Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G002505.700ON1183118356200.0
NDAI0F003105.700ON1259124938510.0
KAFR0D022405.700ON1187116434940.0
KNAG0L021105.700ON1200121034660.0
Suva_9.415.700ON1219122434650.0
Skud_9.215.700ON1221123533980.0
Kwal_55.197075.700ON1143116331420.0
TPHA0D045905.700ON112793525090.0
ZYRO0G06644g5.700ON116671223610.0
CAGL0H06567g5.700ON116970223400.0
Smik_9.225.700ON123074223150.0
YIL147C (SLN1)5.700ON122074123090.0
SAKL0E14872g5.700ON114071521020.0
TDEL0B022105.700ON109570620980.0
Kpol_2001.745.700ON111372020460.0
KLTH0E01100g5.700ON117774620040.0
KLLA0A00638g5.700ON115570519990.0
Kpol_1043.685.700ON104271118080.0
TPHA0E002505.700ON106872317950.0
Ecym_40205.700ON112571217360.0
AFR284W5.700ON110373816420.0
TBLA0E021005.700ON114073714990.0
TBLA0I016805.700ON12144259851e-113
TBLA0A107004.385ON5871241692e-11
Ecym_74744.385ON4961361622e-10
KNAG0M001804.385ON6151241603e-10
KLLA0A10219g4.385ON4751221593e-10
KAFR0B069904.385ON5451241593e-10
Kpol_265.24.385ON5491241594e-10
ADL388W4.385ON4821221584e-10
TPHA0C001504.385ON5101271585e-10
CAGL0F09097g4.385ON6301391577e-10
NCAS0A064504.385ON6091221577e-10
ZYRO0G00484g4.385ON6471231578e-10
TDEL0D003204.385ON5471221551e-09
NDAI0D034304.385ON5971211551e-09
KLTH0D17182g4.385ON4641471541e-09
SAKL0B12408g4.385ON4651221532e-09
Smik_8.2964.385ON6251661532e-09
Skud_8.2734.385ON6231671532e-09
Kwal_47.167704.385ON4611251513e-09
YHR206W (SKN7)4.385ON6221521523e-09
Suva_15.4124.385ON6171651514e-09
Ecym_50775.230ON7951391471e-08
Smik_12.685.230ON7121381462e-08
Suva_10.845.230ON6951381452e-08
TDEL0E039805.230ON7301311409e-08
Kwal_33.152885.230ON5871591391e-07
KAFR0J007005.230ON6201171353e-07
Skud_12.725.230ON7021381353e-07
ADR343C5.230ON7491391345e-07
KNAG0B051405.230ON6481371335e-07
YLR006C (SSK1)5.230ON7121381336e-07
KLTH0B02684g5.230ON5951561319e-07
ZYRO0A11154g5.230ON7761371282e-06
NCAS0D029005.230ON7621301238e-06
Kpol_1004.45.230ON7141411184e-05
CAGL0D02882g5.230ON6671381166e-05
NDAI0I020005.230ON8901341157e-05
KLLA0E09505g5.230ON635741112e-04
TPHA0N008505.230ON6701361068e-04
TBLA0D031705.230ON7651851069e-04
SAKL0G12100g5.230ON738751020.003
CAGL0K12562g8.34ON1682140980.008
KLLA0E04533g7.222ON42181960.012
Klac_YGOB_Anc_8.348.34ON1571110900.078
SAKL0B01210g8.34ON1588110870.19
Kwal_47.181517.222ON41481840.27
TBLA0B015507.222ON39481840.28
SAKL0F08184g7.222ON41281840.28
CAGL0L00869g7.222ON41981830.35
Kpol_1035.408.34ON1517113820.65
YFL033C (RIM15)8.34ON1770128810.85
Suva_9.1587.222ON393109781.3
KLTH0G18612g8.34ON152474791.3
Ecym_43787.222ON44382781.4
Ecym_15088.34ON1694134781.7
Skud_6.388.34ON1758111781.7
ADL116C7.222ON43593781.7
ACR218W8.34ON1569132781.9
TBLA0G034508.34ON197286781.9
TDEL0C005908.34ON1602130781.9
KNAG0D017507.222ON40999762.3
Suva_6.268.34ON1753129772.5
Kwal_23.55345.267ON190799772.9
Smik_6.468.34ON1760129763.1
TPHA0D003608.34ON1536129763.2
KNAG0J017208.678ON62588763.2
KLTH0D11066g8.669ON49365753.5
Kwal_14.11598.34ON152172738.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G00250
         (1183 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  2169   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...  1488   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1350   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1339   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  1339   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1313   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1214   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   971   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   914   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   905   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   896   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   894   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   814   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   812   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   792   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   776   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   774   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   701   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   696   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   673   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   637   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   582   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   384   e-113
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    70   2e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    67   2e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    66   3e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    66   3e-10
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    66   3e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    66   4e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    65   4e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    65   5e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    65   7e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    65   7e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    65   8e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    64   1e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     64   1e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    64   1e-09
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    64   2e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    64   2e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    64   2e-09
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    63   3e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    63   3e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    63   4e-09
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    61   1e-08
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    61   2e-08
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    60   2e-08
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    59   9e-08
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    58   1e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    57   3e-07
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    57   3e-07
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    56   5e-07
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    56   5e-07
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    56   6e-07
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    55   9e-07
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    54   2e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    52   8e-06
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    50   4e-05
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    49   6e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    49   7e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    47   2e-04
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    45   8e-04
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    45   9e-04
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    44   0.003
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    42   0.008
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    42   0.012
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    39   0.078
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    38   0.19 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    37   0.27 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    37   0.28 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    37   0.28 
CAGL0L00869g Chr12 complement(107233..108492) [1260 bp, 419 aa] ...    37   0.35 
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    36   0.65 
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    36   0.85 
Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON...    35   1.3  
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    35   1.3  
Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar t...    35   1.4  
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    35   1.7  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    35   1.7  
ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON} S...    35   1.7  
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    35   1.9  
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    35   1.9  
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    35   1.9  
KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {O...    34   2.3  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    34   2.5  
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...    34   2.9  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    34   3.1  
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    34   3.2  
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    34   3.2  
KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} simila...    33   3.5  
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    33   8.3  

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score = 2169 bits (5620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1071/1183 (90%), Positives = 1071/1183 (90%)

Query: 1    MKVNLSKWYVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 60
            MKVNLSKWYVLKPPFRLGIRTQ                  TTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MKVNLSKWYVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120
            AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN
Sbjct: 61   AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120

Query: 121  NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180
            NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL
Sbjct: 121  NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180

Query: 181  NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240
            NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV
Sbjct: 181  NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240

Query: 241  YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300
            YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA
Sbjct: 241  YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300

Query: 301  VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360
            VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP
Sbjct: 301  VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360

Query: 361  IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420
            IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT
Sbjct: 361  IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420

Query: 421  NGHLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSKKL 480
            NGHLNQRG                 NFATEMISNANTSQRANSISRFTDHTDLSNRSKKL
Sbjct: 421  NGHLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKL 480

Query: 481  TTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIE 540
            TTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIE
Sbjct: 481  TTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIE 540

Query: 541  AETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXX 600
            AETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSG       
Sbjct: 541  AETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHIL 600

Query: 601  XXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILF 660
                 FSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILF
Sbjct: 601  TELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILF 660

Query: 661  GDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIE 720
            GDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIE
Sbjct: 661  GDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIE 720

Query: 721  TKAKAILGAPKKDDPKTSTESVVQIKENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 780
            TKAKAILGAPKKDDPKTSTESVVQIKENL                               
Sbjct: 721  TKAKAILGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEED 780

Query: 781  XXXXXXXXXXMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIA 840
                      METQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIA
Sbjct: 781  NSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIA 840

Query: 841  IEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEV 900
            IEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEV
Sbjct: 841  IEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEV 900

Query: 901  GVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXX 960
            GVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKF                 
Sbjct: 901  GVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTTT 960

Query: 961  XXXXXXXHNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDR 1020
                   HNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDR
Sbjct: 961  FSTTNSLHNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDR 1020

Query: 1021 PFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQD 1080
            PFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQD
Sbjct: 1021 PFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQD 1080

Query: 1081 AFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKE 1140
            AFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKE
Sbjct: 1081 AFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKE 1140

Query: 1141 CLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMKVAEDNKSKNE 1183
            CLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMKVAEDNKSKNE
Sbjct: 1141 CLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMKVAEDNKSKNE 1183

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score = 1488 bits (3851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 770/1249 (61%), Positives = 898/1249 (71%), Gaps = 86/1249 (6%)

Query: 9    YVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQ 68
            +VLKPPFR+GIR Q                  TTGVYFT+NYKNLRSDRLYIAAQLKSSQ
Sbjct: 7    FVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQ 66

Query: 69   IDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQL 128
            IDQ LNYLYYQ Y++SSRDTLQ  LTNYVAGNK+ ENWADS  ++QKFL+S+NLFS A++
Sbjct: 67   IDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKV 126

Query: 129  YDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMS 188
            YD+SF  VL  TNNGTGD IP+S+L KL PL+TN PLSSSLET GILTDPVLN STY+MS
Sbjct: 127  YDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMS 186

Query: 189  MSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLN 248
            MSLPIFANPS+IL +S+VYGY+T+VMSAEGL+TVFNDTTALE+SNVAIVS VYNN S L 
Sbjct: 187  MSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALT 246

