Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G002605.699ON51051020570.0
ZYRO0G06666g5.699ON5035152993e-28
KAFR0D022505.699ON5563342481e-21
Suva_9.435.699ON5133102391e-20
Smik_9.235.699ON5273352363e-20
YIL146C (ATG32)5.699ON5293072311e-19
TDEL0B022205.699ON4892332212e-18
Skud_9.225.699ON5373132203e-18
CAGL0H06545g5.699ON4922362097e-17
KNAG0L021005.699ON4442871411e-08
AFR283W5.699ON4522871365e-08
Kwal_55.197165.699ON4672981366e-08
Ecym_40215.699ON4594851358e-08
KLTH0E01122g5.699ON4721371331e-07
SAKL0E14850g5.699ON4702501294e-07
TBLA0E020905.699ON7491221125e-05
KLLA0A00660g5.699ON5241421125e-05
Kpol_2001.735.699ON4111331000.001
TPHA0D045805.699ON47057761.1
TDEL0B023705.686ON32165687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G00260
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   796   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   119   3e-28
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   100   1e-21
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...    97   1e-20
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...    96   3e-20
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...    94   1e-19
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...    90   2e-18
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...    89   3e-18
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    85   7e-17
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    59   1e-08
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...    57   5e-08
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...    57   6e-08
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...    57   8e-08
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...    56   1e-07
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...    54   4e-07
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    48   5e-05
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...    48   5e-05
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    43   0.001
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             34   1.1  
TDEL0B02370 Chr2 (431434..432399) [966 bp, 321 aa] {ON} Anc_5.68...    31   7.1  

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/510 (79%), Positives = 404/510 (79%)

Query: 1   MQNIDLVRGNHTWRVLEEVQESAGMDNHNDSSECVKSLLDPHLSVLEMLERKDNDTVMEA 60
           MQNIDLVRGNHTWRVLEEVQESAGMDNHNDSSECVKSLLDPHLSVLEMLERKDNDTVMEA
Sbjct: 1   MQNIDLVRGNHTWRVLEEVQESAGMDNHNDSSECVKSLLDPHLSVLEMLERKDNDTVMEA 60

Query: 61  SSRISRSWQNIESPADSKQLLSAKXXXXXXXXXXXXXXXXXXXEEVDRINSLNSAGEGSS 120
           SSRISRSWQNIESPADSKQLLSAK                   EEVDRINSLNSAGEGSS
Sbjct: 61  SSRISRSWQNIESPADSKQLLSAKSSQVSNLVSILSSSSDTSDEEVDRINSLNSAGEGSS 120

Query: 121 KNYNNPSPLQNPIYLPEFTDVTAGDNDDGXXXXXXXXXXXXXXXXXXFVMPTXXXXXXXX 180
           KNYNNPSPLQNPIYLPEFTDVTAGDNDDG                  FVMPT        
Sbjct: 121 KNYNNPSPLQNPIYLPEFTDVTAGDNDDGIASTITKSLTSSSTISNSFVMPTLSLSSSQS 180

Query: 181 XXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELV 240
             RKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELV
Sbjct: 181 QQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELV 240

Query: 241 SLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIINDERALL 300
           SLLNRISEELSF                  VKSILKYFLKNNFVTLLSPIIIINDERALL
Sbjct: 241 SLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIINDERALL 300

Query: 301 KMFKTMQXXXXXXXXXXXXXXXXXXXXXXXXXXXMNDKVIDVKTIKESMMSSQXXXXXXX 360
           KMFKTMQ                           MNDKVIDVKTIKESMMSSQ       
Sbjct: 301 KMFKTMQSISKTVISASSSTTSSDNEEEESSDPSMNDKVIDVKTIKESMMSSQKKKNKKK 360

Query: 361 XXXXXXXEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTR 420
                  EHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTR
Sbjct: 361 HHNNRRKEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTR 420

Query: 421 PGPLSSLIHLKSNKNLLYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAM 480
           PGPLSSLIHLKSNKNLLYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAM
Sbjct: 421 PGPLSSLIHLKSNKNLLYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAM 480

Query: 481 FENLITTTINSKDWKFDEQDRILALCYLLL 510
           FENLITTTINSKDWKFDEQDRILALCYLLL
Sbjct: 481 FENLITTTINSKDWKFDEQDRILALCYLLL 510

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  119 bits (299), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 121/515 (23%), Positives = 204/515 (39%), Gaps = 75/515 (14%)

Query: 36  KSLLDPHLSVLEMLERKDNDTVMEA-------------------SSRISRSWQNIESPAD 76
           +S+LDPHLSVLE+L R  +    EA                   +  IS+SWQ I    D
Sbjct: 24  RSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHR-ND 82

Query: 77  SKQLLSAKXXXXXXXXXXXXXXXXXXXEEVDRINSLNSAGE--GSSKNYNNPSPLQN--- 131
           S   +  +                   +E D +NS ++  +   ++    +   L++   
Sbjct: 83  SCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLEDYRS 142

