMSCRRHRCTERCCAGRP AE R+K +    +DL DES +EP HICLK+C
Sbjct: 412 HARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDC 471

Query: 465 NLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKV 524
           NL LSCG HKC RKCH GKCPPCLESDSNDLVCPCG+TI+EAPVRCGTKLP CPYPCI+V
Sbjct: 472 NLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRV 531

Query: 525 VRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLP 584
           VRGE  CGH+PMPH CHP + PCP CTA+VFKPCKCGK  +VRT+CF  DVSCGK+CG  
Sbjct: 532 VRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGER 591

Query: 585 LENCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITC 644
           L+ C H CQK+CH  G             R+ C H C KPCH   +CPDIPC+  +KITC
Sbjct: 592 LQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITC 651

Query: 645 ECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRST-SLEVE 703
            CGR E  VTCG  S    A   T I CDEEC +L+RH QLKEAFGIVD  ++T + E+ 
Sbjct: 652 PCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMA 711

Query: 704 KLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRP 763
           +L+ +   A+TF +L LP+ E  ++ Y + E WC  IE  LNKL+DD  R SLHFKPMRP
Sbjct: 712 RLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRP 771

Query: 764 PQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXX 823
           PQR+FI+E AK++NLY+E+QD EP RSVFVKK  DGSS+KPI+S+ +A PLYQ+      
Sbjct: 772 PQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEK 831

Query: 824 XXXXXXXXARTTTRLINVE---APQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLT 880
                   + TTTRLIN     +P+ ++   A+++GFL+  +   T+ +DLQ +F  +L 
Sbjct: 832 EKKQANFESMTTTRLINFTPEMSPELESA--ARFNGFLVTNVGEFTSTDDLQNLFAPYLK 889

Query: 881 STLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCD 940
           STL+V PQ+ I+ + K A+IYP  Y+E+S  VERD+ETLV HFDF+ KE+ +A GVELC+
Sbjct: 890 STLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCN 949

Query: 941 VEVAM 945
           +E  +
Sbjct: 950 IENVL 954

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/892 (58%), Positives = 649/892 (72%), Gaps = 7/892 (0%)

Query: 50  MHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVD 109
           M YYERA++EIA+GD+YVCMICTVEMDYTC+M+AC +CYRVFDY+CIREWALKST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 110 RIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHL 169
           + WKCPNC   + KVP K+RPTCWCGKVV          SCGQTC+A  C HGCSK+CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 170 GPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHS 229
           GPHPECTRII+IKC+CG+HT+D+ C +    R + +F C+E CGL L CG+H+C KKCHS
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQ-QFTCEESCGLLLPCGVHKCSKKCHS 234

Query: 230 GLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKC 289
           GLCG C E L++K    A I+CYCG  +  +I+C DV V    S+    +G  W+GVF+C
Sbjct: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDD--QGNGWIGVFRC 292

Query: 290 DNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTD 349
            ++R V+Y C +HSFVE C   P++     CPFSP +L++CPCG+TPL +L ++R KCTD
Sbjct: 293 KDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTD 352

Query: 350 PIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQC 409
            IPTC+S+CGK L CG+HTCP+ CH G CMDPC+Q +K  C C  +SFLVPCQF +DP+C
Sbjct: 353 HIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRC 412

Query: 410 TTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLS 469
            TKCESLMSCRRHRCTE+CC+G+P AE RKK  F S++L+DESLVE +H+CLK CNL L+
Sbjct: 413 NTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLT 472

Query: 470 CGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEY 529
           CG+HKCQRKCHPG+CPPCLESD NDLVCPCG+T++EAPVRCGTKLPPCPY CI VVR  Y
Sbjct: 473 CGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGY 532

Query: 530 PCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCN 589
           PCGHTPMPH CHP  E CPPCTA+V KPCKCGK   VRTLCFQ DVSCG+IC  PL +C 
Sbjct: 533 PCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCR 592

Query: 590 HTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRK 649
           HTCQK+CH  G             R+NC+H C KPCHG   CPD PC  S+ I C CGRK
Sbjct: 593 HTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRK 651