Query: 249  AYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTF 308
            AY FVFAP GAPSY+INST+R+ N SFL++ALREGKGGS+K TKFFY+KN+A+GYSPCTF
Sbjct: 247  AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTF 306

Query: 309  SFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKAT 368
            SFVNW+A+VSQ ESVFLSPSTKLAKII+GTVVAIGVFVF++TFPLAHWAVKPIVRLQKAT
Sbjct: 307  SFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKAT 366

Query: 369  ELMSEGRGLKSTTPGSKNVSR-------------------SSSIKHYV-RSNIPSTASSV 408
            EL+SEGRGLKST P S++VSR                   +SS++ Y     I  T S  
Sbjct: 367  ELISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQIYPTHSYQ 426

Query: 409  HN----FSGDNLSTTTNG------------HLNQRGXXXXXXXXXXXXXXXXXNFATEMI 452
            HN     S   LS +  G            + N                    NF ++ +
Sbjct: 427  HNTIRNMSPQRLSPSPLGLSINRHNHNNDINNNNNNNNNISPDNNLNLPLHGNNFQSDSV 486

Query: 453  SNANTSQ------RANSISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLT 506
            SN +  Q      R++S+  F+DHT+ S +S  LTTSANLIEARVPDYRRLFSDELSDLT
Sbjct: 487  SNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLT 546

Query: 507  DTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGI 566
            DTFN MTDALDQHYALLEDRVRARTKQLEAAKIEAE ANEAKT+FIANISHELRTPLNGI
Sbjct: 547  DTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGI 606

Query: 567  LGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDV 626
            LGMTAISMEETDI+KIRSSLKLIFRSG            FSKNVLKRTTLEKRDFCITDV
Sbjct: 607  LGMTAISMEETDISKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDV 666

Query: 627  ALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGK 686
            ALQIKSIFGKVAKDQRV+LSI L PN IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDGK
Sbjct: 667  ALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGK 726

Query: 687  VNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIET-----KAKAILGAPKKDDPKTSTES 741
            VNV++KL+GEYDE LS ++NFK+V VK GTE +       K    + +PK ++  +S+ +
Sbjct: 727  VNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTNESIPSPKSENNNSSSTT 786

Query: 742  VVQIKENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMETQSIVSTST 801
              +   N                                           +  S+VSTST
Sbjct: 787  SGKDTTNSETSFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTST 846

Query: 802  SSYDDAVFNNQFKKTPELYEDEDGN-LGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFE 860
            SSYDDA+FN+QFKK+P LY+D++ N  G+ + +PKTWVI I V+DTGPGID +LQ+SVF+
Sbjct: 847  SSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQ 906

Query: 861  PFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELEL 920
            PFVQGDQTLSRQYGGTGLGLSICRQLANMM+GTM+LKSEVGVGSTFTFTVPL QTRE+  
Sbjct: 907  PFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINF 966

Query: 921  NEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXXHNVQEEKEEDKLG 980
            ++ +HPFEDEFNP SRKNR+VKF                        ++V E +EE K G
Sbjct: 967  DDMEHPFEDEFNPESRKNRKVKFKLARSIRSKKSRASTVTFGTVTDLNHVPENEEEIKNG 1026

Query: 981  DNEETKDGGKEEDAHQERRHSHDKNNEH-------------------------------- 1008
                    G      +E  +S++    H                                
Sbjct: 1027 SQASVGSSGSSSSDGEESNNSNNSTTHHSEDRTNTSENTNNNNIHEKEHKHKHEHTHNHS 1086

Query: 1009 NNHLLGTVNMDRPFLQSTGTATSTRTIQTVP------DAGKKFKILVAEDNHVNQEVIKR 1062
            +NH    V++DRPFLQSTGTATS+R +  +       D  +  KILVAEDNHVNQEVIKR
Sbjct: 1087 HNHGDYPVSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKR 1146

Query: 1063 MLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHY 1122
            MLNLEGV  I+LA DGQ+AF++VK + EQ + +++IFMDVQMPKVDGLLSTKMIR DLHY
Sbjct: 1147 MLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHY 1206

Query: 1123 TYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQ 1171
             +PIVALTAFADDSNIKECLE+GMNGFLSKPIKRPK++TI++EYCP W+
Sbjct: 1207 DHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 1350 bits (3494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1164 (59%), Positives = 838/1164 (71%), Gaps = 28/1164 (2%)

Query: 12   KPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 71
            KPP+R+ IRTQ                  TTGVYFTS+YKNLR++RLYIAAQLKSSQIDQ
Sbjct: 24   KPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83

Query: 72   NLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDS 131
             L YLYYQSYW+S+RDTLQ  L N+VAGNK++ NW  +E V++KFL+S++ FS  ++YD 
Sbjct: 84   TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143

Query: 132  SFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSL 191
            +F+ VL+ TNNGTG+ I   VL+KL+PL+TN PLSSSLET GILTDPVLNG++Y+MSMSL
Sbjct: 144  NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203

Query: 192  PIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAYH 251
            P+FANPSIIL+ S+VYGYITI+M+A+GL +VFNDTTA+E+SNVAIVS VYNN+S L+AYH
Sbjct: 204  PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263

Query: 252  FVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSFV 311
                PYG  + V +  F++ N+SFLN AL++GKGGS+KKT F Y K +AVGYSPC+F   
Sbjct: 264  LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323

Query: 312  NWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELM 371
            NW+++VSQ ESVF  PSTKL KII+G VV I VFV L+T PLA++AVKPIVRL+KATE++
Sbjct: 324  NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383

Query: 372  SEGRGLKSTTPGSKNVSRSSSIKH--YVRSNIPSTASSVHNFSGDNL---STTTNGHLNQ 426
            +EGRGL+ TTPGS +VSR+SS++     R++I S+  S    + ++L   S + + H   
Sbjct: 384  TEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGNSNSLNENSASLSSHPMV 443

Query: 427  RGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTD-LSNRSKKLTTSAN 485
                               N   E++  A+ S   N+++   D  D LS RSK L T  N
Sbjct: 444  LTSENVLVTNHSGLSRIPVNMNQELLDRASAST-VNTLT--IDSNDRLSERSKHLITFTN 500

Query: 486  LIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETAN 545
            L EARVP  R+LF DELSDLT+TFN MTDALD+HY LLEDRVRARTKQLEAAKI+AE AN
Sbjct: 501  LTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEAAN 560

Query: 546  EAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXX 605
            EAKT+FIANISHELRTPLNGILGMTAISMEE DI KIRSSLKLIFRSG            
Sbjct: 561  EAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTELLT 620

Query: 606  FSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNR 665
            FSKNVL+RT LEKR+FCITDVALQ+KSIFGKVAKDQ VRLSI+L PNI+RTM+L+GDSNR
Sbjct: 621  FSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNR 680

Query: 666  IIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKAK- 724
            IIQ+VMNLVSNALKFTPVDGKV V+IKL+GEYDE  S+ S F+KV VK GTEF    A+ 
Sbjct: 681  IIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTSIPAEL 740

Query: 725  AILGAPKKDDPKTSTESVVQIKENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 784
            A L   +       + S   IKE L                                   
Sbjct: 741  AALSKRESTAGSHFSGSSSHIKEKL-----DGIPANVFASDSDSDDPSEGTTINTSQQRT 795

Query: 785  XXXXXXMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQ 844
                  ++  SI STSTSSYDDA+FN+QFKKTP+LYEDEDGNLG EL+  KTWV  IEV 
Sbjct: 796  SSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVI 855

Query: 845  DTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGS 904
            DTGPGID SLQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMNGTM L+S VG GS
Sbjct: 856  DTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGS 915

Query: 905  TFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXX 964
             F FTVPL QTR ++L+E +HP+EDEFNP S+ NR+VKF                     
Sbjct: 916  KFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSNSS 975

Query: 965  XXXHNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQ 1024
                 V+EE   +   ++ +     K E A  +     +            +N+DRPFLQ
Sbjct: 976  RIA-TVREESRLETRSNHSDVSTSNKNESASPQPESGSN------------LNLDRPFLQ 1022

Query: 1025 STGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNE 1084
            STGTA S+  + TV   GK   +LVAEDNHVNQEVIKRML+LEGV+NI+LA DGQDAF+ 
Sbjct: 1023 STGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDN 1082

Query: 1085 VKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEA 1144
            VK++ E+GE +DMIFMDVQMPKVDGL +TKMIRNDL Y +PIVALTAFADDSNIKECL+A
Sbjct: 1083 VKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDA 1142

Query: 1145 GMNGFLSKPIKRPKVKTILEEYCP 1168
            GM+GFLSKPIKRP++KTIL EYCP
Sbjct: 1143 GMDGFLSKPIKRPQLKTILLEYCP 1166

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/1210 (58%), Positives = 843/1210 (69%), Gaps = 74/1210 (6%)

Query: 8    WYVL-----KPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAA 62
            W+ L     KPP+R+GIR Q                  TTGVYFTSNYKNLRSDRLYIAA
Sbjct: 2    WFRLRSFTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAA 61

Query: 63   QLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNL 122
            QLKSSQIDQNLNYLYYQ YW++SRDTLQ GL NYVAGNK+  NW DS+ V++KFL S+NL
Sbjct: 62   QLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNL 121

Query: 123  FSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNG 182
            FS A++YDSSF  VL  TNN TGDLIPE VL +L PL+TN PL SSLET GI+T+PV NG
Sbjct: 122  FSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNG 181