Query: 132 -----PIYLPE---------FTDVTAGDNDDGXXXXXXXXXXXXXXXXXXFVMPTXXXXX 177
                P+ LPE             T G N  G                  F+MP      
Sbjct: 143 LNVGIPLVLPEDSNNINNNNKNGSTTGSN--GEEDDNDTITKSLNSSSNSFIMP---KLS 197

Query: 178 XXXXXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELK 237
                +KF+IL+ GR G  FY +IPK+YQ++F +P   +     E   +T  L++F+ELK
Sbjct: 198 LSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPA---EFKQYTGILVVFQELK 254

Query: 238 ELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIINDER 297
           E+VSLLNR+ +                      V+++L+  LKN  V+LL P +++N++ 
Sbjct: 255 EMVSLLNRVCQ----CNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQP 310

Query: 298 ALLKMFKTMQXXXXXXXXXXXXXXXXXXXXXXXXXXXMNDKVIDVKTIKESMMSSQXXXX 357
            LL MF+ +Q                                   K +K S+   +    
Sbjct: 311 DLLGMFRFLQELSKTVSDNSDMDAEEPNNGS--------------KRLKRSLQRKKKKFI 356

Query: 358 XXXXXXXXXXEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAH 417
                        R ++     N+WV+W +SLT+G G+GY IS+ V ++   L    +  
Sbjct: 357 ETSAERNGRPHKKRHNNEKV--NRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLG- 413

Query: 418 QTRPGPLSSLIHLKSNKNLLYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKP 477
              P  +S  + +   + L   E    +D+    F +     K+ + Q N   K+ + + 
Sbjct: 414 PVDPESVSKDLFVFDRQELKLGEMDMDSDHP---FGHALFLFKQALKQWNLAVKQFLGRH 470

Query: 478 FAMFENLITTTINSKDWKFDEQ--DRILALCYLLL 510
            +  E +     N  +W   ++  +R+LAL Y++L
Sbjct: 471 LSCMERI--GPANCLEWPTSDEHTNRVLALGYVML 503

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 90/334 (26%), Positives = 145/334 (43%), Gaps = 27/334 (8%)

Query: 184 KFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSLL 243
           +F+ILI GRL    ++ IP ++Q LF +    +    NE   FTA L++ +E +EL+SLL
Sbjct: 243 EFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDI---NEYQKFTAILVVIQETRELISLL 299

Query: 244 NRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLL-SPIIIINDE---RAL 299
           NRIS                        K++LK +L+N+ +TLL  P +I N E   R L
Sbjct: 300 NRISRS---EKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQPFVISNTEELDRML 356

Query: 300 LKMFKTMQXXXXXXXXXXXXXXXXXXXXXXXXXXXMNDKVIDVKTIKESMMSSQXXXXXX 359
           + + +T                              +D  +    +K      +      
Sbjct: 357 VFLKETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVKND--KHRHTKGDG 414

Query: 360 XXXXXXXXEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQT 419
                   EH R    +   NKW++W ISL++G G+GY ISY  F SS   P   +    
Sbjct: 415 SGGSKKGNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISY--FGSS---PWSSLVQYF 469

Query: 420 RP--GPLSSLIHLK-SNKNLLYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRK 476
            P    +S+ + +  SN++ + L  +  +  +  YF  +  F K ++N++    K  IRK
Sbjct: 470 NPESDSISATVPVPLSNESFVLLHDSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRK 529

Query: 477 PFAMFENLITTTINSKDWKFDEQDRILALCYLLL 510
           P   F  L    +N+     D+   +LAL Y+L+
Sbjct: 530 PLNAFSYL--NGLNT-----DDASSLLALGYILI 556

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 6/33 (18%)

Query: 37 SLLDPHLSVLEMLER------KDNDTVMEASSR 63
          S+LDPHLSVLE+LER      + +DT+M  + R
Sbjct: 29 SILDPHLSVLELLERGFQNVHEQDDTIMSTTPR 61

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 87/310 (28%), Positives = 126/310 (40%), Gaps = 49/310 (15%)

Query: 36  KSLLDPHLSVLEMLERKDND---------TVMEASSR------ISRSWQNIESPADSKQL 80
           K LLDPHLSVLE+L +  +          T ++ S+       IS SWQ I+ P D    
Sbjct: 39  KGLLDPHLSVLELLGKTGSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQ-PLDLGAS 97

Query: 81  LSAKXXXXXXXXXXXXXXXXXXXEE--------VDRINSLNSAGEGSSKNYNN------- 125
              +                   EE         D IN +    +G+S    +       
Sbjct: 98  FIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLH 157

