Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G03850singletonON25125112271e-172
NCAS0G037702.289ON25125112271e-172
NDAI0G006802.289ON2552568801e-120
KNAG0H019802.289ON2492498011e-108
Skud_14.3052.289ON2492507961e-107
Suva_14.3232.289ON2532507871e-106
YNL024C2.289ON2462507851e-105
Smik_14.3072.289ON2462507841e-105
CAGL0M06897g2.289ON2482507252e-96
SAKL0E07612g2.289ON2522467174e-95
KAFR0H032902.289ON2452517089e-94
KLTH0G10428g2.289ON2512466621e-86
Kwal_27.115132.289ON2512446462e-84
ADL212W2.289ON2512436402e-83
Ecym_33282.289ON2542526142e-79
KLLA0E08295g2.289ON2662426118e-79
Smik_10.4224.352ON340186986e-04
Skud_10.3524.352ON336216930.002
ZYRO0G20548g1.325ON39770890.008
Smik_2.4141.325ON417149880.012
Suva_12.2204.352ON337186870.013
KNAG0C018001.325ON42169840.031
YBR271W (EFM2)1.325ON41969820.064
SAKL0D06798g1.325ON42194800.12
Skud_2.4031.325ON41765790.17
KAFR0C042501.325ON39165780.19
Suva_4.5321.325ON41668760.38
TPHA0L003404.352ON341112750.44
Kwal_14.25501.325ON41869740.56
ZYRO0D14542g6.79ON263260720.95
TDEL0B007308.824ON113862693.0
KAFR0E003201.509ON98488693.1
Kwal_56.233176.79ON26670673.6
NDAI0J028604.352ON347111683.6
Kpol_1028.814.352ON336178674.6
NDAI0E039607.430ON77775674.9
Kpol_1066.171.325ON43568665.6
KLTH0H10560g1.325ON417157657.7
TDEL0D019401.325ON405101658.6
KAFR0E042804.352ON3151816410.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G03770
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               477   e-172
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   477   e-172
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   343   e-120
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   313   e-108
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   311   e-107
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   307   e-106
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   306   e-105
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   306   e-105
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   283   2e-96
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   280   4e-95
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   277   9e-94
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   259   1e-86
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   253   2e-84
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   251   2e-83
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   241   2e-79
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   239   8e-79
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    42   6e-04
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    40   0.002
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    39   0.008
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    39   0.012
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    38   0.013
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    37   0.031
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    36   0.064
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    35   0.12 
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    35   0.17 
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    35   0.19 
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    34   0.38 
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    33   0.44 
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    33   0.56 
ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} simil...    32   0.95 
TDEL0B00730 Chr2 complement(134434..137850) [3417 bp, 1138 aa] {...    31   3.0  
KAFR0E00320 Chr5 complement(70962..73916) [2955 bp, 984 aa] {ON}...    31   3.1  
Kwal_56.23317 s56 (490526..491326) [801 bp, 266 aa] {ON} YLR285W...    30   3.6  
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    31   3.6  
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    30   4.6  
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...    30   4.9  
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    30   5.6  
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    30   7.7  
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    30   8.6  
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    29   10.0 

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  477 bits (1227), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/251 (94%), Positives = 236/251 (94%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ILEKSGTEDLLNKWPHDGERRFRNVLE               EKNRFHKNIGVHITDIDQ
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 241 RTHLFQLARRF 251
           RTHLFQLARRF
Sbjct: 241 RTHLFQLARRF 251

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  477 bits (1227), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/251 (94%), Positives = 236/251 (94%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ILEKSGTEDLLNKWPHDGERRFRNVLE               EKNRFHKNIGVHITDIDQ
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 241 RTHLFQLARRF 251
           RTHLFQLARRF
Sbjct: 241 RTHLFQLARRF 251

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  343 bits (880), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 201/256 (78%), Gaps = 7/256 (2%)

Query: 1   MDGIFGD-FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCD 59
           MD IFG  F+ LVV RP+EHLGNSDLSFGG+L++PLKIHEDGGESGCGGKVWIAGELLC+
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 60  FILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDID 119
           FILEKS ++DLLN W  +  ++FR ++E               EKN FHK+I  +ITDID
Sbjct: 61  FILEKSNSDDLLNGWASNS-KQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119

