Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G037602.291ON72723811e-49
NDAI0G006902.291ON72723631e-46
KNAG0H019702.291ON72723612e-46
Cgla_YGOB_Anc_2.2912.291ON72723578e-46
Smik_14.3062.291ON72723482e-44
YNL024C-A (KSH1)2.291ON72723482e-44
Suva_14.3222.291ON72723455e-44
Kpol_1003.412.291ON72723412e-43
TPHA0C034302.291ON72723248e-41
TBLA0B069702.291ON72713231e-40
SAKL0E07568g2.291ON72723222e-40
KAFR0H032802.291ON72723203e-40
ADL210W2.291ON72723171e-39
KLLA0E08251g2.291ON72723143e-39
Skud_14.3042.291ON72723082e-38
TDEL0G022102.291ON72723065e-38
Kwal_YGOB_Anc_2.2912.291ON72723003e-37
KLTH0G10472g2.291ON72722943e-36
ZYRO0A01980g2.291ON72722841e-34
Ecym_33302.291ON72722631e-31
Smik_9.1657.201ON115469670.25
SAKL0F09702g7.283ON67634611.8
TBLA0D056601.221ON75031566.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G03760
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   151   1e-49
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   144   1e-46
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   143   2e-46
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   142   8e-46
Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   138   2e-44
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   138   2e-44
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   137   5e-44
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   135   2e-43
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...   129   8e-41
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...   129   1e-40
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...   128   2e-40
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   127   3e-40
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   126   1e-39
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...   125   3e-39
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   123   2e-38
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   122   5e-38
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   120   3e-37
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   117   3e-36
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...   114   1e-34
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...   105   1e-31
Smik_9.165 Chr9 complement(279003..282467) [3465 bp, 1154 aa] {O...    30   0.25 
SAKL0F09702g Chr6 complement(743532..745562) [2031 bp, 676 aa] {...    28   1.8  
TBLA0D05660 Chr4 complement(1387319..1389571) [2253 bp, 750 aa] ...    26   6.9  

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  151 bits (381), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACIIMAINQFNS
Sbjct: 61 ACIIMAINQFNS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  144 bits (363), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 70/72 (97%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILLLICSCTYVH+QWPS+LDRYKDH ALGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACIIMAINQFNS
Sbjct: 61 ACIIMAINQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  143 bits (361), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 71/72 (98%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYK+HEALGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+MA+NQF S
Sbjct: 61 ACILMALNQFMS 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  142 bits (357), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 71/72 (98%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF+SLLQVILLLICSCTY+HTQWPSLLDRYK+H+ LGAFWKMARIGERASPYVS+
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACIIMAINQFNS 72
          ACI+MAINQFNS
Sbjct: 61 ACILMAINQFNS 72

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  138 bits (348), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 69/72 (95%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILLLICSC+YVH QWPSLLDRYK+HE LGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  138 bits (348), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 69/72 (95%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILLLICSC+YVH QWPSLLDRYK+HE LGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  137 bits (345), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 68/72 (94%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILLLICSC+YVH QWPSLLDRYK+HE  GAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  135 bits (341), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF+SLLQVILLLICS TY+H+QWPS LDRYKD   LGAFWK+ARIGERASPYVSL
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACIIMA+NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  129 bits (324), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 65/72 (90%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNFSSLLQVILLLICS TY+H+QWPSL DRYKD   L  FWK++RIGERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACIIMAINQFNS 72
          ACIIMA+NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  129 bits (323), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 60/71 (84%), Positives = 65/71 (91%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALF+F S+LQVILLLICS TY+H QWPSLLDRYK+H  LGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACIIMAINQFN 71
          ACI MAI+QFN
Sbjct: 61 ACIAMAISQFN 71