Query: 183  STYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYN 242
            S+Y+MSMSLPIFANPSIILTDS+VYGY+T+VMSAEGL +VFNDTTALE+S VAIVS VY 
Sbjct: 182  SSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYT 241

Query: 243  NESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVG 302
            N + L+AY FVF P+G+ S ++N TF + NN+FL++ALR+GKGG++K T+ FY   +AVG
Sbjct: 242  NATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVG 301

Query: 303  YSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIV 362
            YSP T +  NW+AIV+Q ESVF+SP+TKLAKII+GTVV IGVF  LITFPLAHWAVKPIV
Sbjct: 302  YSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIV 361

Query: 363  RLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNG 422
            RLQKATEL++E RGL+ TTP S   SR++SI   +R      +  +H  S +N++   + 
Sbjct: 362  RLQKATELITESRGLRPTTPTSG--SRANSI---LRDKSSLISFPLHPVSTNNINNNNSN 416

Query: 423  HLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTD-LSNRSKKLT 481
               Q                   N   E   +A+      S+S  +D  + LSN SK  T
Sbjct: 417  EKAQPPSDQDTNTNNSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYT 476

Query: 482  TSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEA 541
            T+ NLI+ARVP YR LF DELSDLT+TFN MTDALDQHYALLE+RVRARTKQLEAAKIEA
Sbjct: 477  TAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEA 536

Query: 542  ETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXX 601
            ETANEAKT+FIANISHELRTPLNGILGMTAISMEETDI KIR+SLKLIFRSG        
Sbjct: 537  ETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILT 596

Query: 602  XXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFG 661
                FSKNVLKRT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSI+L PN+IR+M+L+G
Sbjct: 597  ELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYG 656

Query: 662  DSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIET 721
            DSNRIIQIVMNLVSNALKFTPVDGKV+VR+K++G YDE LS + N  KV VK GTE  ++
Sbjct: 657  DSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDS 716

Query: 722  KAKAILGAPKKDDPKTSTESVVQIKENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 781
                         P  + +S  Q K+                                  
Sbjct: 717  T------------PSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDED 764

Query: 782  XXXXXXXXXMETQSIVSTSTSSYDDAVFNNQFKKTPELY-EDEDGNLGIELTNPKTWVIA 840
                      + +S++S++TSSYDDA+FN+QFKKT  LY ED++  +G+EL  PKTWVI+
Sbjct: 765  NMYE------DNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVIS 818

Query: 841  IEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEV 900
             EV+D+GPGID  LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M L+S+V
Sbjct: 819  FEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKV 878

Query: 901  GVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXX 960
            GVGS FTFT+PL QTRE+     + PFEDEFN  S+KNR+VKF                 
Sbjct: 879  GVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKF-RMARSLNSRKSRSSIV 937

Query: 961  XXXXXXXHNVQ------------EEKEEDKLGDNEETKDG-----GKEEDAHQERRH-SH 1002
                   H+V             +    D++  N   + G       E D H    H + 
Sbjct: 938  TAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNR 997

Query: 1003 DKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTI-------------------------QT 1037
            DK++E  +    T+++DRPFLQSTGTATSTR+I                         + 
Sbjct: 998  DKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKK 1057

Query: 1038 VPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDM 1097
              +    +KILVAEDNHVNQEVIKRML LEGV++I+LA DGQDAF++VK + ++G  +++
Sbjct: 1058 TSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNL 1117

Query: 1098 IFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRP 1157
            IFMDVQMPKVDGL STKMIR+DLH  +PIVALTAFADDSNIKECL+AGM+GFLSKPIKR 
Sbjct: 1118 IFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRT 1177

Query: 1158 KVKTILEEYC 1167
            K+KTIL+E+C
Sbjct: 1178 KLKTILKEFC 1187

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 1339 bits (3465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1224 (60%), Positives = 856/1224 (69%), Gaps = 58/1224 (4%)

Query: 1    MKVNLSKWYVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 60
            M+  L    V  PPFR+ IR Q                  TTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120
            AAQLKSSQIDQ LNYLYYQ+Y+L+SRD LQ  LT YVAGNK+++NW DS  ++QKFL+S+
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120

Query: 121  NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180
            NLF  A++YDSSF  VL ATNNGTGDLIP+ +  +L+PL+T+  L SSLET GILTDP+L
Sbjct: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180

Query: 181  NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240
            N + Y+MSMSLPIFANPSIILTDS+VYGYITI+MSAEGLK+VFNDTTALE+SNVAI+S V
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240

Query: 241  YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300
            YNN+S   AYHFVF PYG  S +  + F I NN+F+++A + GKGGS+KKT  F  KN+A
Sbjct: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300

Query: 301  VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360
            +GYSPC+F  VNW+A+VSQ ESVFLSPSTKLAKII+GTV+AIGVFV L+T PLAHWAV+P
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420
            IVRLQKATEL++EGRGL+ +TP  + VSR+SS K    S     +S +   SG+  STT+
Sbjct: 361  IVRLQKATELITEGRGLRPSTP--RTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTS 418

Query: 421  NGHLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRAN--------SISRFTDHTD 472
                   G                 N   E +S     +R          S+    +H  
Sbjct: 419  ASGHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDL 478

Query: 473  LSNRSKK-------------LTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQH 519
            L+  + +             LTTSANL EAR+PDYRRLFSDELSDLT+TFN MTDALDQH
Sbjct: 479  LAPNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH 538

Query: 520  YALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDI 579
            YALLEDRVRARTKQLEAAKIEAE ANEAKT+FIANISHELRTPLNGILGMTAISMEETD+
Sbjct: 539  YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV 598

Query: 580  AKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAK 639
             KIR+SLKLIFRSG            FSKNVL+RT LEKRDFCITDVALQIKSIFGKVAK
Sbjct: 599  NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK 658

Query: 640  DQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDE 699
            DQRVRLSI L PN IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDG V VR+KL+GEYD+
Sbjct: 659  DQRVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDK 718

Query: 700  NLSRESNFKKVLVKSGTEFIETKAKAILGAPKKDDPKTSTESVVQIKENLXXXXXXXXXX 759
             LS +  FK+V V+ GTE IE      +G   K D K S      +              
Sbjct: 719  ELSEKKQFKEVHVRKGTEIIED-----IGNINKHDAKKSENFKKSMDSESTTTSMTSNRD 773

Query: 760  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMETQSIVSTSTSSYDDAVFNNQFKKTPEL 819
                                            +  SIVSTSTSSYDDA+FN+QF K    
Sbjct: 774  TSTIQEEITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGS 833

Query: 820  YEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLG 879
             +DE G+LG  + NPKTW I+IEV+DTGPGIDPSLQ+SVF PFVQGDQTLSRQYGGTGLG
Sbjct: 834  DDDEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLG 893

Query: 880  LSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNR 939
            LSICRQLANMM+GTM+L+S+VGVGS FTFT+PL QT+E+     + PFEDEFNP SR+NR
Sbjct: 894  LSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNR 953

Query: 940  RVKFXXXXXXXXXXXXXXXXXXXX--------XXXXHNVQEEKEEDKLGDNEETKDGGKE 991
            RVKF                                    EE+E  K+ + EE K+GG E
Sbjct: 954  RVKFNVARSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNE 1013

Query: 992  ED-AHQERRHSHDKN---------NEHNN---------HLLGTVNMDRPFLQSTGTATST 1032
             D AHQ+ +  + KN         NE  +           +G+VN+DRPFLQSTGTATS 
Sbjct: 1014 LDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSN 1073

Query: 1033 RTIQTVPDAGK---KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMV 1089
            R I TV ++ K     KILV EDNHVNQEVIKRMLNLEG+ENIELA DGQDAF++VK + 
Sbjct: 1074 RNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELT 1133

Query: 1090 EQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGF 1149
             +GE ++MIFMDVQMPKVDGLLSTKMIR DL YT PIVALTAFADDSNIKECLE+GMNGF
Sbjct: 1134 SRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGF 1193

Query: 1150 LSKPIKRPKVKTILEEYCPNWQMK 1173
            LSKPIKRPK+KTIL E+C  +Q K
Sbjct: 1194 LSKPIKRPKLKTILIEFCAAYQGK 1217

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 1313 bits (3398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 720/1235 (58%), Positives = 857/1235 (69%), Gaps = 80/1235 (6%)

Query: 1    MKVNLSKWYVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 60
            M+  L       PPFR+GIR Q                  TTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120
            AAQLKSSQ+DQ LNYLYYQ+Y+L+SRD LQ  LT+YVAGNK+ +NW DS  V+QKFL+S+
Sbjct: 61   AAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120

Query: 121  NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180
            NLF  A++YDSSF  VL ATNNGTGDLIPE VL  L+PL+T+ PL SSLET GILTDP++
Sbjct: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180

Query: 181  NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240
            N + Y+MSMSLPIFANPSIILTDS+VYGYITIVMSAEGLK+VFNDTTALE+SNVAI+S  
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240

Query: 241  YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300
            YN +   + YHFVF PYG    +    F I NN+F+++  R GKGGS+KKT  F TKN+A
Sbjct: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300

Query: 301  VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360
            +GYSPC+F  VNW+A+VSQ ESVFLSP+TKL KII+GTV+AIGVFV L+T PL HWAVKP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360

Query: 361  IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420
            IVRLQKATEL++EGRGL+ +TP  + VSR+SS +    S   + +S +   +G+  STT+
Sbjct: 361  IVRLQKATELITEGRGLRPSTP--RTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTS 418