Query: 126 -----PSPLQNPIYLPEFTDVTAGDNDDGXXXX---XXXXXXXXXXXXXXFVMPTXXXXX 177
                P P +   +  E  DV   DNDD                      FVMP      
Sbjct: 158 TVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSR 217

Query: 178 XXXXXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELK 237
                  F++LI GR G +FY++ PK+YQ LF +P   ++        +T  +I+F+EL+
Sbjct: 218 KNPV---FRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTI---FPQYTGIVIVFQELR 271

Query: 238 ELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIINDER 297
           E+VSLLNRI E                      VK++LK FLKN+ + LL P ++  + +
Sbjct: 272 EMVSLLNRIVE----YAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRK 327

Query: 298 ALLKMFKTMQ 307
            L KMF+ +Q
Sbjct: 328 DLKKMFQRLQ 337

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 141/335 (42%), Gaps = 56/335 (16%)

Query: 18  EVQESAGMDNHNDSSE---CVKS---------LLDPHLSVLEMLERKDND---------T 56
           E++ES+  D    SS    C +S         LLDPHLSVLE+L +  +          T
Sbjct: 9   EIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPSPMGQSLVT 68

Query: 57  VMEASSR------ISRSWQNIESPADSKQLLSAKXXXXXXXXXXXXXXXXXXXEE----- 105
            ++ S        IS SWQ I+ P D       +                   EE     
Sbjct: 69  SIDISGHQNVNDSISGSWQAIQ-PLDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQ 127

Query: 106 ---VDRINSLNSAGEGSS-KNYNNP-SPLQNPIYLP-------EFTDVTAGDNDDGXXXX 153
               D IN +    EG++  + ++P   L   I LP        + +    D++DG    
Sbjct: 128 APAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEE 187

Query: 154 XXXXXXXXXXXXX-XFVMPTXXXXXXXXXXRKFQILIFGRLGPSFYRTIPKQYQYLFHVP 212
                          FVMP             F++LI GR G +FY++IPK+YQ LF +P
Sbjct: 188 DSVTITKSLTSSTNSFVMPKLSLSQKNPV---FRLLILGRTGSNFYQSIPKEYQSLFELP 244

Query: 213 NQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVK 272
              ++ T      +T  +IIF+EL+E+VSLLNRI +                      VK
Sbjct: 245 KYHDSAT---FPQYTGIIIIFQELREMVSLLNRIVQ----YSQGKPIIPICQPGQTIQVK 297

Query: 273 SILKYFLKNNFVTLLSPIIIINDERALLKMFKTMQ 307
           ++LK FL+N  + LL P +++ + + L KMF+ +Q
Sbjct: 298 NVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQ 332

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 63/152 (41%), Gaps = 27/152 (17%)

Query: 378 FKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTR----------------- 420
           F   W  W IS+T+G   G  ++Y V  +     ++ ++ ++                  
Sbjct: 384 FFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTVKSLSLRSSLLTSMLSLDSSSDTVNT 443

Query: 421 PGPLSSLIHLKSNKNLLYLERTT--PNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPF 478
           P   S      S+++ L+ ++ T   N +       +    KET  ++N      + +P 
Sbjct: 444 PATASP----SSSEHFLWFDKGTLQINFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPL 499

Query: 479 AMFENLITTTINSKDWKFDEQDRILALCYLLL 510
           +  ENL      S D+  DE +RILAL Y+LL
Sbjct: 500 SFLENL----NRSSDFSIDESNRILALGYILL 527

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 95/307 (30%), Positives = 130/307 (42%), Gaps = 48/307 (15%)

Query: 36  KSLLDPHLSVLEMLERKDND---------TVMEASS------RISRSWQNIESPADSKQL 80
           K LLDPHLSVLE+L +  +          T ++ S        IS SWQ I+ P D    
Sbjct: 39  KGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQ-PLDLGAS 97

Query: 81  LSAKXXXXXXXXXXXXXXXXXXXEE--------VDRINSLNSAGEGSSKNYNNPS----P 128
              +                   EE         D IN +    EG+  N  +PS     
Sbjct: 98  FIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGA--NVVSPSHPFKQ 155

Query: 129 LQNPIYLP----EFTD----VTAGDNDDGXXXXXXXXXXXXXXXXXXFVMPTXXXXXXXX 180
           LQ  I LP    E T        GD D+                   FVMP         
Sbjct: 156 LQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNP 215

Query: 181 XXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELV 240
               F++LI GR G SFY++IPK+YQ LF +P   ++ T      +T  +IIF+EL+E+V
Sbjct: 216 V---FRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSAT---FPQYTGIVIIFQELREMV 269

Query: 241 SLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIINDERALL 300
           SLLNRI +                      VK++LK FL+N  V LL P +++ ++R L 
Sbjct: 270 SLLNRIVQ----YSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLK 325

Query: 301 KMFKTMQ 307
           KMF+ +Q
Sbjct: 326 KMFQRLQ 332

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 65/150 (43%), Gaps = 23/150 (15%)