Query: 650 ETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLA 709
           E+   CG  S   SA+    + CDEECE ++R  QLK+A G+ ++  S+   VE     A
Sbjct: 652 ESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSS---VENTVSNA 708

Query: 710 KVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFI 769
            VA+ FEEL LP+ ET L+IY++Q+++CD IE +LN  +DD+ + SLHFKPM+P QRHF+
Sbjct: 709 LVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFV 768

Query: 770 QEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXX 829
            E AK++ LY+E+QD EPKRSV+VKKE +G S+KP I+L +ALP+YQ             
Sbjct: 769 HELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRR 828

Query: 830 XXARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQY 889
              +  T L+N     E  V  AKY+GFLI+ ++ GT  EDLQRI+G+ L  TL+ NP Y
Sbjct: 829 YEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVY 888

Query: 890 LIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDV 941
             + D   ALI+PE+Y +++   E D+E LVGHFDFI KE FI DGVELC V
Sbjct: 889 KALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQV 940

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/907 (56%), Positives = 636/907 (70%), Gaps = 22/907 (2%)

Query: 52  YYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRI 111
           YYE+ I EI KGDSY CMICT+EMDYTC MYAC +CYRV+D+ECIREWALKS++K++D+ 
Sbjct: 50  YYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKT 109

Query: 112 WKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHLGP 171
           WKCPNCY+VN ++P KNR TCWCGKVV          SCGQTCNA  C HGCSK CHLGP
Sbjct: 110 WKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGP 169

Query: 172 HPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGL 231
           HPEC R   +KC CGKHTKD+ CYQS     K  +QC EPC L L CG+H+CQ+KCHSG 
Sbjct: 170 HPECMRTTKVKCLCGKHTKDMFCYQSE--EEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 232 CGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDN 291
           CG C E ++ K      I CYCG + R+ I C+DV    S + S+N  GE W+GVF C +
Sbjct: 228 CGNCEETISGK------IMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAH 278

Query: 292 IRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPI 351
           +R+V+Y C  HSF E C APPT  G   CPFSP+LLKTCPCG TPLK L   RKKCTDPI
Sbjct: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338

Query: 352 PTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTT 411
           PTC++RC KPLKCG+H+CPF+CH GPCMDPC+ +DK  CSC+ +SFLVPCQFH +  C T
Sbjct: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398

Query: 412 KCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCG 471
           KCESLMSCRRHRCTERCC+GR  A  R+K +F ++D +DESLVE QHICLK CNL LSCG
Sbjct: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458

Query: 472 KHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPC 531
            H C+RKCHPGKC PCLESDSNDL CPCG+T++ APVRCGTKLPPC +PCIK ++ +  C
Sbjct: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518

Query: 532 GHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHT 591
           GH PMPH CH L +PCP CTA ++K CKC KV+KVRTLCFQNDVSCGKICGLPL+NC+HT
Sbjct: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578

Query: 592 CQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKET 651
           C++ CH  G+            R  CEH C   CH   DCPD  C V +K+TC CGRKE+
Sbjct: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638

Query: 652 YVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKV 711
            + C A +  PS+     + CD++CE  +RHR L EAFGI       +  VE+L+DL + 
Sbjct: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGI---KEKLTAPVEELRDLVES 695

Query: 712 ATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQE 771
           A +F+EL LP+ E+TLS+Y+KQ  WC+QIE  L+KLM D  R SLHFKPM+ PQR FI E
Sbjct: 696 AKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHE 755

Query: 772 FAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXXXX 831
            A ++ LY+E+QDREPKRSVFVKK E+  S  P++ L +ALPLY +              
Sbjct: 756 LANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKELE 814

Query: 832 ARTTTRLINVEAPQEDNVYH-AKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYL 890
             TT RL N      ++V H A+++ FL+K ++PG T ++L     ++L  TLI NP Y 
Sbjct: 815 KSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQ 874

Query: 891 IIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGERL 950
            +++G D LIYPE++  +S  VE D++ L  +   I KE  I++GV+L  ++     E L
Sbjct: 875 TLENG-DFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKID-----ENL 928