Query: 421  NGHLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQR-------------------- 460
                   G                 N   E +S +    +                    
Sbjct: 419  ANGHGSSGHGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDL 478

Query: 461  --ANSISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQ 518
               NS+ R  D    S+RS  LTTSANL EAR+PDY+RLFSDELSDLT+TFN MTDALDQ
Sbjct: 479  LAPNSL-RNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQ 537

Query: 519  HYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETD 578
            HYALLEDRVRARTKQLEAAKIEAE ANEAKT+FIANISHELRTPLNGILGMTAISMEETD
Sbjct: 538  HYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETD 597

Query: 579  IAKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVA 638
            + KIR++LKLIFRSG            FSKNVL+RT LE+RDFCITDVALQIKSIFGKVA
Sbjct: 598  VNKIRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVA 657

Query: 639  KDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYD 698
            KDQRVRLSI L PN+IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDG V+VR+KL+GEYD
Sbjct: 658  KDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYD 717

Query: 699  ENLSRESNFKKVLVKSGTEF---IETKAK----AILGAPKKDDPKTSTESVVQIKENLXX 751
            ++ S +  FK+V VK GTE    +E+  K      LG  K  + +++T S+   ++N   
Sbjct: 718  KDSSEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDN--- 774

Query: 752  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMETQSIVSTSTSSYDDAVFNN 811
                                                    +  SIVST+TSSYDDA+FN+
Sbjct: 775  ---------SAIQEEITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNS 825

Query: 812  QFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSR 871
            QF K  +   DE GN+G  + NPKTWVI+IEV+DTGPGI+PSLQ+SVF+PFVQGDQTLSR
Sbjct: 826  QFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSR 885

Query: 872  QYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEF 931
            QYGGTGLGLSICRQLANMM+GTM+L+S+VGVGS FTFT+PL QT+E+     + PFEDEF
Sbjct: 886  QYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEF 945

Query: 932  NPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXX----------XXHNVQEEKEEDK--L 979
            NP S+KNRRVKF                                   + +EE E+ K  +
Sbjct: 946  NPESKKNRRVKFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFI 1005

Query: 980  GDNEETKDGGKEEDAHQERRHSHD------------------KNNEHNNHLLGTVNMDRP 1021
               E   + GK +   QE+   H                   ++ E N   LG+VN+DRP
Sbjct: 1006 KRKEGENENGKAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEEN---LGSVNIDRP 1062

Query: 1022 FLQSTGTATSTRTIQTVPDA---GKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDG 1078
            FLQSTGTATS+R + TV      G   KILV EDNHVNQEVI+RMLNLEG++NIELA DG
Sbjct: 1063 FLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDG 1122

Query: 1079 QDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNI 1138
            Q+AF++VK +  +GE+++MIFMDVQMPKVDGLLSTKMIR DL Y  PIVALTAFADDSNI
Sbjct: 1123 QEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNI 1182

Query: 1139 KECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMK 1173
            KECLE+GMNGFLSKPIKRPK+ TIL E+C  +Q K
Sbjct: 1183 KECLESGMNGFLSKPIKRPKLNTILSEFCAAYQGK 1217

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1214 bits (3142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1163 (54%), Positives = 806/1163 (69%), Gaps = 57/1163 (4%)

Query: 11   LKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
            L+ P  + IRTQ                   TGVYFTS++K+LR++RL++AAQLKSSQID
Sbjct: 17   LRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQID 76

Query: 71   QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130
            QNLNYLYYQ YWLS+RD LQ  LT Y+AGN + ENW+D+   + KFL S+NLFS A++YD
Sbjct: 77   QNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYD 136

Query: 131  SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190
            SSF  VL  +NNG+G+LIPE++L +L+PL+T+  L SSLE  G+LTDPVLNGS Y+MSMS
Sbjct: 137  SSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMS 196

Query: 191  LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250
            LPIFANPSIIL+ +KVYGYIT+V+SAEGLK+V+NDTTAL+ S+V IVS VY++   L  Y
Sbjct: 197  LPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHE-LAGY 255

Query: 251  HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310
            H VF PY     VIN  ++I N SFL  A+++GKGGS+K T+FF  K IAVGYSPC  + 
Sbjct: 256  HLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTL 315

Query: 311  VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370
              W+AI++Q E++FLSPST+LAKII GT +AI V   ++TFPL+HWAV+PIVRLQKATE+
Sbjct: 316  AQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEI 375

Query: 371  MSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRGXX 430
            ++ GRGL+S          SS++  + R+   STA S  +  G   S   +G + + G  
Sbjct: 376  ITAGRGLRS--------DNSSTLFSHKRT---STAESFSSIFGTG-SVRRSGSVARAGRD 423

Query: 431  XXXXXXXXXXXXXXXNFATEMISNANTS----QRANSISRFTDHTD-LSNRSKKLTTSAN 485
                           + A   ++  N      Q+ NS + ++   +  + +S++  TS N
Sbjct: 424  KYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTN 483

Query: 486  LIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETAN 545
            LIEARVP Y+RLFSDELS+LT+TFN MTD LD+HYALLEDRVRART+QLEAAKIEAE AN
Sbjct: 484  LIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGAN 543

Query: 546  EAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXX 605
            EAKT+FIANISHELRTPLNGILGMTAI+M E D AK++SSLKLIFRSG            
Sbjct: 544  EAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLT 603

Query: 606  FSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNR 665
            FSKNVLKRT LE+RDF I D+ALQ++SIFGK+AKDQ V L+I +LPN++R+M+L+GDSNR
Sbjct: 604  FSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNR 663

Query: 666  IIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKAKA 725
            I+QIVMNLVSNALKFTPVDGKV+V+ +L+GEYDE  S+ S +K+V V   TE   +  +A
Sbjct: 664  IVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEA 723

Query: 726  ILGAPKKDDPKTSTESVVQIKENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 785
                  KD+   + ES V    N+                                    
Sbjct: 724  ------KDE--KNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDE 775

Query: 786  XXXXXMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQD 845
                  +T+SI S +TSSYDDA+F  + +K     E+E+G     L +PK WVI++EV D
Sbjct: 776  DDENE-DTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGR---ALESPKKWVISMEVHD 831

Query: 846  TGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGST 905
            TGPGIDP+L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM+GTM+L S+VGVGS 
Sbjct: 832  TGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSK 891

Query: 906  FTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXX 965
            F+FTVPL QT+EL   + ++PFEDEFNP S+KNR+VKF                      
Sbjct: 892  FSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKS----------------- 934

Query: 966  XXHNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQS 1025
               N + +   +  G      +GG          +S    +E +   +G+V +DRPFLQS
Sbjct: 935  ---NKRSKSRSESSGTE---GNGGNSPGVEGSGGNSPGTGSEVS---VGSVRVDRPFLQS 985

Query: 1026 TGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEV 1085
            TGTA ST T+ T      + KILVAEDN+VNQEVIKRMLNLEG+E++ELA DGQDAF++V
Sbjct: 986  TGTALST-TLVTTSSLADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKV 1044

Query: 1086 KAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAG 1145
            KA    G+H+D+IFMDVQMP+VDGL +T+MIR +L Y++PIVALTAFADDSNIKECL+AG
Sbjct: 1045 KAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAG 1104

Query: 1146 MNGFLSKPIKRPKVKTILEEYCP 1168
            MNGFLSKPIKRPK+K IL+EYCP
Sbjct: 1105 MNGFLSKPIKRPKIKAILKEYCP 1127

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1127

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/935 (55%), Positives = 652/935 (69%), Gaps = 35/935 (3%)

Query: 12  KPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 71
           KPP+R+ IR Q                  T GVYFT+NYKNL++ RLYIAAQLK+SQIDQ
Sbjct: 10  KPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69

Query: 72  NLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDS 131
            LNYLYYQ Y+LSS +TLQ  L +Y AGN ++ NW +S  V++KFLTS++LFS A+LYD+
Sbjct: 70  TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129

Query: 132 SFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSL 191
           +FN ++ ATNN +G+ +PESV+ KL+ L+ N  L SSLETIGI TDPVLNGS ++MSMSL
Sbjct: 130 NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189

Query: 192 PIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAYH 251
           PIFANPSIIL+DS++YGY++++MSAEGLK+VFNDTTALE S V ++S  Y+  + L  ++
Sbjct: 190 PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249

Query: 252 FVFA-PYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310
           F+FA  Y       +  +RI N++F+   L  GKGG+VKKT  F     AVGYS C+FS 
Sbjct: 250 FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309

Query: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370
           VNW+AIV+Q E+ F   +TKL +IISG VVA+ VFV L+TFPL+HWAV+P++RLQKATE 
Sbjct: 310 VNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATER 369

Query: 371 MSEGRGLKSTTP--GSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRG 428
           ++EGRGL+   P  GS +VSR+SSIK   R+++ +   S   F+ + LS + +       
Sbjct: 370 IAEGRGLRPPQPTVGS-SVSRNSSIKW--RNSLENHVRSSLGFNANKLSDSGS------- 419

Query: 429 XXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIE 488
                              ++ +  N N+S  +  I+      DLS+ S+K  TSANLIE
Sbjct: 420 --ITANNFKNNTSSSNSITSSHIYGNNNSSHSSMGIN---PDDDLSSSSQKYKTSANLIE 474