Query: 120 QLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPS-----TVDNLPKTNVVDLILAAD 174
           Q+VPLM++NI+LNG+  EV AE LWWGEPL ++FAPS       ++  +   VDLILAAD
Sbjct: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAAD 179

Query: 175 CVYLEDAFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKY 234
           CVYLE AFPLLE+TLLDLTE ETPP ILM+YRKRRKADKHFF KIKKNFD++E+KDF KY
Sbjct: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239

Query: 235 EMYLKMRTHLFQLARR 250
           E YLK RTHLFQL R+
Sbjct: 240 EYYLKQRTHLFQLIRQ 255

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  313 bits (801), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 154/249 (61%), Positives = 182/249 (73%), Gaps = 1/249 (0%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           M+ IFG F  LVV RP+EH G+ D+SFGG+L   L+IHEDGGESGCGGKVW+AGELLCD+
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           I+EKS  +DLL  W     ++FRN++E               EK  FHK I V ITDIDQ
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           LVPLMQ+NIELN V+ E++AE LWWGEPL  +FAP + + L K   VDLILAADCVYLE 
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHS-EGLSKVTSVDLILAADCVYLEK 179

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLE+TLLDLT    PPVILM+YRKRR ADK FF KI K+F V E+ DF+ Y+ YLK 
Sbjct: 180 AFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQ 239

Query: 241 RTHLFQLAR 249
           RTHLF+L R
Sbjct: 240 RTHLFELIR 248

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  311 bits (796), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           MD IFG FE LVVPR  EHLG +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ILEKS    LL++  H G R+F+ VLE               EKN FH    V++TDID+
Sbjct: 61  ILEKS-LHHLLSEATH-GRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDK 118

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           LVPL++RNIEL+ V  EV+A  LWWGEPL   F+P   D   +TN VDL+LAADCVYLE 
Sbjct: 119 LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGD--LQTNNVDLVLAADCVYLEK 176

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLERTLLDLT   +PPVILM+Y+KRRKADKHFF+KIK+NFDV+E+ DF+K++ YLK 
Sbjct: 177 AFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQ 236

Query: 241 RTHLFQLARR 250
           RTHLFQL R+
Sbjct: 237 RTHLFQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  307 bits (787), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/250 (63%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           MDGIFG FE LVVPR  EH G +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ILEKS  + LL++  H+ +R F  VLE               EKN+FH N  V++TDID+
Sbjct: 61  ILEKS-DDHLLSETVHE-KRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDR 118

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           LVPLM+RNIEL+ V  EV+A  LWWGEPL   F+P   D   + N VDL+LAADCVYLE 
Sbjct: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGD--LQVNNVDLVLAADCVYLEK 176

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLE+TLLDLT   +PPVILM+Y+KRRKADK FFNKIK+NFDV+E+KDF K++ YLK 
Sbjct: 177 AFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQ 236

Query: 241 RTHLFQLARR 250
           +THLFQL R+
Sbjct: 237 KTHLFQLVRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  306 bits (785), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           M+ IFG F  LVVPRP EHLG +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ILEKS  + LL+K   +G ++F+ VLE               EKN FH    V++TDID+
Sbjct: 61  ILEKS-VDHLLSK-TVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDK 118

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           L+PL++RNIEL+ V  EV+A  LWWGEPL   F+P   +   + N VDL+LAADCVYLE+
Sbjct: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQ--EGAMQANNVDLVLAADCVYLEE 176

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLE+TLLDLT    PPVILM+Y+KRRKADKHFFNKIK+NFDV+E+ DF+K+E YLK 
Sbjct: 177 AFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKE 236

Query: 241 RTHLFQLARR 250
           RTHLFQL R+
Sbjct: 237 RTHLFQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  306 bits (784), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/250 (62%), Positives = 189/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           MD IFG F  LVVPRP EHLG +DLSF GKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ILEKS  + LL+K   DG++RF+ VLE               EKN +H    V++TDID+
Sbjct: 61  ILEKS-VDHLLSK-TVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDK 118

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           LVPL++RNIEL+ V  EV+A  L WGEPL   F+P   D   +TN VDL+LAADCVYLE 
Sbjct: 119 LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGD--LQTNNVDLVLAADCVYLEK 176

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLE+TLLDLT+  +PPVILM+Y+KRRKADKHFFNKIK+NFDV+E+ +F+K++ YLK 
Sbjct: 177 AFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQ 236