Query: 951 ETPILEE 957
           +T   EE
Sbjct: 929 KTFTSEE 935

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/904 (54%), Positives = 636/904 (70%), Gaps = 13/904 (1%)

Query: 46  DDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTE 105
           +DD + YYE+ I++I+KGD Y CMICT+EMDYTC+MYAC+ CYRVFDYECI+EWA KS  
Sbjct: 41  EDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSAS 100

Query: 106 KTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSK 165
           KT+D++WKCPNC H +K++P +NRPTCWCGKV+          SCGQTCN  TCVHGC  
Sbjct: 101 KTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKN 160

Query: 166 ICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQK 225
            CHLGPH EC+ I T+KC+CG++ KDI C+Q       + +QC+E C LPLACG+H+C++
Sbjct: 161 FCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKR 220

Query: 226 KCHSGLCGICPEILNTKEYLDAH------IRCYCGSQDRDTIKCRDVHVPLSASLSQNLK 279
            CHSGLCG CPEIL++++            +CYCG   ++ I C+ +   ++ + S+N +
Sbjct: 221 VCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKL--AITGTFSKNSE 278

Query: 280 GEKWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKE 339
           G+KW+G F C   R V Y C+EHSF+E C A  +I G K CP++PKLL +CPCGKT LK+
Sbjct: 279 GDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQ 338

Query: 340 LVESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLV 399
           L + RKKCTDPIPTC++RCGK LKCG+HTCP+ICH G CMDPC+Q++   CSC Q+ FLV
Sbjct: 339 LAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLV 398

Query: 400 PCQFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHI 459
           PC F Q P+CT KCESLMSCRRHRC ++CC G+P A+ RKK L   ++L DESLVE  HI
Sbjct: 399 PCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHI 458

Query: 460 CLKECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPY 519
           CLKECNL LSCG H C RKCHPG+CP CL SDSNDLVCPCG+T+IEAPVRCG+KLPPCP+
Sbjct: 459 CLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPF 518

Query: 520 PCIKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGK 579
            CIKV+   YPCGH P PH CHP  EPCPPCTA V +PCKCGK   V+ +CFQ   SCG+
Sbjct: 519 ECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGE 578

Query: 580 ICGLPLENCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVS 639
           IC   LENC+H CQ +CH +G+            R NC H C   CHG + CPD+PC+  
Sbjct: 579 ICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEV 638

Query: 640 IKITCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTS 699
            K++C+CGRK+ Y  C AT    SA+ +  + CDE+CE   RH QL++AFG   S  +++
Sbjct: 639 TKVSCKCGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFGYDSSLDTSN 697

Query: 700 LEVEKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFK 759
             ++ ++ L +  +T+EEL+LPY ++ +S Y+KQ KWC QIE+IL K + DKA+ +LHFK
Sbjct: 698 KNIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFK 757

Query: 760 PMRPPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXX 819
           PM+P QRHF++E + SFNLY+E+QD EPKRSVFVK++ D  +  P ISL + LPL+    
Sbjct: 758 PMKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFK 815

Query: 820 XXXXXXXXXXXXARTTTRLINVEAPQEDNVYHAK-YSGFLIKKISPGTTVEDLQRIFGQF 878
                       + +  + IN E P+E  V  +   +GF IKKISPG T EDL  +FG+ 
Sbjct: 816 KLEKERKIQHFESTSQRKYINYE-PKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKA 874

Query: 879 LTSTLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVEL 938
           L STLI N  Y I+ +  DA+IYPE Y  ++  V +DLE LVGHFDFI KE  I D + L
Sbjct: 875 LKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIML 934

Query: 939 CDVE 942
           C+VE
Sbjct: 935 CNVE 938

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/909 (54%), Positives = 638/909 (70%), Gaps = 14/909 (1%)

Query: 46  DDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTE 105
           ++D MHY ERAI++IAKGD Y CMICT+E+D T +MYAC  CYRVFDY+CIREWA+KS++
Sbjct: 63  NEDLMHY-ERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQ 121