Query: 489 ARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAK 548
           ARVP Y RL  DELS+LTDTFN MTDALDQHY LLE+RVRARTKQLEAAKI+AE+ANEAK
Sbjct: 475 ARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAK 534

Query: 549 TIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXXFSK 608
           T+FIANISHELRTPLNGILGMTAISMEE D+ KIR +LKLIFRSG            FSK
Sbjct: 535 TVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFSK 594

Query: 609 NVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQ 668
           NVL+RT LEKRDFCIT+VALQIKSIFGK+AKDQ V+LSI+L+PNI+R+ +L+GDSNRIIQ
Sbjct: 595 NVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQ 654

Query: 669 IVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKAKAILG 728
           +VMNLVSNALKFTPVDG V+VRI L+GEYDE  S+  ++KKV VK GTE     +   L 
Sbjct: 655 VVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISH--LK 712

Query: 729 APKKDDPKTSTESVVQIKENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 788
             + +D    +E+ +   EN                                        
Sbjct: 713 TEENNDISRKSETELNNDEN-------------ETHTISKDDTADSSIKIGNEDVEISEV 759

Query: 789 XXMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGP 848
             M   S+V+TS+ SYDD     Q  K+ +L +DE+  LG+EL   KTWVI++EV+DTG 
Sbjct: 760 DKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDEN-KLGVELKEQKTWVISVEVKDTGS 818

Query: 849 GIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTF 908
           GIDP LQ+SVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MMNGTMEL+SEVGVGS F F
Sbjct: 819 GIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIF 878

Query: 909 TVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKF 943
           T+PL QTRE+ +  DD  F DEFN  S+KNR+VKF
Sbjct: 879 TLPLKQTREISI-PDDELFNDEFNAVSKKNRKVKF 912

 Score =  207 bits (528), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 101/169 (59%), Positives = 129/169 (76%), Gaps = 12/169 (7%)

Query: 1015 TVNMDRPFLQSTGTATSTRTIQTV---PDAGKKFK---------ILVAEDNHVNQEVIKR 1062
            +V ++RPFLQSTGTATST+ + T+    D   K K         ILVAEDNHVNQEVIKR
Sbjct: 959  SVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKR 1018

Query: 1063 MLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHY 1122
            ML LEG+ NI+LARDGQDAF++ K + E   ++D+IFMDVQMP++DGL +TKMIR +L+Y
Sbjct: 1019 MLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNY 1078

Query: 1123 TYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQ 1171
            T PIVAL+AF  + N+KECL+ GMN FLSKPIKRP +K IL++Y  ++Q
Sbjct: 1079 TQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/712 (66%), Positives = 545/712 (76%), Gaps = 30/712 (4%)

Query: 11  LKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
            + P RLGIR Q                  +TGVYFT NYKNLRS+RLY+AAQLKS+QID
Sbjct: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70

Query: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130
           QNLNY+YYQ YWLSSRDTLQ  L NYVAGNKT  NW DS  VIQKFLTS+ LFS A +YD
Sbjct: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130

Query: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190
           ++F  VL+ATNNGTG+ IPES L +L PL+ N+PL SSL++ GILT+PVLNG++Y+MSMS
Sbjct: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190

Query: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250
           LPIFANPSIILT S VYGYITIVMSA+ LK VF+DTTALE+SNVAI+S VY+   TL++Y
Sbjct: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250

Query: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310
           +FVFAP G PS ++  T  I N +FL++ALR+GKGG++++TKF YTK +AVGYSPC+  F
Sbjct: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310

Query: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370
           VNWIA+V Q E+VF+ P+TKL KIISGTVV IGVFV L+TFPLAHWAVKPIVRLQKATEL
Sbjct: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370

Query: 371 MSEGRGLKSTTP--GSKNVSRSSSIKHY---VRSNIPSTASSVHNFSGDNLSTTTNGHLN 425
           ++EGRGL++++P  GS NVSR SS  H      S+I S  +  HN  G +L    +G   
Sbjct: 371 ITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDL----HGEQI 426

Query: 426 QRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSAN 485
           Q G                  FA  M  + N S  A+  S  + +  LS++SK LTTSAN
Sbjct: 427 QHGF-----------------FA--MNGSINHSLAASIAS--SGNEALSDKSKGLTTSAN 465

Query: 486 LIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETAN 545
           LIEARVP YRR FSDELS+LTDTFN MTDALDQHYALLEDRVRART+QLEAAKI+AE AN
Sbjct: 466 LIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAAN 525

Query: 546 EAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXX 605
           EAKT+FIANISHELRTPLNGILGMTAISMEE DI KI++SLKLIFRSG            
Sbjct: 526 EAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLT 585

Query: 606 FSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNR 665
           FSKNVLKRT LEKR+F +TDVALQIKSIFGKVAKDQRVRLSI L PN+IRTM+LFGDSNR
Sbjct: 586 FSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNR 645

Query: 666 IIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTE 717
           IIQIVMNLVSNALKFTPVDGKVNV + L+GEYD   S   N KKV V  GTE
Sbjct: 646 IIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE 697

 Score =  234 bits (596), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (84%), Gaps = 3/157 (1%)

Query: 1015 TVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIEL 1074
            +V +DRPFLQSTGTA+S   + T     K   ILVAEDN VNQEVIKRMLNLEGV NIEL
Sbjct: 955  SVRLDRPFLQSTGTASSNTNLGTTSTINK---ILVAEDNDVNQEVIKRMLNLEGVHNIEL 1011

Query: 1075 ARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFAD 1134
              DGQ+A ++VK +VE GEH+++IFMDVQMPK+DGLLSTKMIR DL+YT+PIVALTAFAD
Sbjct: 1012 VCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFAD 1071

Query: 1135 DSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQ 1171
            DSNI+ECL+AGM+GFL+KPIKR +++ I+EE+CP+ Q
Sbjct: 1072 DSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQ 1108

 Score =  214 bits (545), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 117/140 (83%)

Query: 804 YDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFV 863
           Y+D VF++QFKKTP++ +D    LG+E+ + K WVI+I V+DTGPGID SL +SVFEPFV
Sbjct: 776 YNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFV 835

Query: 864 QGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNED 923
           QGDQ LSRQYGGTGLGLSICRQLA MMNGTM+LKS++GVGS FTFTVPL QTRE+  ++ 
Sbjct: 836 QGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDI 895

Query: 924 DHPFEDEFNPASRKNRRVKF 943
              FEDEFNP S+KNR+VKF
Sbjct: 896 PAAFEDEFNPDSKKNRKVKF 915

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/702 (66%), Positives = 545/702 (77%), Gaps = 25/702 (3%)

Query: 11  LKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
           LKPPFR+GIR Q                  TTGVYFTSNYKNLRSDRLYIAAQLKSSQ+D
Sbjct: 14  LKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLD 73

Query: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130
           QNLNYLYYQ YWL+SRDTLQ  L +YVAGNKT ENW +S  VIQKFL+S+NLF  +++YD
Sbjct: 74  QNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYD 133

Query: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190
             F  VL  TNNGTGD +PES+  +L+PL+T+ PL SSL T G+LTDPVLNG+ Y+MSMS
Sbjct: 134 YDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMS 193

Query: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250
           LPIFANPSII +D KVYGYIT+VMSAEGL++VFNDTTALE+SNVAIVS  Y+N + +++Y
Sbjct: 194 LPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSY 253

Query: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310
            FVF PYG    ++N TF + ++SFLN A ++ KGGS+KKTKFFYTK++A+GY PC+F+F
Sbjct: 254 RFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNF 313

Query: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370
           VNW+A+VSQ ESVFLSPSTKL KIISGTVV I VFV L+TFPLA WAVKPIVRLQKATEL
Sbjct: 314 VNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATEL 373

Query: 371 MSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRGXX 430
           ++EGRGL+     + + SRS S    ++ +I        NF    LS +   H       
Sbjct: 374 IAEGRGLRPAG--AGSGSRSGSRTSSMKKDINDL-----NFIS-RLSLSEKNH------- 418

Query: 431 XXXXXXXXXXXXXXXNFATE--MISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIE 488
                          N+AT+  +  +  TSQ +N   R +D+   S+RS+ LTTS NL E
Sbjct: 419 -----RPAYDSASDSNYATDGSLSHDLQTSQASN---RPSDNDRSSSRSRFLTTSTNLNE 470

Query: 489 ARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAK 548
           AR+PDYRRLFSDELSDLT+TFNAMTDALDQHYALLEDRVRARTKQLEAAKI+AE ANEAK
Sbjct: 471 ARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAK 530

Query: 549 TIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXXFSK 608
           T+FIANISHELRTPLNGILGMTAISMEETDIAKIR+SLKLIFRSG            FSK
Sbjct: 531 TVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSK 590

Query: 609 NVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQ 668
           NVLKRT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSI L PN+IRTM+L+GDSNRIIQ
Sbjct: 591 NVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQ 650

Query: 669 IVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKV 710
           IVMNLVSNALKFTPVDGKVNVRIKL+GEYDE  ++  NFK++
Sbjct: 651 IVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQI 692

 Score =  459 bits (1182), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/390 (61%), Positives = 286/390 (73%), Gaps = 17/390 (4%)

Query: 804  YDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFV 863
            YD+A+FN QFKKTP+LYED +  LG EL + KTWV AIEV+DTGPGIDP L +SVFEPFV
Sbjct: 769  YDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFV 828