Query: 241 RTHLFQLARR 250
           RTHLFQL R+
Sbjct: 237 RTHLFQLIRK 246

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  283 bits (725), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 176/250 (70%), Gaps = 2/250 (0%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           M+ I G F  L+  RPVEH+G SDL+F G L   LKI+EDGGESGCGGKVWIAGELLC+F
Sbjct: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ILEKS   +LL  W +D    F NVLE                K +  + +  +ITDIDQ
Sbjct: 60  ILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQ 119

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180
           LVPLM++N+ELN + ++V A+ L WGE L   FAP    +   T+ +DL+LAADCVYLE 
Sbjct: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGH-ATTSSLDLVLAADCVYLEK 178

Query: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240
           AFPLLE+TLLDLTE + PPVILM+YRKRRKADKHFF KI+KNF+VI + DF  Y+ YLK 
Sbjct: 179 AFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQ 238

Query: 241 RTHLFQLARR 250
           RTHLFQL R+
Sbjct: 239 RTHLFQLVRK 248

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  280 bits (717), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 175/246 (71%), Gaps = 7/246 (2%)

Query: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67
           F  LV  RP EHLG+SDLSFGGKL  PLKIHEDGGESGCGGKVWIAGELLC+F+LEKS  
Sbjct: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70

Query: 68  EDLLNKWPHDG--ERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQLVPLM 125
           + L ++W  D   +   + ++E                K    K++ +++TDIDQLV LM
Sbjct: 71  QGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLM 130

Query: 126 QRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLL 185
            RNI+LN + + V  + LWWGEPL   FAP+  +       VDLILAADCVYLE AFPLL
Sbjct: 131 DRNIKLNEL-EHVFPKELWWGEPLKPEFAPTRSNQ----RQVDLILAADCVYLEKAFPLL 185

Query: 186 ERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLF 245
           E TLLDLT  + PP+ILMSY+KRRKADKHFF +IKKNFDV+E+ +FT+++ YLK +THLF
Sbjct: 186 EVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLF 245

Query: 246 QLARRF 251
           QL R+F
Sbjct: 246 QLVRKF 251

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  277 bits (708), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 180/251 (71%), Gaps = 7/251 (2%)

Query: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60
           M+ +FG++ GL+  RP+EHLG++DLSF G+L   +KI+EDGG SGCGGKVWIAGELLC++
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 61  ILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQ 120
           ++EKS +E+LL     DG    +N+LE               EK RFHK+I V ITDI  
Sbjct: 61  LIEKSDSENLL----CDGS--IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114

Query: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVD-NLPKTNVVDLILAADCVYLE 179
           LVPLM+RNI LN ++   VA+ L WG+ L   +  ++VD N    + VDL++AADCVY E
Sbjct: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174

Query: 180 DAFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLK 239
            AFPLLE+ LLDLT  + PP+ILM+YRKRRKADK FF +I+KNFDVIE+ DF+ +E Y+K
Sbjct: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234

Query: 240 MRTHLFQLARR 250
            RTHLF+L R+
Sbjct: 235 QRTHLFELKRK 245

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  259 bits (662), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 167/246 (67%), Gaps = 8/246 (3%)

Query: 6   GDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKS 65
             F  LV  RP+EH G+SDL+FGG++   LKIHEDGGESGCGGK+WIAGELLC+++LE S
Sbjct: 9   AQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68

Query: 66  GTEDLLNKWPH--DGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQLVP 123
               +L+K  +    ++ F N+LE                +     N  VHITDIDQLV 
Sbjct: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQLVR 127

Query: 124 LMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFP 183
           LM+ N+ELNG++  V AE LWWGEPL   F P  +     +N  DL+LAADCVYLE AFP
Sbjct: 128 LMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAI-----SNKTDLVLAADCVYLETAFP 182

Query: 184 LLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTH 243
           LLE+TLLDLT+ ETPPV+LMSYRKRRKAD+ FF  I+KNF V+ +  F + + +LK RTH
Sbjct: 183 LLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTH 242

Query: 244 LFQLAR 249
           LFQL R
Sbjct: 243 LFQLIR 248

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  253 bits (646), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 168/244 (68%), Gaps = 8/244 (3%)