Query: 378 FKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRPGPLS------------ 425
           F   W  W IS+T+G   G  ++Y V  + +   ++ ++   RP  L+            
Sbjct: 386 FFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLS--LRPSILASLLSLDSSSDTI 443

Query: 426 ---SLIHLKSNKNLLYLERTT--PNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAM 480
              +     S +  L+ ++ T   N +S  +   +    KET  ++N+     + KP   
Sbjct: 444 NTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLKF 503

Query: 481 FENLITTTINSKDWKFDEQDRILALCYLLL 510
            ENL      S ++  DE +RILAL Y+LL
Sbjct: 504 LENL----NKSSEFSIDESNRILALGYILL 529

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 100/233 (42%), Gaps = 29/233 (12%)

Query: 36  KSLLDPHLSVLEMLERKDN-----------DTVMEASSRISRSWQNIESPADSKQLLSAK 84
           KSLLDPHLSVLE+LER  +           D +   ++ IS SWQ I    D+      +
Sbjct: 29  KSLLDPHLSVLELLERTGDTQRVGRGVEKADDMANTTNSISSSWQAIHR-NDAMITGVPE 87

Query: 85  XXXXXXXXXXXXXXXXXXXEEVDRINSLNSAG----EGSSKNYNNPSPLQNPIYLPEFTD 140
                              EE+D  +S N A       S +    P  L  P+ LP    
Sbjct: 88  RCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFKLDVPVILPARDQ 147

Query: 141 VTAG-----DNDDGXXXXXXXXXXXXXXXXXXFVMPTXXXXXXXXXXRKFQILIFGRLGP 195
             +G     DNDD                   FVMP            K +ILI GR G 
Sbjct: 148 EPSGQTQTPDNDD--ERDDETLTKSLSNSSNSFVMP---KLSLSQKSHKLRILILGRPGL 202

Query: 196 SFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISE 248
            FY++IPK+YQ+ F +    +    +E   FT  LI+F+ELKE+VSLLNR+ +
Sbjct: 203 KFYQSIPKRYQHFFELSRLQDP---SEFRQFTGILIVFQELKEMVSLLNRVCQ 252

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 72/137 (52%), Gaps = 17/137 (12%)

Query: 380 NKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRPGPLSSLIHLKSNKNLLYL 439
           NKW+VW ISLTVG G+GY +SY  F SS  + +   +       ++S+   + N N++  
Sbjct: 364 NKWIVWGISLTVGVGVGYCMSY--FASSGLISMSAKS-------IASINGCRPNDNVVVF 414

Query: 440 ERTTPNDYSWSY-----FQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDW 494
           + ++     + +     F +     K+T+ Q N   K+ + K   + E+  +++ N K+W
Sbjct: 415 DDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPES--SSSTNYKEW 472

Query: 495 KF-DEQDRILALCYLLL 510
              D  +R+LAL Y+LL
Sbjct: 473 GAEDNSNRVLALGYILL 489

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/313 (27%), Positives = 126/313 (40%), Gaps = 54/313 (17%)

Query: 36  KSLLDPHLSVLEMLERKDND---------TVMEASSR------ISRSWQNIESPADSKQL 80
           K LLDPHLSVLE+L +  +          T ++ SS       IS SWQ I  P D    
Sbjct: 39  KGLLDPHLSVLELLGKTGHSPSPMGHSLVTSIDISSHHYVNDSISGSWQAIH-PLDLGAS 97

Query: 81  LSAKXXXXXXXXXXXXXXXXXXXEE--------VDRINSLNSAGEGSSKNYNNPS-PLQN 131
              +                   EE         D IN +    EG+S    +PS P + 
Sbjct: 98  FVPERSSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGAS--VTSPSRPFRQ 155

Query: 132 -----PIYLPEFTDVTAGDND------------DGXXXXXXXXXXXXXXXXXXFVMPTXX 174
                 + LP     + G+ D                                FVMP   
Sbjct: 156 LHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLS 215

Query: 175 XXXXXXXXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFE 234
                     F++LI GR G +FY++IPK++Q LF +P   ++        +T  +IIF+
Sbjct: 216 LSQKNPV---FRLLILGRTGSNFYQSIPKEHQSLFELPKYHDS---TAFPQYTGIIIIFQ 269

Query: 235 ELKELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIIN 294
           EL+E+VSLLNRI +                      VK++LK FL+N  + LL P +++ 
Sbjct: 270 ELREMVSLLNRIVQ----YSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVT 325

Query: 295 DERALLKMFKTMQ 307
           + R L KMF+ +Q
Sbjct: 326 NRRDLKKMFQRLQ 338

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 23/147 (15%)