Query: 106 KTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSK 165
           K++D++WKCPNC H + K+P +NRPTCWCGK V          SCGQTCNA +C+H CS 
Sbjct: 122 KSLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSH 181

Query: 166 ICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKD---KFQCDEPCGLPLACGLHR 222
            CHLGPHP+C R  TI C CGKHTKD+ CY   L  GK+   KF C E C + L+CG+H+
Sbjct: 182 FCHLGPHPQCHRTTTIHCECGKHTKDVFCYL--LDHGKNRNKKFNCGEKCNMTLSCGIHK 239

Query: 223 CQKKCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEK 282
           C + CHSG CG CPE++  K      + CYCGS   D I+C +V +  S   S++ +G  
Sbjct: 240 CSRVCHSGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNT 293

Query: 283 WVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVE 342
           W+GVFKC+ IR V+Y C  HSF E C +PPTI GTK CP+SPKLLKTCPCGKT L +   
Sbjct: 294 WIGVFKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFEN 353

Query: 343 SRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQ 402
            R+KCTDPI TC++RC KPLKCG+H CPF CH GPCMDPC QI+ +KCSCN + F VPCQ
Sbjct: 354 KRQKCTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQ 413

Query: 403 FHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLK 462
           FH+ P+C  KCESLMSCRRHRCT RCC+G+P A+ RKK LF   DL+DESLVE +HICLK
Sbjct: 414 FHEKPRCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLK 473

Query: 463 ECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCI 522
           +CNL LSCG H C RKCH GKCPPCLESDS+DLVCPCG+T++EAPVRCGTKLP C +PCI
Sbjct: 474 DCNLKLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCI 533

Query: 523 KVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICG 582
           K + G YPCGH P  H CHP + PCPPCT  VFKPCKCGK  K + LCFQ   SCGK+C 
Sbjct: 534 KYIEGSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCE 593

Query: 583 LPLENCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKI 642
             L+ C+H CQ +CHL GE            R+NC HTC + CHG ++CPDIPC V  ++
Sbjct: 594 KKLDGCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEV 653

Query: 643 TCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEV 702
            C CGR++  + CGATST  S      + CD+ C   +R  +L+ AFG+  S+     E+
Sbjct: 654 YCGCGRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESEL 713

Query: 703 EKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMR 762
           E+LK + +  T++EEL+LP++ET LS+Y+KQ  WC+QIEE++NK ++DK +PSLHFKPM 
Sbjct: 714 ERLKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMP 773

Query: 763 PPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXX 822
            PQR+FI    +++ +Y+E+QDREPKRSV++KK  +  +  P ISL +ALPLYQ+     
Sbjct: 774 APQRNFIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIE 831

Query: 823 XXXXXXXXXARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTST 882
                    ++     +N + P+       KY+GFLIK I+ GTT +DL  +FG  L  T
Sbjct: 832 KERKVQSFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPT 891

Query: 883 LIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVE 942
           LI + QY I+ DGK A++YP++Y  +S  VERD+E+L GHFD+++KE  + + VE+C++ 
Sbjct: 892 LIKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNIT 951

Query: 943 VAMLGERLE 951
             +  E  E
Sbjct: 952 DILQTESAE 960

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/897 (54%), Positives = 618/897 (68%), Gaps = 15/897 (1%)

Query: 52  YYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRI 111
           YYE+ I+EIAKGD Y CMICTVEMD+TC MYAC +CYRVFDYECIREWA+KST+K+V + 
Sbjct: 63  YYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTKT 122

Query: 112 WKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHLGP 171
           WKCPNCY   K VP KNRPTCWCGK +          SCGQTC+A  CVHGCS  CHLGP
Sbjct: 123 WKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLGP 182

Query: 172 HPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGL 231
           HP C R++  KCRCGK +KD+ C  S   + ++ F+C  PCGL L CG+H+CQ++CH+G+
Sbjct: 183 HPTCMRMVQTKCRCGKKSKDVFC--SEARKHQELFRCGNPCGLTLPCGVHKCQRECHNGV 240