Query: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67
           F  LV  RPVEHLG+SDLSFGG++   LKIHEDGGE+GCGGK+W+AGELLCD++LE S  
Sbjct: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70

Query: 68  EDLLNK--WPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQLVPLM 125
           + +L+K     D +  F N+LE                +    +   V+ITDID+LV LM
Sbjct: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDRT-KVYITDIDRLVGLM 129

Query: 126 QRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLL 185
           + N+ LN +++ V  E L WGEPL E F P       K + VDL+LAADCVYLE AFPLL
Sbjct: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGPDA-----KADKVDLVLAADCVYLETAFPLL 184

Query: 186 ERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLF 245
           E+TLLDLTE +TPP +LMSYRKRRKADK+FF  I+KNF ++ + +F +Y+ YLK +THLF
Sbjct: 185 EKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLF 244

Query: 246 QLAR 249
           QL R
Sbjct: 245 QLVR 248

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  251 bits (640), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 169/243 (69%), Gaps = 10/243 (4%)

Query: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67
           FE LV PRP+EHLG SDLS+ G+L  PLKIHEDGGESGCGGKVWIAG LLC+FILEKS  
Sbjct: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68

Query: 68  EDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQLVPLMQR 127
             +L+++P   ER+F+N++E                K     +  V+ITDI+ L PLMQ+
Sbjct: 69  GRVLSQFP-GYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQK 127

Query: 128 NIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLLER 187
           N+ELNG+   V    L+WGEPL + F             +DL+LAADCVYLE AFPLLE+
Sbjct: 128 NVELNGLDGMVHPRPLFWGEPLSDEFT---------RQPIDLVLAADCVYLEKAFPLLEK 178

Query: 188 TLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQL 247
           TLLDLT  E+ P++LMSY+KRRKADK FF KIKK FD+IE+KDF  YE Y + RT+LFQL
Sbjct: 179 TLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQL 238

Query: 248 ARR 250
            R+
Sbjct: 239 VRK 241

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  241 bits (614), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 136/252 (53%), Positives = 166/252 (65%), Gaps = 10/252 (3%)

Query: 1   MDGIFGD-FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCD 59
           M  +F   FE LV   P+EHLG SDLSF G+L  PLKI+EDGGESGCGGKVWIAGELLCD
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 60  FILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDID 119
           F+LEKS    LL+K+  +G ++F  VLE                      ++ V+ITDID
Sbjct: 61  FLLEKSKDGQLLSKFVKNG-KQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119

Query: 120 QLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLE 179
            L PLM RN+ +N +   V    L+WG+ L     P+   N  K + VDLILAADCVYLE
Sbjct: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDEL-----PAEFRN--KDSPVDLILAADCVYLE 172

Query: 180 DAFPLLERTLLDLTES-ETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYL 238
            AFPLLE  LL+LT + E  PV+LMSYRKRRKADK FF KIKK+F + E+ DF +Y+ Y+
Sbjct: 173 KAFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYI 232

Query: 239 KMRTHLFQLARR 250
           K RTH+FQL RR
Sbjct: 233 KQRTHIFQLVRR 244

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  239 bits (611), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 135/242 (55%), Positives = 168/242 (69%), Gaps = 11/242 (4%)

Query: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67
           FE LV  RP+EHLG  D+SF GKL SPL I+EDGGESGCGGKVWIAGELLC++ILEKS  
Sbjct: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93

Query: 68  EDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQLVPLMQR 127
           E LL+    DG     +VLE               ++   + +  V+I+DIDQL+ LM+ 
Sbjct: 94  EHLLSHLFPDG--NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151

Query: 128 NIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLLER 187
           NI++NG+  +V AE LWWG PL + F    VD         L+LAADCVYLE AFPLLE+
Sbjct: 152 NIQVNGLDDKVHAEVLWWGNPLPDVFVKKPVD---------LVLAADCVYLEAAFPLLEK 202

Query: 188 TLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQL 247
           TLL+LT+ E  P+ILM+Y+KRRKADKHFF KIKKNF ++E++DF  ++ YLK RTHLFQL
Sbjct: 203 TLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQL 262

Query: 248 AR 249
            R
Sbjct: 263 MR 264

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 74/186 (39%), Gaps = 19/186 (10%)

Query: 41  GGESGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXX 100
              S  G + W A   + DF++ K   E  L +   + +++  NVLE             
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKKLNVLEIGAGTGIVSLVLS 186