Query: 864  QGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNED 923
            QGDQTLSRQYGGTGLGLSICRQLA MM+GTM+L+S+VGVGS FTFTVPL QTR ++ +E+
Sbjct: 829  QGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEE 888

Query: 924  DHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXX-----------XXXXXXXXXHNVQE 972
            +  FEDEFNP S+KNRRVKF                                     + E
Sbjct: 889  EDLFEDEFNPESKKNRRVKFKDSTRSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISE 948

Query: 973  EKEED--KLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTAT 1030
             K+ED  +  + +     G E D+      S   N +        V++DRPFLQSTGTAT
Sbjct: 949  VKDEDIEQSPEPDNLPKVGDENDSKASSSSSKSDNIKEKEE---KVHLDRPFLQSTGTAT 1005

Query: 1031 STRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVE 1090
            S+R + T+ D   +FKILVAEDNHVNQEVIKRMLNLEG+ NI+LA DGQDAF++V+++VE
Sbjct: 1006 SSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVE 1065

Query: 1091 QGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFL 1150
            Q + +DMIFMD+QMPKVDGLLSTKMIR DL+Y   IVALTAFADDSNIKEC+EAGMNGFL
Sbjct: 1066 QNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFL 1125

Query: 1151 SKPIKRPKVKTILEEYCPNW-QMKVAEDNK 1179
            SKPIKRPK+K ILEEYCPNW +MK +++NK
Sbjct: 1126 SKPIKRPKLKMILEEYCPNWIEMKKSKENK 1155

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/742 (64%), Positives = 559/742 (75%), Gaps = 25/742 (3%)

Query: 1   MKVNLSKWYVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 60
           M++ L       PPFR+GIR Q                  TTGVYFTSNYKNLRSDRLYI
Sbjct: 1   MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120
           AAQLKSSQIDQ LNYLYYQ+Y+L+SRD LQ  LT++VAGNK+A+NW DS  V+QKFL+S+
Sbjct: 61  AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120

Query: 121 NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180
           NLF  A++YDSSF  VL ATNNGTGDLIPE VL  L+PL+T+ PL SSLET GILTDPV+
Sbjct: 121 NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180

Query: 181 NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240
           N + Y+MSMSLPIFANPSIILTDS+VYGYITI+MSAEGLK+VFNDTTALE+SNVAI+S +
Sbjct: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240

Query: 241 YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300
           YNN+   + YHF+F PYG  S +  S F I NN+F+++A R GKGGS+K+T  F  KN+A
Sbjct: 241 YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300

Query: 301 VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360
           +GYSPC+F  VNW+A+VSQ ESVFLSP+TKLAKII+GTV+AIGVFV L+T PLAHWAV+P
Sbjct: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361 IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420
           IVRLQKATEL++EGRGL+ +TP  + VSR+SS K    S     +S +   +G++ ST +
Sbjct: 361 IVRLQKATELITEGRGLRPSTP--RTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTIS 418

Query: 421 NGHLNQRGXXXXXXXXXXXXXXXXXNFATEM---------ISNANTSQRA---------- 461
                  G                 N   E          I N NT  +           
Sbjct: 419 ASGHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDL 478

Query: 462 ---NSISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQ 518
              NS+ R  D    SNRS  LTTSANL EAR+PDYRRLFSDELSDLT+TFN MTDALDQ
Sbjct: 479 LAPNSL-RNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQ 537

Query: 519 HYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETD 578
           HYALLEDRVRARTKQLEAAKIEAE ANEAKT+FIANISHELRTPLNGILGMTAISMEETD
Sbjct: 538 HYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETD 597

Query: 579 IAKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVA 638
           + KIR+SLKLIFRSG            FSKNVL+RT LEKRDFCITDVALQIKSIFGKVA
Sbjct: 598 VNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVA 657

Query: 639 KDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYD 698
           KDQRVRLSI L PN+IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDG V+VR+KL+GEYD
Sbjct: 658 KDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYD 717

Query: 699 ENLSRESNFKKVLVKSGTEFIE 720
           ++LS +  FK+V VK GTE  E
Sbjct: 718 KDLSEKKQFKEVHVKRGTEITE 739

 Score =  472 bits (1214), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 248/413 (60%), Positives = 289/413 (69%), Gaps = 33/413 (7%)

Query: 804  YDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFV 863
            YDDA+FN+QF K P   EDE GNLG  + NPKTWVI+IEV+DTGPGIDPSLQ+SVF PFV
Sbjct: 818  YDDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFV 877

Query: 864  QGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNED 923
            QGDQTLSRQYGGTGLGLSICRQLANMMNGTM L+S+VGVGS FTFT+PL QT+E+     
Sbjct: 878  QGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANM 937

Query: 924  DHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXX--HNVQEE---KEEDK 978
            D PFEDEFNP SRKNRRVKF                          ++V  E   K E++
Sbjct: 938  DFPFEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQ 997

Query: 979  LGDNEET---KDG----GKEEDAHQERR----------HSHDKNNEHNNHL-----LGTV 1016
            +   E +   ++G    G+ E   QE+            S +K      H      LG+V
Sbjct: 998  IKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSV 1057

Query: 1017 NMDRPFLQSTGTATSTRTIQTVPDAGK---KFKILVAEDNHVNQEVIKRMLNLEGVENIE 1073
            N+DRPFLQSTGTATS+R + T+ D  K     KILV EDNHVNQEVIKRMLNLEG+ENIE
Sbjct: 1058 NLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIE 1117

Query: 1074 LARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFA 1133
            LA DGQ+AF++VK +  +G +++MIFMDVQMPKVDGLLSTKMIR DL Y  PIVALTAFA
Sbjct: 1118 LACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFA 1177

Query: 1134 DDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMK---VAEDNKSKNE 1183
            DDSNIKECLE+GMNGFLSKPIKRPK+KTIL E+C  +Q K     E  K+K E
Sbjct: 1178 DDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKITSEEPKKAKTE 1230

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/741 (64%), Positives = 561/741 (75%), Gaps = 23/741 (3%)

Query: 1   MKVNLSKWYVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 60
           M+  L     L PPFR+GIRTQ                  TTGVYFTSNYKNLRSDRLYI
Sbjct: 1   MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120
           AAQLKSSQIDQ LNYLYYQ+Y+L+SRD LQ  LT+YVAGNK+A+NW DS  VIQKFL+S+
Sbjct: 61  AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120

Query: 121 NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180
           NLF  A++YDSSFNAVL ATNNGTGDLIPE VL  L+PL+T+ PL SSLETIGILTDPVL
Sbjct: 121 NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180

Query: 181 NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240
           N + Y+MSMSLPIFANPSIILTDS+VYGYITI+MSAEGLK+VFNDTTALE S +AI+S V
Sbjct: 181 NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240

Query: 241 YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300
           YN++   + YHFVF PYG+ S +    F I N++F+++A R GKGGS+K+T    T+N A
Sbjct: 241 YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300

Query: 301 VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360
           +GYSPC+F+ VNW+AIVSQ ESVFLSP+TKLAKII+GTV+AIGVFV L+T PLAHWAV+P
Sbjct: 301 LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361 IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420
           IVRLQKATEL++EGRGL+ +TP  + +SR+SS K    S     +S +   + +  STT+
Sbjct: 361 IVRLQKATELITEGRGLRPSTP--RTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTS 418

Query: 421 NGHLNQRGXXXXXXXXXXXXXXXXXNFATEMIS---------NANTSQRAN---SIS--- 465
                  G                 N   E +S         N +T  + +   S++   
Sbjct: 419 VSGHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDL 478

Query: 466 ------RFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQH 519
                 R  D    SNRS  LTTSANL EAR+PDYRRLFSDELSDLT+TFN MTDALDQH
Sbjct: 479 LGPHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH 538

Query: 520 YALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDI 579
           YALLE+RVRARTKQLEAAKIEAE ANEAKT+FIANISHELRTPLNGILGMTAISMEETD+
Sbjct: 539 YALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV 598

Query: 580 AKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAK 639
            KIR+SLKLIFRSG            FSKNVL+RT LEKRDFCITDVALQIKSIFGKVAK
Sbjct: 599 NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK 658

Query: 640 DQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDE 699
           DQRVRLSI L PN+IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDG V+VR+KL+GEYD+
Sbjct: 659 DQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK 718

Query: 700 NLSRESNFKKVLVKSGTEFIE 720
            LS +  +K+V +K GTE  E
Sbjct: 719 ELSEKKQYKEVYIKKGTEVTE 739

 Score =  475 bits (1222), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 242/399 (60%), Positives = 286/399 (71%), Gaps = 29/399 (7%)

Query: 804  YDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFV 863
            YD+A+FN+QF K P   ++E GNLG  + NPKTWVI+IEV+DTGPGIDPSLQ+SVF PFV
Sbjct: 818  YDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFV 877

Query: 864  QGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNED 923
            QGDQTLSRQYGGTGLGLSICRQLANMM+GTM+L+S+VGVGS FTFT+PL QT+E+   + 
Sbjct: 878  QGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADM 937

Query: 924  DHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXX--XXXXHNVQEE-----KEE 976
            + PFEDEFNP SRKNRRVKF                          ++V  E     K E
Sbjct: 938  EFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHE 997

Query: 977  DK------LGDNEETKDGGKEE-------------DAHQERRHSHDKNNEHNNHLLGTVN 1017
             K      +G  E+  +GG E+              A    ++S    +   +  LG+VN
Sbjct: 998  TKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVN 1057