Query: 232 CGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDN 291
           CG CPE +  +      I CYCG +   +IKC+DV +    S SQ+  G+KW+G F C  
Sbjct: 241 CGECPETIAKE------INCYCGLESLPSIKCQDVKI---QSKSQDGSGKKWIGAFACSR 291

Query: 292 IRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPI 351
           IR V+Y C EHSF E C APP+I G  PCP+SPK LKTCPCG+TPL+ +   R KCTDPI
Sbjct: 292 IRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPI 351

Query: 352 PTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTT 411
           PTCD+ CGK L CGRH CPF CH G CM+ C   DK KCSCN + F+VPC+F   P+C T
Sbjct: 352 PTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNT 411

Query: 412 KCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCG 471
           KCESLMSCRRHRC ERCC GR  A+ R+K++F ++D +DESLVE QHICLK+CNL LSCG
Sbjct: 412 KCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCG 471

Query: 472 KHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPC 531
           +H CQRKCHPG CPPCLESDSNDLVCPCG+T+  APVRCGT LPPC  PCIK ++G   C
Sbjct: 472 RHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDC 531

Query: 532 GHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHT 591
           GH PMPH CH L+EPCP CTA VFK CKCGK  KVRTLCFQN+VSCG++CG  L +C+H+
Sbjct: 532 GHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHS 591

Query: 592 CQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKET 651
           C K CH  GE            R NC H C   CH  + CPD+PC+V++++ C CG + +
Sbjct: 592 CTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSS 651

Query: 652 YVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKV 711
           + TC A       A +  +EC E+C    R  +L EAFG+       +  +  L  LA+ 
Sbjct: 652 FATCAAHEG-QDPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAALAEK 710

Query: 712 ATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQE 771
            TTF+EL LP+ E +LSI+AKQ  WC QIEE LN+LM D ++PSLHFKPM+PPQRHFI E
Sbjct: 711 VTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHE 770

Query: 772 FAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXXXX 831
            A+++ LY E+QD+EPKRSV+VKK  D  S KP +SL +ALPLYQ+              
Sbjct: 771 LAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKLKELE 828

Query: 832 ARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLI 891
             TTTR++N  +  E +   A+ +G LI+K+  GT  + ++  F  +L  TLI +P YL 
Sbjct: 829 RSTTTRILNYTSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLK 888

Query: 892 IQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGE 948
           +  G D +++ ENY   S  VERD+  +VGH D I+K++F+A+GV +C VE  M  E
Sbjct: 889 LDSG-DVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAEE 944

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/886 (55%), Positives = 612/886 (69%), Gaps = 16/886 (1%)

Query: 52  YYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRI 111
           YYE+ ++EI KGD Y CMICTVEMD+TC MYAC  CYRVFD+ECIREWALKST+K+V + 
Sbjct: 45  YYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKT 104

Query: 112 WKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHLGP 171
           WKCPNCY   K+VP KNRPTCWCGK V          SCGQTC+A  C HGCS ICHLGP
Sbjct: 105 WKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGP 164

Query: 172 HPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGL 231
           HP C R++ +KC CGK  K + C+++   +  D F CD PCGL L CG+H+CQ+KCHSG+
Sbjct: 165 HPTCMRMVQVKCNCGKKNKSVFCHEAG--KFVDSFICDSPCGLTLPCGIHKCQRKCHSGI 222

Query: 232 CGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDN 291
           CG CPE +         I CYC  + + ++KC +V +      S++  G KWVG F C+N
Sbjct: 223 CGECPESIY------GTINCYCKLESKPSLKCTEVRI---EGRSRDSSGNKWVGAFSCEN 273

Query: 292 IRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPI 351
           IR V++ C +HSF E C APP+I G  PCPFSP+ LKTCPCG++PL+E+  SR +CTDPI
Sbjct: 274 IRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPI 333

Query: 352 PTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTT 411
           PTCDS CGK L+CG+H CPF CH G CM+ CL  DK KCSC+ + F+VPC+F +  +C T
Sbjct: 334 PTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNT 393

Query: 412 KCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCG 471
           KCE+LMSCRRHRC ERCC GR  A++R+K++F ++D +DESLVE QHICLK+CNL LSCG
Sbjct: 394 KCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCG 453