Query: 101 XXEKNRFHKNIGVHITDIDQLVPLMQRNIELNGVSKE----VVAEGLWWGEPLLESFAPS 156
              +N F   + V   D D +   +++N ELN    E    +  + LWWG          
Sbjct: 187 QNYRN-FVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWGS--------- 236

Query: 157 TVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLTESETPPVILMSYRKRRKA-DKHF 215
             D +P  + +DL++ AD  Y    FP L + L +        + L+S   R ++ DK F
Sbjct: 237 --DKVP--DDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLF 292

Query: 216 FNKIKK 221
             +  K
Sbjct: 293 AQECSK 298

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 88/216 (40%), Gaps = 30/216 (13%)

Query: 41  GGESGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXX 100
              S  G + W A   + DF++ K   +  L       +R+  NVLE             
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQQLAL---MQKEDRKKLNVLEIGAGTGIVSLVLL 183

Query: 101 XXEKNRFHKNIGVHITDIDQ--LVPLMQRNIELNGVSKE----VVAEGLWWGEPLLESFA 154
             EK R   N  +++TD D   +   ++RN ELN    E    V  + LWWG        
Sbjct: 184 --EKYREFVN-RMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWGS------- 233

Query: 155 PSTVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLTESETPPVILMSYRKRRKADKH 214
               D +P  + +DL++AAD  Y    FP L + L +        + L+S   R ++   
Sbjct: 234 ----DRIP--DDIDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDK 287

Query: 215 FF----NKIKKNFDVIEVKDFTKYEMYLKMRTHLFQ 246
            F    NKI  N+ V+   +  K +   +M+T  F+
Sbjct: 288 LFAQECNKIGLNYTVVSSTEHDK-DSESRMKTLTFK 322

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 7/70 (10%)

Query: 108 HKNIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVV 167
           + NI +  TD+ ++VP +++N+E+NG+S   V + L W  P  E F    VD    +   
Sbjct: 258 NSNIEMFFTDLQEIVPNLRKNVEINGISDNSVVDTLDWTCP--EDF----VDKY-SSEKF 310

Query: 168 DLILAADCVY 177
           D+I+ +D +Y
Sbjct: 311 DIIIVSDPIY 320

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 67/149 (44%), Gaps = 10/149 (6%)

Query: 31  LRSPLKIHEDG-GESGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGERRFRNVLEXX 89
           LR+ + ++E        G K W +  +L   ++++  T D+ +   + G +R + VLE  
Sbjct: 202 LRNAIPLYEPSLTADNLGWKTWGSSLILSQLVVDRLHTADM-DFVANRGTKRIK-VLELG 259

Query: 90  XXXXXXXXXXXXXEKNRFH-KNIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEP 148
                         K  +   N  + +TD+  +V  +++N+ LN +   V AE L W  P
Sbjct: 260 SGTGLVGLSWASKWKELYGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNP 319

Query: 149 LLESFAPSTVDNLPKTNVVDLILAADCVY 177
             +SF    +D     N  D+IL AD +Y
Sbjct: 320 --QSF----IDRFGYENEFDIILIADPIY 342

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 72/186 (38%), Gaps = 24/186 (12%)

Query: 41  GGESGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXX 100
              S  G + W A   + DF++ +      L +  H  +++  NVLE             
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMHEP-----LLELVHGDDKKKLNVLEIGAGTGIVSLVLL 183

Query: 101 XXEKNRFHKNIGVHITDIDQLVPLMQRNIELNGV----SKEVVAEGLWWGEPLLESFAPS 156
              +    K + V   D D +   ++RN ELN      S ++  + LWWG          
Sbjct: 184 HKYREYVSK-MYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWGS--------- 233

Query: 157 TVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLTESETPPVILMSYRKRR-KADKHF 215
             D +P  + V+L++AAD  Y    FP L + L +        V L+S   R    DK F
Sbjct: 234 --DRVP--DEVNLVVAADVTYDSTIFPELCQCLAECLAMSHCKVCLLSATIRSYSTDKEF 289

Query: 216 FNKIKK 221
             +  K
Sbjct: 290 AQECHK 295

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 109 KNIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVD 168
            N+ +++TD+ ++V  +++N++LN +   VVA+ L W  P       + ++        D
Sbjct: 283 SNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTNPY------NFIERYNGEQSFD 336