Query: 381 KWVVWSISLTVGAGMGYIISYCV-----------FNSSKRLPLEKIA----HQTRPGPLS 425
           +W  W +S+T+G   G  ++Y             FN    +    ++    H T   P +
Sbjct: 397 RWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNLRSSILTSLLSLDSYHDTVNTPAT 456

Query: 426 SLIHLKSNKNLLYLERTT--PNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFEN 483
           +     S +  L+ ++ T   N +S  +   +    K+T +++N      + +P    EN
Sbjct: 457 T--STSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLEN 514

Query: 484 LITTTINSKDWKFDEQDRILALCYLLL 510
           L   +    D+  DE +RILAL Y+LL
Sbjct: 515 LNKNS----DFSLDESNRILALGYILL 537

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 85.1 bits (209), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 103/236 (43%), Gaps = 35/236 (14%)

Query: 168 FVMPTXXXXXXXXXXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFT 227
           FVMP           +K  +L+ GRL   F++ IP++Y+  FH+    +    +E  N+ 
Sbjct: 195 FVMPKLSLTYKPSQAKK--LLVVGRLSKRFHQDIPREYRQYFHISQSSDP---SEFQNYI 249

Query: 228 AFLIIFEELKELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLL 287
             +I+F+ELKE V++LNRI +                      VK+ILK FLKN+ +TL 
Sbjct: 250 GIVIVFQELKEFVAMLNRIVQ----YTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLW 305

Query: 288 SPIIIINDERALLKMFKTMQXXXXXXXXXXXXXXXXXXXXXXXXXXXMNDKVIDVKTIKE 347
            P + I +E+++ K+FK                                + V+ + T  +
Sbjct: 306 YPPVTIANEKSMEKLFK--------------------HTVKLVNKLENEEDVLSLSTSDK 345

Query: 348 SMMSSQXXXXXXXXXXXXXXEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCV 403
           S+                  +H    ST++  +KW+ W ISLT+G  +GY  +Y +
Sbjct: 346 SL----SDETSGYRKNNRRKKHGGKPSTNY--SKWITWGISLTIGVSIGYYATYMI 395

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 37 SLLDPHLSVLEMLERK-DNDTVMEASSRISRSWQNI 71
          S+LDPH SV+E+L+R+ +   V   S  +  SWQ I
Sbjct: 28 SILDPHHSVMELLQRQMEGSEVPSESGVLGESWQQI 63

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 107/287 (37%), Gaps = 38/287 (13%)

Query: 37  SLLDPHLSVLEMLER---KDNDTVMEASSR--------ISRSWQNIESPADSKQLLSAKX 85
           S+LDPHLSVLE+LE+   +        SSR        +S SW  +E     +  LSA  
Sbjct: 7   SVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTVE-----RDELSAME 61

Query: 86  XXXXXXXXXXXXXXXXXXEEVDRINSLNSAGEGSSKNYNNPSPLQNPIYLPEFTDVTAGD 145
                             EE           +GS  +          +  P  +  +   
Sbjct: 62  RSASQQTNNGVLSSSDTSEE-------GEPEQGSPGDGEGGGVADTRMARPAMSLQSTSS 114

Query: 146 NDDGXXXXXXXXXXXXXXXXXXFVMP--------TXXXXXXXXXXRKFQILIFGRLGPSF 197
             DG                  F+MP                   R F++ + GR    F
Sbjct: 115 TLDGVDDDSATVSKSLTSSSNSFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKF 174

Query: 198 YR-TIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISEELSFXXXX 256
            + T+P+Q+++ F +   ++ L   +  +    LI+ +E++EL+SLLNR+          
Sbjct: 175 CQETVPEQFRHRFELTAGVHDLA--QCADRQGILIVVQEVRELISLLNRV----HCACPE 228

Query: 257 XXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIINDERALLKMF 303
                         VK++L+ F +   V+LL P + +++  AL KMF
Sbjct: 229 VPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMF 275

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 112/287 (39%), Gaps = 41/287 (14%)

Query: 36  KSLLDPHLSVLEMLERKDND--------TVMEASSR---------ISRSWQNIESPADSK 78
           K +LDPHLSVLEML+R+D D         VM    R         IS SWQ I+  +D  
Sbjct: 29  KGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKR-SDYS 87

Query: 79  QLLSAKXXXXXXXXXXXXXXXXXXXEEVD-RINSLNSAGEGSSKNYNNPSPLQNPIYLPE 137
            L                       EE + R ++  +   GSS      SP++  + + E
Sbjct: 88  FLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPSAHGTVHLGSSLA----SPMRQ-LLVEE 142

Query: 138 FTDVTAGDNDDGXXXXXXXXXXXXXXXXXXFVMPTXXXXXXXXXXRKFQILIFGRLGPSF 197
             D +  + DD                    VMP            + Q+L+ G+    F
Sbjct: 143 --DNSCAEEDD-----CQTVTISMPSSSTSLVMPKLSLSQRLG---EPQLLLVGQPARKF 192