Query: 472 KHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPC 531
           KH C+RKCHPG C PCLESDSNDLVCPCG+T++ APVRCGT LP C +PCIK ++G  PC
Sbjct: 454 KHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPC 513

Query: 532 GHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHT 591
           GH PMPH CHPL EPCP CTA VFK CKC K DKVRTLCFQNDVSCG++CG  L  C H 
Sbjct: 514 GHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHI 573

Query: 592 CQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKET 651
           CQK CH  GE            R NCEH C   CH  T CPD PC   + I C CG + T
Sbjct: 574 CQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRST 633

Query: 652 YVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKV 711
            VTCGA     + A +T +EC+ +C++  RH +L EAFGI +     S  +E L+ LA+ 
Sbjct: 634 TVTCGANEN-RAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEK 692

Query: 712 ATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQE 771
            +TF+EL LP++E TLSI++KQ  WC QIEE L +LM+DK +PSLHFKPMRPPQRHFI E
Sbjct: 693 VSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHE 752

Query: 772 FAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXXXX 831
             ++++LY E+QD+EPKRSVFVKK  D  S +P ISL  ALPLY +              
Sbjct: 753 LGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREKKLKETE 810

Query: 832 ARTTTRLINVEAP-QEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYL 890
             TTTR+IN     Q      A+++G L++ +  G   + +Q  F ++L  TL+ +P YL
Sbjct: 811 RHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYL 870

Query: 891 IIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGV 936
           ++  G D L+Y ++Y   S  VE D+E +VGH D I KE  +A+GV
Sbjct: 871 LLASG-DVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGV 915

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/896 (50%), Positives = 588/896 (65%), Gaps = 22/896 (2%)

Query: 52  YYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRI 111
           YYE+ ++EI  GD YVCMICTVE+D TC+MYAC  CYRVFDYEC+REWALKST KT+D+ 
Sbjct: 34  YYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDKS 93

Query: 112 WKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKICHLGP 171
           WKCPNCY +N K+P + R TCWCGKVV          SCGQTCNA++CVHGCSK+CHLGP
Sbjct: 94  WKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGP 153

Query: 172 HPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGL 231
           HPEC   + IKC+CGKH K I C +S +L   + + C + CGL L CG H CQK CH+G 
Sbjct: 154 HPECLIPVQIKCKCGKHCKQIPCSRSKVL--GNSYNCGDVCGLLLPCGKHTCQKTCHTGF 211

Query: 232 CGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDN 291
           CG C  I+ T+      + CYCGS  +  I+C D+ V      S+++ G+KW+GV+ C  
Sbjct: 212 CGPCESIIKTE------LPCYCGSDVKSGIQCSDLRV---LDYSKDVSGKKWIGVYSCGE 262

Query: 292 IRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPI 351
           +R + Y C  H++VEQC+AP  ID ++PCPFSPK LKTCPCGKT LKEL + R+KCTD I
Sbjct: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322

Query: 352 PTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTT 411
           PTC + CGK L CG+HTCPF CH G CMDPCL I K  C+C+ ++FL PCQ H  P+C  
Sbjct: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382

Query: 412 KCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCG 471
           KCES MSCRRH+C E CC+G+P A+ R+K LF  +DL +E+LVEP+H+CLK+CNL LSCG
Sbjct: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCG 442

Query: 472 KHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPC 531
            H C  KCHPGKCPPCLESD NDLVCPCG+T++ APVRCGTKLPPCP PCIK+  G  PC
Sbjct: 443 IHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPC 502

Query: 532 GHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQND--VSCGKICGLPLENCN 589
           GH   PH CHP    CPPCTA+V K C+C K   +RTLC   D  V+CG  CGLPL  C+
Sbjct: 503 GHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCH 562

Query: 590 HTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRK 649
           H CQK+CH+ GE            R  C H C + CHG + CP+  C   + ITC+C R+
Sbjct: 563 HKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRR 622

Query: 650 ETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLA 709
              V CGAT    S +    + CDEEC  L+RH +L EAFG+ +  ++T    E+L+ + 
Sbjct: 623 TKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK---EQLESIV 679