Query: 169 LILAADCVY 177
           LIL AD +Y
Sbjct: 337 LILVADPIY 345

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 109 KNIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVD 168
           +NI + +TD+ ++V  +++N+ LN +   V AE L W  P    F    +D     N  D
Sbjct: 282 ENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNP--HDF----IDKFGHENEFD 335

Query: 169 LILAADCVY 177
           +IL AD +Y
Sbjct: 336 VILIADPIY 344

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 12/94 (12%)

Query: 113 VHITDIDQLVPLMQRNIELNGVSKE----VVAEGLWWGEPLLESFAPSTVDNLPKTNVVD 168
           +++TD+ ++VP +Q+N+E+N ++ +    V A+ L W  P+  SF     D     +  D
Sbjct: 281 MYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPV--SFTEKYGD-----DKFD 333

Query: 169 LILAADCVYLEDAFPLLERTLLDLTESETPPVIL 202
           +IL AD +Y     P+   T++D   SE   V L
Sbjct: 334 VILIADPIY-SPQHPVWVVTMIDKFLSEKGKVYL 366

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 113 VHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILA 172
           + +TD+ ++V  +++N+ LN +   V AE L W  P  + F    +D     N  D+IL 
Sbjct: 284 IFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNP--QDF----IDRFGHENEFDIILV 337

Query: 173 ADCVY 177
           AD +Y
Sbjct: 338 ADPIY 342

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 7/65 (10%)

Query: 113 VHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILA 172
           +++TD+ ++V  +++NI +N ++  VV++ L W  P  ESF  +  D        D++L 
Sbjct: 254 IYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNP--ESFVSNYGDTR-----FDVLLI 306

Query: 173 ADCVY 177
           +D +Y
Sbjct: 307 SDPIY 311

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 110 NIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDL 169
           NI +++TD+ ++V  +++N+ LN +   V AE L W  P  ++F    ++        D+
Sbjct: 280 NIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNP--QNF----INQFGHEMDFDI 333

Query: 170 ILAADCVY 177
           IL AD +Y
Sbjct: 334 ILVADPIY 341

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 19/112 (16%)

Query: 113 VHITDIDQ--LVPLMQRNIELNGV--SKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVD 168
           ++ITD D   L   + RN+ LNG+  S  V  + L W E           D++P    +D
Sbjct: 195 LYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNE-----------DHIPDN--LD 241

Query: 169 LILAADCVYLEDAFPLLERTLLDLTES--ETPPVILMSYRKRRKADKHFFNK 218
           LI+AAD  Y     P L   +LD  +S  +   V  ++  +R +     F +
Sbjct: 242 LIVAADVTYDSSVIPSLCHCILDCFKSSNKCSTVCYLAATRRNQETIAVFEQ 293

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 11/69 (15%)

Query: 113 VHITDIDQLVPLMQRNIELNGVSK----EVVAEGLWWGEPLLESFAPSTVDNLPKTNVVD 168
           VH+TD+  +VP +Q+N++LN  ++    EV  + L W +       PS+          D
Sbjct: 279 VHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLDWTD-------PSSFQEKYGYKKFD 331

Query: 169 LILAADCVY 177
           ++L AD +Y
Sbjct: 332 VLLIADPIY 340

>ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} similar
           to uniprot|Q05874 Saccharomyces cerevisiae YLR285W NNT1
           Putative nicotinamide N-methyltransferase has a role in
           rDNA silencing and in lifespan determination
          Length = 263

 Score = 32.3 bits (72), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 91/260 (35%), Gaps = 55/260 (21%)

Query: 1   MDGIFGDFE---GLVVPRPVEHLGNSDLSFGGK----LRSPLKIHEDGGESGCGGKVWIA 53
           +DG FG FE     + P P  H  + +  +  K        +++   G     G  +W A
Sbjct: 6   LDGAFGVFEEPTDFLPPPPEAHFADYEREYVSKESDSQNKKVQLRLVGKSPLWGHMLWNA 65

Query: 54  GELLCDFILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNRFHKNIGV 113
           G            T   L+K  H G  + +NVLE                 N+       
Sbjct: 66  GIY----------TAKHLDK--HPGLVKGKNVLELGAAAALPTVVCGLIGANK------- 106