Query: 198 YRTIPKQYQYLFHVPNQLNTLTRNEMDN-FTAFLIIFEELKELVSLLNRISEELSFXXXX 256
           + TIPK YQ LF V N L  +TR ++   + A +++F ++ +   LL+ + E+       
Sbjct: 193 WLTIPKCYQKLFDVKN-LGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVI 251

Query: 257 XXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIIN--DERALLK 301
                         +K   +Y  +       SPII+ N  ++  LLK
Sbjct: 252 PVCQKGQKSTLAALLK---RYTARKCIRVYCSPIIMSNHHEKHRLLK 295

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 55/138 (39%), Gaps = 30/138 (21%)

Query: 382 WVVWSISLTVGAGMGYIISYCV-----FNSSKRLPLEKIAHQTRPGPLSSLIHLKSNKNL 436
           W +W+ S T+G G+G  IS        F SS  LPL  +     P  ++      S+K  
Sbjct: 336 WAIWTASFTIGIGIGCCISLMATTRFTFFSSAPLPLTAVIPAQIPSSVA------SDKP- 388

Query: 437 LYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWKF 496
               R  P+ Y           CK T+ QL ++ +      F  FE+     I   D   
Sbjct: 389 --PHRLVPHFYM---------LCKTTIRQLGTSLRLFF---FEKFESRTWVHIFGMDLHS 434

Query: 497 DEQ----DRILALCYLLL 510
           D+      R++ L +++L
Sbjct: 435 DDPLASLGRLMPLDFIML 452

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 116/298 (38%), Gaps = 49/298 (16%)

Query: 37  SLLDPHLSVLEMLERKD-------------------NDTVMEASSR-ISRSWQNIESP-- 74
           S+LDPHLSVL++LER +                   + +  E   R IS SWQ+I     
Sbjct: 30  SILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDY 89

Query: 75  ------ADSKQLLSAKXXXXXXXXXXXXXXXXXXXEEVDRINSLNSAGEGSSKNYNNPS- 127
                  ++    +                      E    N   +    +S     PS 
Sbjct: 90  SILNLIGETSHQPAGILSSSDTSEDEPDHFLSPSPNEYAFANGAKTVFPEASHAPEGPSL 149

Query: 128 -PLQNPIYLPEFTDVTAGDNDDGXXXXXXXXXXXXXXXXXXFVMPTXXXXXXXXXXRKFQ 186
             LQ+ +Y  E ++V A DND+                   FVMP           RKF 
Sbjct: 150 ATLQDSVY--EHSNV-AEDNDN------ETVTLSLINSSNSFVMP---KLSLAQPLRKFS 197

Query: 187 ILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRI 246
           ILI G+    FYR IP+ YQ +F V +  +  TR ++D F+A ++IF + K   SLL  +
Sbjct: 198 ILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTR-DVDQFSAIMVIFTDPKNGQSLLEMV 256

Query: 247 SEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIINDERALLKMFK 304
           +   S                   + ++L  F K + + L+  + +++D + + ++ +
Sbjct: 257 TGRSS------NIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLR 308

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 22/128 (17%)

Query: 380 NKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRPGPLSSLIHLKSNKNLLYL 439
           N+WV+WSISLTVG G+GY IS C+ +S+  +         R   L+  +H      L+  
Sbjct: 347 NRWVIWSISLTVGVGIGYCIS-CLLSSTMSV---------RGNTLT--LHSSDEIALIEE 394

Query: 440 ERTTPNDYSW-SYFQNTWEFCKETVNQLNSTFKKIIRK---PFAMFENLITTTINSKDWK 495
              +P++    +YF+      K+ V Q++ +FK+ +     P    + +       KDW 
Sbjct: 395 APISPHETVLENYFRQLVLAFKKAVKQVSQSFKQCLHGHSLPVLWMQRI------GKDWM 448

Query: 496 FDEQDRIL 503
            +  D  L
Sbjct: 449 SEASDTTL 456

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 97/485 (20%), Positives = 179/485 (36%), Gaps = 95/485 (19%)

Query: 14  RVLEEVQESAGMDNHNDSSECVKSLLDPHLSVLEMLERKDNDTV-----MEASSR----- 63
           + +E++Q +    N        +S+LDPHLSVLE+LE K+ + V     +  +SR     
Sbjct: 3   QTVEKMQSNGHTQNGGLPGTTQRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQ 62

Query: 64  ----------ISRSWQNIESPADSKQLLSAKXXXXXXXXXXXXXXXXXXXEEVDRINSLN 113
                     IS SWQ+I+S  D   L  A                    EE   I+   
Sbjct: 63  FEGERVLHHSISESWQSIKS-TDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSP 121