Query: 1018 MDRPFLQSTGTATSTRTIQTVPDAGK---KFKILVAEDNHVNQEVIKRMLNLEGVENIEL 1074
            +DRPFLQSTGTATS+R I TV D  K     KILV EDNHVNQEVIKRMLNLEG+ENIEL
Sbjct: 1058 LDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIEL 1117

Query: 1075 ARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFAD 1134
            A DGQ+AF++VK +  +GE+++MIFMDVQMPKVDGLLSTKMIR DL YT PIVALTAFAD
Sbjct: 1118 ACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFAD 1177

Query: 1135 DSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMK 1173
            DSNIKECLE+GMNGFLSKPIKRPK+KTIL E+C  +Q K
Sbjct: 1178 DSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGK 1216

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1140

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/715 (60%), Positives = 528/715 (73%), Gaps = 13/715 (1%)

Query: 11  LKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
           LKPPF++GIRTQ                  TTGVYFT+NYK+LR+DRL++AAQLKSSQID
Sbjct: 11  LKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQID 70

Query: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130
           QNLNYLYYQ YWLS+RDTLQ  L  Y AGN T ENW+++E V++KFL S++LFS A++YD
Sbjct: 71  QNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYD 130

Query: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190
           S+F  VL ATNNG+G+L+PE VL  L+PL+T+ PL+SSL+T GILTDPVLN + Y+MSMS
Sbjct: 131 STFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMS 190

Query: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250
           LPIFA+PSI+LT+S++ GYIT+VMSAE LK VFNDTTAL++S+VAI+S  Y+N+S   +Y
Sbjct: 191 LPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSY 250

Query: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310
           HFVF P+G  + +I+ +F I N SF+ +A  + K GSVK+T FFY K++AVGYSPC F  
Sbjct: 251 HFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQ 310

Query: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370
           V W+A++SQ E+VFLSPST+L  II GT + I VF+ L+TFPLAHWAVKPIVRLQKATE+
Sbjct: 311 VQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEI 370

Query: 371 MSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTN-GHLNQRGX 429
           ++  RGL+S    S   SR++S +       PST+SS+    G    T T+  H    G 
Sbjct: 371 ITARRGLRSYNQ-SAPASRTNSFRKR-----PSTSSSI----GSVFRTITDRPHERDNGH 420

Query: 430 XXXXXXXXXXXXXXXXNFATEM-ISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIE 488
                               E+ IS A       + + +T+    S +S     S NLI+
Sbjct: 421 SNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQH-SYKSDNFVNSTNLID 479

Query: 489 ARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAK 548
           ARVP Y RLFSDELS+LTDTFN MTD LD+HYALLEDRVRARTKQLEAAKIEAE ANEAK
Sbjct: 480 ARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAK 539

Query: 549 TIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXXFSK 608
           T+FIANISHELRTPLNGILGMTAISM E D+ K+++SLKLIFRSG            FSK
Sbjct: 540 TVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSK 599

Query: 609 NVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQ 668
           NVL+RT LE+R+F I DVALQ+KSIFGK+AKDQ V LSI+L PN+IRTMIL+GDSNRIIQ
Sbjct: 600 NVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQ 659

Query: 669 IVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKA 723
           IVMNLVSNALKF+PVDGKV VRIKL+GEYD   S++SN+  V +K GTE  +  A
Sbjct: 660 IVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASA 714

 Score =  432 bits (1110), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/381 (57%), Positives = 273/381 (71%), Gaps = 36/381 (9%)

Query: 804  YDDAVFNNQFKKTPELYEDEDG--NLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEP 861
            YDDA+ + Q +K P     ED   +LG +L   KTWVIAIEV+DTGPGI+P+L +SVFEP
Sbjct: 793  YDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEP 852

Query: 862  FVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELN 921
            FVQGDQTLSRQYGGTGLGLSICRQLA MM GTM+L+S+VGVGS FTFTVPL QTRE+  +
Sbjct: 853  FVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFD 912

Query: 922  EDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXXHNVQEEKEEDKLGD 981
            + ++PFEDEFN  S+KNR+VKF                         N    K    +  
Sbjct: 913  DVENPFEDEFNAHSKKNRKVKFKMN---------------------KNSGGSKSRPSVNT 951

Query: 982  NEET-KDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTVPD 1040
            +  +  D   E+ A  E   S           +G+V +DRPFLQSTGTATSTR+I TV  
Sbjct: 952  SLNSGTDSTAEKMALSESEVS-----------VGSVRVDRPFLQSTGTATSTRSITTVKS 1000

Query: 1041 AGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFM 1100
              + FKILVAEDN+VNQEV+KRMLNLEG+ +I+LA DGQ+AF++VKA+ E  +H+ +IFM
Sbjct: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060

Query: 1101 DVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVK 1160
            DVQMP+VDGLLSTKMIR +L Y++PIVALTAFADDSNIK CL++GMNGFLSKPIKRPK+K
Sbjct: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120

Query: 1161 TILEEYCPNWQMKVAEDNKSK 1181
            ++L E+CP++  K    NK+K
Sbjct: 1121 SVLSEFCPDFVEK-RNSNKAK 1140

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/706 (61%), Positives = 523/706 (74%), Gaps = 34/706 (4%)

Query: 13  PPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 72
           PPFR+ IRTQ                  TTGVYFTSNYK+LRS+RLY+AAQLKSSQIDQN
Sbjct: 13  PPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSSQIDQN 72

Query: 73  LNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDSS 132
           LNYLYYQ YWLSS+ TLQ  L NYV+GNKT  NW DS  V+QKFL+S+ LFS A++YD+ 
Sbjct: 73  LNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVARVYDAD 132

Query: 133 FNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSLP 192
           F  VL ATNNGTGD++ + VL KL PL++N  L +SLE+ G+LTDPVLNG++Y+MSMSLP
Sbjct: 133 FQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLP 192

Query: 193 IFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAYHF 252
           I+ANPSIILT+S+VYGY+TI+MSA+ LK+V++D TALE+S+V IVS +Y  +  L +Y F
Sbjct: 193 IYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSYRF 252

Query: 253 VFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSFVN 312
           VFAPYG    +++ T+ I NNSFL+ ALR+GK GS ++T  FY +  AVGYSPC+F FVN
Sbjct: 253 VFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFVN 312

Query: 313 WIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELMS 372
           W+AI+SQ E+VF+ PST+L KII G VV IG FV + TFPLAHWAV+PIVRLQKATE+++
Sbjct: 313 WVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEIIT 372

Query: 373 EGRGLKSTTPGSKNVSRSSS-IKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRGXXX 431
           EGRGL+S TPGS +VSR+SS I+     +    + S+ +  G     +T G  N      
Sbjct: 373 EGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKGAVGRASTEGSFN------ 426

Query: 432 XXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIEARV 491
                              + SNA  S               S+R++K  TS+NL+EARV
Sbjct: 427 ------------YDQAVPSLNSNAEIS---------------SDRTRKYMTSSNLVEARV 459

Query: 492 PDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAKTIF 551
           P YR  FSDE S+LTDTFN MT+ALDQHYALLEDRVRARTKQLEAAK+EAE ANEAKT+F
Sbjct: 460 PVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVF 519

Query: 552 IANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVL 611
           IANISHELRTPLNGILGMTAISMEE DI KI+SSLKLIFRSG            FSKNVL
Sbjct: 520 IANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVL 579

Query: 612 KRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVM 671
           +RT LEKRDF ITDVA+QIKSIFGKVAKDQRV+ SI L PN IR M+L+GDSNRIIQIVM
Sbjct: 580 QRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVM 639

Query: 672 NLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTE 717
           NLVSNALKFTPVDGKV+VR++L+GEYD+  S   +FK V V  GTE
Sbjct: 640 NLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTE 685

 Score =  256 bits (653), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 113/155 (72%), Positives = 138/155 (89%)

Query: 1013 LGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENI 1072
            +G V++DRPFLQSTGTA+S++ +  V +  K ++ILVAEDNHVNQEVIKRML LEG++ I
Sbjct: 931  VGNVSLDRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDRI 990

Query: 1073 ELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAF 1132
            +LA DGQDAF++VKA+ E+GEH+++IFMDVQMPKVDGLL+TKMIR DL Y YPIVALTAF
Sbjct: 991  DLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAF 1050

Query: 1133 ADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYC 1167
            ADDSNI+ CLEAGMNGFLSKPIKRPK+KTI+ +YC
Sbjct: 1051 ADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
           (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/720 (59%), Positives = 518/720 (71%), Gaps = 48/720 (6%)

Query: 11  LKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
            KPP+R+ IR Q                  TTGVYFT NYK LRS RL IAA+LKSSQID
Sbjct: 9   FKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQID 68

Query: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130
           Q LNYL+YQ  +L+SRDTLQ  L NY AGNKT ENW +SE V+QKFL+S++LF  A+LYD
Sbjct: 69  QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128

Query: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190
            +F  V+ ATNNGTGDLIP  VL +L+PL+TNQ L SSL   GILTDPVLNGS Y+MSMS
Sbjct: 129 LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188

Query: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250
           LPI  NPSIIL+ S+VYGYITIVMSA+GLK V+ + TALE SNV ++S +YN++  ++ +
Sbjct: 189 LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGF 248