Query: 114 HITDIDQLVPLMQRNIELN--------------GVSKEVVAEGLWWG---EPLLESFAPS 156
            +   D   P + +NI+ N                 ++VV EG  WG   EP+L     S
Sbjct: 107 -VVSTDYPEPELIQNIQYNVDHELYGGKPFSQDSNDRKVVVEGYIWGNEYEPILSHTGGS 165

Query: 157 TVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLTESETPPVILMSYRKRR--KADKH 214
             D         LI+ +DCV+       L R + DL  ++   +++ S  + R    D  
Sbjct: 166 KFD---------LIILSDCVFNHTEHRKLLRCIKDLLANDGKALVVFSPHRPRLLDVDLS 216

Query: 215 FFNKIKKNFDVIEVKDFTKY 234
           FF   K+     E  D  K+
Sbjct: 217 FFETAKEFGLAPEFIDLVKW 236

>TDEL0B00730 Chr2 complement(134434..137850) [3417 bp, 1138 aa] {ON}
           Anc_8.824 YML104C
          Length = 1138

 Score = 31.2 bits (69), Expect = 3.0,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 14/62 (22%)

Query: 182 FPLLERTLLDLTESETPPVILMSYRKRRKADKHFFN--KIKKNF-DVIEVKDFTKYEMYL 238
           FPL  R++L           L+    RR  D++FF   K+ K F +++   DFT  E+Y 
Sbjct: 525 FPLARRSIL-----------LLQSEARRALDRNFFQTFKMSKEFLNMLSNSDFTNTELYS 573

Query: 239 KM 240
           K+
Sbjct: 574 KL 575

>KAFR0E00320 Chr5 complement(70962..73916) [2955 bp, 984 aa] {ON}
           Anc_1.509 YJR061W
          Length = 984

 Score = 31.2 bits (69), Expect = 3.1,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 20/88 (22%)

Query: 184 LLERTL----LDLTESETPPVILMSYR-----------KRRKADKHFFNKIKKNFDVIEV 228
           L E TL    LDL E E    + ++ R            R+ A +H F  +KK+   IE 
Sbjct: 211 LFEGTLDVEALDLIEKEVGEPLFVNERFKYTYPKWYHFSRKMAQRHIFTVLKKHCTPIEK 270

Query: 229 KDFTK----YEMYLKMRTHLFQL-ARRF 251
             F+      EMY  +R  +FQL AR F
Sbjct: 271 AKFSTGVVINEMYDNVRPEVFQLQARNF 298

>Kwal_56.23317 s56 (490526..491326) [801 bp, 266 aa] {ON} YLR285W -
           Hypothetical ORF [contig 181] FULL
          Length = 266

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 135 SKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLTE 194
           S+ VV EG  WG      +AP T      T+  DLI+ +D V+       L +T  DL  
Sbjct: 144 SRNVVVEGYIWGN----DYAPLTAHLPSGTSKFDLIILSDLVFNHTEHGKLLQTTKDLLA 199

Query: 195 SETPPVILMS 204
           S+   +++ S
Sbjct: 200 SDGQALVVFS 209

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 12/111 (10%)

Query: 113 VHITDIDQ--LVPLMQRNIELNGVSKE---VVAEGLWWGEPLLESFAPSTVDNLPKTNVV 167
           V++TD D   +  ++ +N ELN V+ E   V+   LWW +P  E  A    DN      +
Sbjct: 198 VYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDP-NEKIAGE--DN----GKI 250

Query: 168 DLILAADCVYLEDAFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNK 218
            L++ AD  Y     P L   L    +       ++S   R     +FF +
Sbjct: 251 GLVVGADITYDNSVIPDLCACLKQFMDKNRDCKAIISATVRNIDTINFFER 301

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 71/178 (39%), Gaps = 32/178 (17%)

Query: 47  GGKVWIAGELLCDFILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXEKNR 106
           G + W A   +  F +E +G  D ++K         +N+LE                ++ 
Sbjct: 140 GFRTWEAALFMTSFFVE-TGYLDTMSK---------KNILELGAGTGLVSIGLCKQYEDS 189