Query: 114 SAGEGSSKNYNNPS-PLQNPIYLPEFTDVTAGDNDDGXXXXXXXXXXXXXXXXXXFVMPT 172
                +S  +++    +    +    + + + D DD                    VMP 
Sbjct: 122 PPPNSASSAFDSRIINIAGQAFSATLSHLRSEDEDD----DGETVTVSLPNTMTSLVMPK 177

Query: 173 XXXXXXXXXXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMD-NFTAFLI 231
                     +   +LI G+    F+ +IPK YQ +F + + L+ L   ++D  ++  ++
Sbjct: 178 LSLSDRIIESK---VLIVGQPARKFWFSIPKSYQKMFEICS-LSVLRDKDVDEKYSTIMV 233

Query: 232 IFEELKELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPII 291
           IF ++     LL+RI  ++                    + S+LK ++  N + L    I
Sbjct: 234 IFHDMGLAPELLDRICNKV----VRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPI 289

Query: 292 IINDERALLKMFKTMQXXXXXXXXXXXXXXXXXXXXXXXXXXXMNDKVIDVKTIKESMMS 351
           ++++     ++ K +                              +  + V+ +K+    
Sbjct: 290 VMSNHHEKHRLLKHLHQLSSGSDSGY-------------------ETEVTVEPVKKLPRK 330

Query: 352 SQXXXXXXXXXXXXXXEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCV-----FNS 406
           ++                 R S  S F++ WVVW+ S+T+G G+G  +S  V     F  
Sbjct: 331 AKK----------------RPSKPSTFRD-WVVWTASITIGIGIGCCVSLMVSTRYAFLV 373

Query: 407 SKRLPLEKIAHQTRPGPLSSLIHLKSNKNLLYLERTTPNDYSWSYFQNTWEFCKETVNQL 466
            ++L ++ I       PLS     KS+ NL               F + +  CK ++ +L
Sbjct: 374 PRQLAVDDIT----SSPLSPEGTDKSSHNL---------------FLHAYSLCKTSLKKL 414

Query: 467 NSTFK 471
            S+ +
Sbjct: 415 ASSLR 419

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 65/137 (47%), Gaps = 10/137 (7%)

Query: 168 FVMPTXXXXXXXXXXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFT 227
           FVMP           +KF ILI G+    FYR IP+ Y  +F V   +  L+  EM+ ++
Sbjct: 189 FVMP---KLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEV-RDVGHLSPREMNKYS 244

Query: 228 AFLIIFEELKELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLL 287
           A ++IF E KE   LL +++   S                   + +IL  + K+N + L+
Sbjct: 245 AVMVIFGEPKEGKELLEKVAAHNS------NIIAVCQRGQQQQISNILNRYSKSNEIRLV 298

Query: 288 SPIIIINDERALLKMFK 304
             + +++D + + ++ +
Sbjct: 299 YHLTVMSDHQDVHRLLR 315

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 18/20 (90%)

Query: 380 NKWVVWSISLTVGAGMGYII 399
           N+WV+WSISLTVG G+GY I
Sbjct: 354 NRWVIWSISLTVGVGLGYCI 373

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 20/56 (35%)

Query: 37 SLLDPHLSVLEMLERKD----------NDTVMEASSR----------ISRSWQNIE 72
          S+LDPHLSVL++L+R D           +    A+ R          IS SWQ+I+
Sbjct: 39 SILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIK 94

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 102/250 (40%), Gaps = 49/250 (19%)

Query: 36  KSLLDPHLSVLEMLER---KDNDTVMEASSRI--------------------------SR 66
           +S+LDPH SVL++LER   +  + V +ASS+I                          S 
Sbjct: 29  RSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSISD 88

Query: 67  SWQNIESPADSKQLLSAKXXXXXXXXXXXXXXXXXXXEEVDRINSLNSAGEGSSKNYNNP 126
           SWQ+I+    S  +L++                    EE+D    LNS    S + + N 
Sbjct: 89  SWQSIKMVDYS--ILNSLHDTSSSQAVGILSSSDTSEEELDH---LNSPSPSSQQVFPNG 143

Query: 127 SPL----QNPIYLPEFTDVTAG--DNDDGXXXXXXXXXXXXXXXXXXFVMPTXXXXXXXX 180
            P+    Q  +     T    G  + DD                   FVMP         
Sbjct: 144 PPISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLAASSNS-----FVMP---QLSLSQ 195

Query: 181 XXRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELV 240
              +F+IL+ G+    F+  +PK YQ +F +     +++  ++ ++TA +IIF++ KE+ 
Sbjct: 196 RSHRFEILVVGKPARKFWNNVPKMYQKMFDI-GDFESISAPKVSHYTAVMIIFQDTKEVS 254

Query: 241 SLLNRISEEL 250
            +L+ +  +L
Sbjct: 255 FILDSLVTKL 264

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 380 NKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTR 420
           N+WV+W +SLTVG G+G  IS+ + + S  +   +I H +R
Sbjct: 352 NRWVIWGLSLTVGVGIGCCISFILSSYSSSV---QIPHASR 389