Query: 710 KVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFI 769
            VA  F++L +PY+E  L++Y KQ  WCDQI  + +K ++D  + SLH KPMR PQR FI
Sbjct: 680 LVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFI 739

Query: 770 QEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXXXXX 829
           +E A ++ LY+E+QDREP RSV++KK +   S KP ++L DA  LYQ             
Sbjct: 740 KELASAYALYSESQDREPNRSVYLKKIQ-SQSKKPELTLKDASELYQLFKTLEKERMQEH 798

Query: 830 XXARTTTRLINVEAPQEDNVYHAKYSG---FLIKKISPGTTVEDLQRIFGQFLTSTLIVN 886
              + T  LIN+  P  +    A Y G    +I  +   + +++++ +   FL  TL+  
Sbjct: 799 YSTKVTKTLINI--PASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856

Query: 887 PQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVE 942
           PQY  ++D    LI+PENY  ++     D+E ++       ++  +A GVE+C V+
Sbjct: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVD 912

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/898 (49%), Positives = 570/898 (63%), Gaps = 20/898 (2%)

Query: 42  FAGMDDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWAL 101
            +  DDD + YYE+AI++I  G  Y C+ICTVE+D TC+MYAC  CYRV+DYECI EWA 
Sbjct: 20  LSEADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAK 79

Query: 102 KSTEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVH 161
           KS++++ D  WKCPNCYH   KV PK R TCWCGK +          SCGQTC A  C H
Sbjct: 80  KSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKH 139

Query: 162 GCSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLH 221
           GC+  CHLGPHP+C   + +KC+CGK T+ ISCYQ+  +  K K  C  PCGLPL CG+H
Sbjct: 140 GCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAV--KPKLSCKLPCGLPLPCGVH 197

Query: 222 RCQKKCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGE 281
            CQK CHSG CG C  +++ K       +CYCGS   D+I C+DV V     +S++ K +
Sbjct: 198 TCQKICHSGPCGRCNTVMSGK------FKCYCGSNHLDSIICKDVAV---TKMSRSGKHK 248

Query: 282 KWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELV 341
           KW+GVF C NIR V Y+C EHSF E C   P+ D    CP+SP + KTC CG T L ++ 
Sbjct: 249 KWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQ 308

Query: 342 ESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPC 401
           + R+KCTDPIPTCD RCGKPL CG+HTCP  CH G CMDPCLQI+++KCSC +++FL PC
Sbjct: 309 QKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPC 368

Query: 402 QFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICL 461
           QF   P C  KCE+LMSCRRHRC +RCC+G+P A AR   +    D  DESL+E +HIC 
Sbjct: 369 QFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICF 428

Query: 462 KECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPC 521
           K CN  LSCG H C  KCHPGKCPPCLESDSNDLVCPCG+++I APVRCGT  P C YPC
Sbjct: 429 KNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPC 488

Query: 522 IKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKIC 581
           I  +RG  PCGH    H CHP  E CPPCTA V+KPCKCGK+   RT+CFQND+SCG+ C
Sbjct: 489 INTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKC 548

Query: 582 GLPLENCNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIK 641
              L NC+H CQK+CH  GE            R  CEH C   CHG   CPD+PC   + 
Sbjct: 549 AAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVV 608

Query: 642 ITCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLE 701
           ++C CGR+   V CGA     SA     + CD++C  +++H+ L      + S+ ST+  
Sbjct: 609 VSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQML---LQTLRSSESTNKA 665

Query: 702 VEKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPM 761
                 +    T++E+L LPY+E  + +++KQ  WC  I++ L +L++DK+R SLHFKPM
Sbjct: 666 EHGSSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPM 725

Query: 762 RPPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXX 821
           + PQR F+ E +K+F LY+E+QDREPKRSVFVK  +  +S  P I L +AL LYQ     
Sbjct: 726 KAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTF 783

Query: 822 XXXXXXXXXXARTTTRLIN--VEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFL 879
                       TT  LI+  ++   +     A  +  LI  +    TVE+++  F + L
Sbjct: 784 QKERRDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECL 843