Query: 107 FHKNIGVHITDID-QLVP-LMQRNIELNGVSKE--VVAEGLWWGEPLLESFAPSTVDNLP 162
             K   +++TD D QLV   + +N   N +S    V+ + LWW            VD++P
Sbjct: 190 IDK---IYVTDGDSQLVEGQLLKNFNENELSHNDRVILQKLWWN-----------VDDVP 235

Query: 163 KTNVVDLILAADCVYLEDAFPLLERTLLDL--TESETPPVILMSYRKRRKADKHFFNK 218
               +DLI+AAD  Y     P L  T+ +     S    V L+S   R +     F K
Sbjct: 236 LD--LDLIVAADVTYDSSVVPDLCETISNCFKRSSNDSAVCLLSATVRNEDTLDLFEK 291

>NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {ON}
           Anc_7.430
          Length = 777

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 8/75 (10%)

Query: 18  EHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGTEDL------- 70
           E L   D+  GGK+   L   ED   SGCG  +  A  +    I E    +++       
Sbjct: 609 ECLARLDVCMGGKIAEELIFGEDNVTSGCGSDLRTATNMARAMITEYGMNDEVGPINLAE 668

Query: 71  -LNKWPHDGERRFRN 84
             N W +D + R  N
Sbjct: 669 NWNTWSNDIQERADN 683

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 110 NIGVHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDL 169
           N  + +TD+ ++V  +QRNI +N ++    A  L W  P  +SF              D+
Sbjct: 298 NTEIILTDLPEIVGNLQRNISINNLNDIARASVLDWTNP--KSFIQEY-----SNEKFDI 350

Query: 170 ILAADCVY 177
           IL AD +Y
Sbjct: 351 ILVADPIY 358

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 65/157 (41%), Gaps = 26/157 (16%)

Query: 29  GKLRSPLKIHEDGGES-GCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGERRFRNVLE 87
           G LR+ +K+HE    S   G K W A  +L   + E        +K+    + R    L 
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCEN------FSKFERQRDLRILE-LG 250

Query: 88  XXXXXXXXXXXXXXXEKNRFHKNIGVHITDIDQLVPLMQRNIELNGVSK----EVVAEGL 143
                          E N  H N  +H+TD+ ++V  ++ N+++N  +     +V A+ L
Sbjct: 251 AGTGLVGISLVLKMLESNSGH-NCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYADVL 309

Query: 144 WWGEPLLESFAPSTVDNLPKT---NVVDLILAADCVY 177
            W  P          D+  KT   +  D++L AD VY
Sbjct: 310 DWTNP----------DSFEKTYGAHKFDVLLIADPVY 336

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 113 VHITDIDQLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILA 172
           + +TD+  +V  +Q+N+E+N V        L W +P    F  S  D     +  D+++ 
Sbjct: 272 IFLTDLPVIVANLQKNVEVNKVESFATVSALDWTDP--TDFINSYTD-----DEFDILIV 324

Query: 173 ADCVYLEDAFPLLERTLLDLTESETPPVILMSYRKRRKADK 213
           +D +Y  +   L+   +     S+    + +  R R  A++
Sbjct: 325 SDPIYSPNHPELVVNMIKKFLSSQGQCYLEIPLRPRYAAER 365

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 71/181 (39%), Gaps = 34/181 (18%)

Query: 44  SGCGGKVWIAGELLCDFILEKSGTEDLLNKWPHDGERRFRNVLEXXXXXXXXXXXXXXXE 103
           S  G + W A   LCD+I     TE L              VLE                
Sbjct: 113 STTGFRTWEAASYLCDYI-SNVDTESL---------NGCSTVLELGAGTGLCSLTLL--- 159

Query: 104 KNRFHKNI-GVHITDID------QLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPS 156
           K +F  ++  V++TD D      QL+   + N   + + ++V  + L WGE         
Sbjct: 160 KGKFQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE--------- 210

Query: 157 TVDNLPKTNVVDLILAADCVYLEDAFPLLERTLLDLTESETPPVILMSYRKRR-KADKHF 215
             D++P  N +D ++ AD  Y +  F  L + L    E E+  + L++   R  + D+ F
Sbjct: 211 --DSIP--NDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKF 266

Query: 216 F 216
            
Sbjct: 267 L 267

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.142    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,794,763
Number of extensions: 1148899
Number of successful extensions: 2817
Number of sequences better than 10.0: 44
Number of HSP's gapped: 2847
Number of HSP's successfully gapped: 44
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)