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 7/122 (5%)

Query: 183 RKFQILIFG-RLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVS 241
           RKF+ILI G     +FY+ IP  Y+YLF +P   N    N   ++    I+  +L +  S
Sbjct: 348 RKFRILILGSNQNLTFYQNIPTSYKYLFELP--PNNFDYN-FKHYAGIAIVIHDLTDFKS 404

Query: 242 LLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVTLLSPIIIINDERALLK 301
           +LN+I +   +                  VK+ILK ++K   ++LL P I+  +   +  
Sbjct: 405 ILNKIDK---YSMNKKPIIPICEKGQINEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNT 461

Query: 302 MF 303
           ++
Sbjct: 462 LY 463

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 60/145 (41%), Gaps = 22/145 (15%)

Query: 381 KWVVWSISLTVGAGMGYIISY-----------CVFNSSKRLPLEKIAHQTRPGPLSSLIH 429
           K + W++SL+VG G+G+ +SY            +      L  E +       P+ S   
Sbjct: 612 KIIYWTVSLSVGVGLGFCLSYYASTIFSNISESISKGINTLISESVTPTVSDTPIPSPTT 671

Query: 430 LKSNKNL----LYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLI 485
               +NL     Y+       +S S F       K T+  LN T K+I   P  +  N +
Sbjct: 672 YSMEENLSTTCHYVGEKVKETFSNSLF-----LLKTTLRNLNWTTKQIWNSPQGL--NGV 724

Query: 486 TTTINSKDWKFDEQDRILALCYLLL 510
              + SK   +++   ILAL ++LL
Sbjct: 725 DQILPSKYNFYEDPAMILALGFVLL 749

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 67/142 (47%), Gaps = 10/142 (7%)

Query: 168 FVMPTXXXXXXXXXXRKFQILIF--GRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDN 225
           FVMP           ++F+ILI   G    SFY  + + ++ +F V  +LN  ++ E   
Sbjct: 226 FVMP---KLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDV-GKLNEASKEEALK 281

Query: 226 FTAFLIIFEELKELVSLLNRISEELSFXXXXXXXXXXXXXXXXXXVKSILKYFLKNNFVT 285
           +TAF+IIF + K++ ++LNR+ ++                     V   +K F  +N + 
Sbjct: 282 YTAFMIIFSDSKKVTTILNRMWKKYG----DFTLIPICQKGQKQSVTEKVKTFANSNKIK 337

Query: 286 LLSPIIIINDERALLKMFKTMQ 307
           L+S  ++I+D   +  + + + 
Sbjct: 338 LMSYPVVISDHYEIHGLLRHLH 359

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 29/133 (21%)

Query: 381 KW--VVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRPGPLSSLIHLKSNKNLLY 438
           KW  V + IS+T+G G+GY IS  V + +    ++ I   T   P + +I L+S      
Sbjct: 305 KWLFVYYGISITLGVGVGYCISSLVVSQNSN-DIQSIVPST---PNNDIIALESQD---- 356

Query: 439 LERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWK-FD 497
           L     +DY+W++                   K  I+  +++ +  ITT+IN  ++K  +
Sbjct: 357 LNSHNGDDYNWNF------------------LKLSIKNVYSILKRFITTSINLLEYKTLN 398

Query: 498 EQDRILALCYLLL 510
           + ++I+A+ Y+LL
Sbjct: 399 DSNKIIAMSYVLL 411

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 36 KSLLDPHLSVLEMLERKDNDTVMEASSRISRSWQ 69
          K LLDPH SVL++LE   N+     S  +S SWQ
Sbjct: 3  KHLLDPHYSVLKLLENNFNNP--NDSMNLSESWQ 34

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 455 TWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWK-FDEQDRILALCYLLL 510
           TW+F   TV  +    K II KP +             +W+  D+ +RI+A+ Y+LL
Sbjct: 423 TWDFLTSTVRHICVIMKYIILKPISFL---------GSNWQNLDDSNRIIAMSYVLL 470

>TDEL0B02370 Chr2 (431434..432399) [966 bp, 321 aa] {ON} Anc_5.686
           YKR088C
          Length = 321

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 385 WSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRP-GPLSSLIHLKSNKNLLYLERTT 443
           WSI L  GA +G + S+C+F +      EK+ H  R     ++++   ++  +L L R  
Sbjct: 155 WSI-LAFGAVIGSVASFCLFKTLLHSQAEKLVHSNRRFEAFAAILQENNSYWVLALIRLC 213

Query: 444 PNDYS 448
           P  YS
Sbjct: 214 PFPYS 218

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,783,942
Number of extensions: 1647440
Number of successful extensions: 5341
Number of sequences better than 10.0: 22
Number of HSP's gapped: 5425
Number of HSP's successfully gapped: 44
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)