Query: 880 TSTLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVE 937
             TL+ +PQ+ +I    +A IYP N+ E+SA VE D++ LV +F  + +   I   V 
Sbjct: 844 KQTLLKDPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVS 899

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/900 (49%), Positives = 567/900 (63%), Gaps = 23/900 (2%)

Query: 48  DAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKT 107
           + + YYE+ + E+  G++Y C+ICTVEMD +C MYAC QCYRV+DYECIR WALK+T  T
Sbjct: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73

Query: 108 VDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVXXXXXXXXXXSCGQTCNAHTCVHGCSKIC 167
           VDR WKCPNCYHVN+KVPPKNR TCWCGK V          SCGQTC A  C HGCSK+C
Sbjct: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133

Query: 168 HLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKC 227
           HLGPH EC   I  KCRCGK T++I CY++     K  F CD+PCGLP+ CG+H+C++ C
Sbjct: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKA--AKRNFSCDQPCGLPMPCGIHKCERVC 191

Query: 228 HSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVF 287
           H+G CG C      KE +   I+CYCG   R+ + C +V V   + +S   K + W+G F
Sbjct: 192 HNGPCGPC------KEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVS---KYKSWIGAF 242

Query: 288 KCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKC 347
            CD +R V Y C +HSF E+CIAPP++    PCP+SP+   TCPCGKT L EL  +R  C
Sbjct: 243 ACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTAC 302

Query: 348 TDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDP 407
           TD I +C   CGK L CG HTCP  CH G CMDPCL I ++KC+C Q+ FLVPCQF   P
Sbjct: 303 TDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSP 362

Query: 408 QCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLM 467
            CT KCESLMSCRRHRC ERCC+GRP +  R  R  R +   DES VE QH+CLK+CN +
Sbjct: 363 SCTAKCESLMSCRRHRCAERCCSGRPHSVKRNSRR-RRESPDDESEVEAQHVCLKDCNRV 421

Query: 468 LSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRG 527
           L CG H C  KCH GKCPPCLESDSNDL+CPCG+TI+ APVRCGTKLP C +PC   +  
Sbjct: 422 LLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLD 481

Query: 528 EYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLEN 587
            +PCGH+P  H CHPL+EPCPPCT +V K C+CGK +++RT C+ +DVSC + C  PL  
Sbjct: 482 TWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCSRPCKKPLSY 540

Query: 588 CNHTCQKRCHLLGEXXXXXXXXXXXXRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECG 647
           CNH CQ  CH  G+            R  CEH C   CHG T CP+ PC+    ITC CG
Sbjct: 541 CNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCG 600

Query: 648 RKETYVTCGATSTIPSA-ATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLK 706
            K +   C   +          H+ CDE+C   +RH+QL  AFG+V+  ++TS E E L 
Sbjct: 601 HKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVE--KATSEEDEALL 658

Query: 707 DLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQR 766
            LA+ + +F++L LP+ E  LS++ KQ +WC QIE+ L KLMDD +  +LHFKPMR  QR
Sbjct: 659 -LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQR 717

Query: 767 HFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTXXXXXXXXX 826
            F+ E + SF LY+E+QD EPKRSV+VKK   G S  P I L  A PLY +         
Sbjct: 718 RFVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFK 775

Query: 827 XXXXXARTTTRLINVEAPQEDNVYH-AKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIV 885
                A  T +L++V         H A  +  L+  ++   +   L+  F  + + TL+ 
Sbjct: 776 ANSESA-VTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLN 834

Query: 886 NPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAM 945
            PQY++   G +  I+P +Y  +SA  E+DL  L G+F  + +E  +   +  C ++  +
Sbjct: 835 CPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,914,975
Number of extensions: 4075562
Number of successful extensions: 9763
Number of sequences better than 10.0: 51
Number of HSP's gapped: 8890
Number of HSP's successfully gapped: 55
Length of query: 957
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 838
Effective length of database: 39,836,145
Effective search space: 33382689510
Effective search space used: 33382689510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)