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score =  128 bits (322), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 64/72 (88%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILLLICSCTY+HTQWPSLLDRYK+H  L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI MAI+QF S
Sbjct: 61 ACICMAISQFKS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  127 bits (320), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 70/72 (97%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNFSSLLQV+LLLICSCTY+HTQWPSLL+RYKDHEALG FWKMAR+GER SPYVSL
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+MA+NQFNS
Sbjct: 61 ACILMAVNQFNS 72

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  126 bits (317), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 63/72 (87%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALF FS+LLQVILLLICS TYVH QWPSLL+RYK+H  LG FWK ARIGERASPYVS+
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACIIMAINQFNS 72
          ACI MAINQ NS
Sbjct: 61 ACIAMAINQINS 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score =  125 bits (314), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 62/72 (86%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILL ICSCTY+H Q PSLLDRYKD   LG FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI MA++QFNS
Sbjct: 61 ACIAMAVSQFNS 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  123 bits (308), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 69/72 (95%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQV+LLLICSC+YVH QWPSLLDRYK+HE LGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  122 bits (306), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 67/72 (93%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILLL+CSCTYVH QWPSLLDRYKDH   GAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACIIMAINQFNS 72
          ACI+MAINQFNS
Sbjct: 61 ACILMAINQFNS 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  120 bits (300), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 61/72 (84%), Positives = 67/72 (93%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF +LLQV+LLLICSCTY+H+QWPSLLDRYKDH  LGAFWK ARIGERASPYVSL
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACIIMA+NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  117 bits (294), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 67/72 (93%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF +LLQV+LLLICSCTY+H+QWPSLLDRYK+H  LGAFWK ARIGERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACIIMAINQFNS 72
          ACIIMA+NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  114 bits (284), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALFNF SLLQVILLL+CSCTYVH QWPSLLDRYK H  L AFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+MA++Q NS
Sbjct: 61 ACILMALSQLNS 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score =  105 bits (263), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 58/72 (80%), Positives = 61/72 (84%)

Query: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60
          MSALF FSSLLQ+ILLLICS TYVH QWPSLL+RYK H  L  FWK ARIGERASPYVSL
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACIIMAINQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACIVMVANQFNS 72

>Smik_9.165 Chr9 complement(279003..282467) [3465 bp, 1154 aa] {ON}
           YIL026C (REAL)
          Length = 1154

 Score = 30.4 bits (67), Expect = 0.25,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 11  LQVILLLICSCTYVHTQWPSLLDRYKDHEA-----LGAFWK--MARIGERASPYVSLACI 63
            ++++LL+   T+   +W  L+D+  DHEA     L + WK   A IG   +  +SLA I
Sbjct: 860 FKILVLLV---TWNLQKWKELMDKVTDHEASTPKNLRSIWKPIAAIIGRLNTLVISLATI 916

Query: 64  IMAINQFNS 72
                  NS
Sbjct: 917 SDTSGNINS 925

>SAKL0F09702g Chr6 complement(743532..745562) [2031 bp, 676 aa] {ON}
           similar to uniprot|Q12027 Saccharomyces cerevisiae
           YDL176W Hypothetical ORF
          Length = 676

 Score = 28.1 bits (61), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 3   ALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYK 36
           AL NFSS  ++ ++  C C    T    L+DRYK
Sbjct: 519 ALSNFSSFKKLFMVNDCLCLIFDTHGVLLVDRYK 552

>TBLA0D05660 Chr4 complement(1387319..1389571) [2253 bp, 750 aa]
           {ON} Anc_1.221 YJL132W
          Length = 750

 Score = 26.2 bits (56), Expect = 6.9,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 8   SSLLQVILLLICSCTYVHTQWPSLLDRYKDH 38
           S  LQ  L  + +     T W SL+D Y+DH
Sbjct: 104 SKKLQAFLTGVLTHQISDTSWHSLVDNYRDH 134

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.136    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,444,995
Number of extensions: 182255
Number of successful extensions: 520
Number of sequences better than 10.0: 23
Number of HSP's gapped: 520
Number of HSP's successfully gapped: 23
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)