Query: 251 HFVFAPYGAPSYVINSTFR------IMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYS 304
           HFVF        V N  F       I N ++L++AL EGK GS+KKTK+ + + +A+GYS
Sbjct: 249 HFVFE-------VENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYS 301

Query: 305 PCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRL 364
           PC+FS  NW+A+V+Q E+VFLSPSTKL KIISGTVVAI VFV LITFPL+HWAVKPIVRL
Sbjct: 302 PCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRL 361

Query: 365 QKATELMSEGRGLKSTTPGSKNVSRSSS------IKHYVRSNIPSTASSVHNFSGDNLST 418
           QKATEL+S+GRGLK T+  S   S S+S      ++ +VR+++    S  +N S +  S 
Sbjct: 362 QKATELISQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSLRNNGSNELQSN 421

Query: 419 TTNGHLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSK 478
                +N+R                         S+ N S   N  S   D +    R  
Sbjct: 422 DDMNEINER-------------------------SSKNNSTGDNIKSSDNDSSSSFQR-- 454

Query: 479 KLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAK 538
              T++NL++ARVP Y R   DELS+LTDTFNAMT+ALDQHY LLEDRVRARTKQLEAAK
Sbjct: 455 --YTTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAK 512

Query: 539 IEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXX 598
           IEAE ANEAKT+FIANISHELRTPLNGILGMTAISMEE D  KI+ +LKLIFRSG     
Sbjct: 513 IEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLH 572

Query: 599 XXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMI 658
                  FSKNVLKRT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I+L+PN IR+M+
Sbjct: 573 ILTELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMV 632

Query: 659 LFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEF 718
           L+GDSNRIIQIVMNLVSNALKFTP+DGKV+VRIKL+GEYDE  S   ++K+V +KSGTE 
Sbjct: 633 LWGDSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL 692

 Score =  439 bits (1130), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 224/390 (57%), Positives = 278/390 (71%), Gaps = 53/390 (13%)

Query: 791  METQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGI 850
            +E  S+ ++ST SYDDA    QFKKTP+L +D++  LG+EL+ PKTWVI++EV+DTGPGI
Sbjct: 755  IEILSMTTSSTRSYDDAALQRQFKKTPDL-DDKEETLGVELSEPKTWVISVEVEDTGPGI 813

Query: 851  DPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTV 910
            +P LQ++VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM+L+S VGVGS F FTV
Sbjct: 814  EPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTV 873

Query: 911  PLMQTRELELNEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXXHNV 970
            PL QTRE+    DD  FEDEFN  S+KNRR+KF                           
Sbjct: 874  PLKQTREIHF--DDEKFEDEFNAESKKNRRIKF--------------------------- 904

Query: 971  QEEKEEDKLGDNEETKDGGKE-EDAHQERRHSHDKNNEH--------NNHLLGTVNMDRP 1021
                   K+ D+ ++ D   E E+  +  R     NNEH        +NH    V +DRP
Sbjct: 905  -------KIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNH--SKVRLDRP 955

Query: 1022 FLQSTGTATSTRTIQTV-----PDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELAR 1076
            FLQSTGTATS++ I T+      +  K  +ILVAEDNHVNQEVIKRMLNLE ++NI+LA 
Sbjct: 956  FLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLAC 1015

Query: 1077 DGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDS 1136
            DGQDAF++VK++ +  E++D+IFMDVQMPKVDGL+STKMIR DL+Y +PIVALTAFA+D 
Sbjct: 1016 DGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDD 1075

Query: 1137 NIKECLEAGMNGFLSKPIKRPKVKTILEEY 1166
            NIKECL+AGM+GFL KPIKRPK+K IL+EY
Sbjct: 1076 NIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/746 (56%), Positives = 527/746 (70%), Gaps = 40/746 (5%)

Query: 11  LKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
           LKPPF + IRTQ                   TGVYFTS++K++R++RLY+A+QLK+SQID
Sbjct: 17  LKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQID 76

Query: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130
           QNL YLYYQ Y+LS+RD LQ  LT Y+AGN T ENWAD+   + KFL S+NLFS A++YD
Sbjct: 77  QNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYD 136

Query: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190
           SSF  VL A+NN +G+L+PESVL +L+PL+TN  L SSLE  G+LTDPVLN + Y+MSMS
Sbjct: 137 SSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMS 196

Query: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250
           LPIFANPSIIL+ SKVYGYIT+V+SAEGLKTVFNDTTALE S+V +VS VY+N   L  Y
Sbjct: 197 LPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRE-LAGY 255

Query: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310
           H VF PYG PS +I+  + I N+SFL  A ++ KGGS+K T F Y+K +A+GYSPC+   
Sbjct: 256 HLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDL 315

Query: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370
           V W+AI++Q ES FL PST+LA+II GT VAI V    +TFPL+HWAV+PIVRLQKATE+
Sbjct: 316 VQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEI 375

Query: 371 MSEGRGLKSTTPGSKNVS--RSSSIKHYVRSNIPSTA--------SSVHNFSGDNLSTTT 420
           ++ GRGL+S   GS   S  RSS+ + +  +  P++         SS H +    +  + 
Sbjct: 376 ITAGRGLRSDN-GSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKY----IPESA 430

Query: 421 NGHLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTS--QRANSI---SRFTDHTDLSN 475
            G LN+                       + I N   +  Q+ +S    S F++    S 
Sbjct: 431 KGTLNKN---------------DFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQR--SA 473

Query: 476 RSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLE 535
           RS++  TS NLIEARVP Y RLFSDELS+LT+TFN MTD LD+HYALLEDRVRART+QLE
Sbjct: 474 RSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLE 533

Query: 536 AAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXX 595
           AAKIEAE ANEAKT+FIANISHELRTPLNGILGMTAI+M E D+ K++SSLKLIFRSG  
Sbjct: 534 AAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGEL 593

Query: 596 XXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIR 655
                     FSKNVLKRT LE+RDF + ++ALQ++SIFGK+AKDQ V L+I ++PN++R
Sbjct: 594 LLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLR 653

Query: 656 TMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSG 715
           TM+L+GDSNRI+QIVMNLVSNALKFTPVDG+VNV+  L+GEYDE+ +    F +  V   
Sbjct: 654 TMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPI 713

Query: 716 TEFIETKAKAILGAPKKDDPKTSTES 741
            E    K  + LG  +K   K  TES
Sbjct: 714 QE--SEKESSTLGPTEKGGIKDVTES 737

 Score =  243 bits (620), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 142/171 (83%), Gaps = 2/171 (1%)

Query: 1013 LGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENI 1072
            +G+V +DRPFLQSTGTA STR++ T      K K+LVAEDN+VNQEVIKRMLNLEG++++
Sbjct: 1006 VGSVRVDRPFLQSTGTALSTRSVTTT-SVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDV 1064

Query: 1073 ELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAF 1132
            +LA DGQDAF++VKA  E G+ +D+IFMDVQMP+VDGL +T+MIRN+L YT+PIVALTA+
Sbjct: 1065 DLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAY 1124

Query: 1133 ADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMKVAEDNKSKNE 1183
            ADD NIKEC++AGMNGFL+KPI+RPK+K IL EYCP +  K   + K K E
Sbjct: 1125 ADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTY-FKADGEKKGKTE 1174

 Score =  213 bits (542), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (81%), Gaps = 4/152 (2%)

Query: 792 ETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGID 851
           + +SI S + SSYDDA+F+++ +K     E+EDG     L +P+   IA+EVQDTGPGI+
Sbjct: 825 DARSIESENASSYDDAIFHSRLRKGNS-GENEDGR---PLEHPRRLAIAMEVQDTGPGIE 880

Query: 852 PSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVP 911
           P+LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMNG+M L S+VGVGS FTFTVP
Sbjct: 881 PALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVP 940

Query: 912 LMQTRELELNEDDHPFEDEFNPASRKNRRVKF 943
           L QT+EL   ED++PFEDEFNP S+KNR+VKF
Sbjct: 941 LTQTKELCFEEDENPFEDEFNPDSKKNRKVKF 972

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1155

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/705 (55%), Positives = 502/705 (71%), Gaps = 2/705 (0%)

Query: 13  PPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 72
           PPF +G+RTQ                  TTGVYFT+NYK++R++RL +AAQLKSSQ+DQN
Sbjct: 20  PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQN 79

Query: 73  LNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDSS 132
           LNYLYYQ YWLS+RDTLQ  L N+ AGN + +NW  +E  ++KFL S+ LFS A++YD+S
Sbjct: 80  LNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTS 139

Query: 133 FNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSLP 192
           FN V+ +TNNG+GD IPE+VL +L+PL+  +PLSSSL T GI+TDPV N + Y++SMSLP
Sbjct: 140 FNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLP 199

Query: 193 IFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAYHF 252
           +  NPSIIL  +++ GYIT++ SAE LK V NDT AL++S+V+I+S V+++ S+L  YHF
Sbjct: 200 VSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHF 259

Query: 253 VFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSFVN 312
           VF P+G  S+    TF I N +F+  A   GK GSV KT     +NIAVGYSP TF  VN
Sbjct: 260 VFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVN 319

Query: 313 WIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELMS 372
           W+A+V+Q E VFLSP+ +L KII+GTV AI VF+ L+TFP+AHWAV+PIVRLQKATE+++
Sbjct: 320 WVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIIT 379

Query: 373 EGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRGXXXX 432
            GR LK  +  + N   +++I H  R+   S  + V      +++  T  +         
Sbjct: 380 SGRDLKHYS-NTGNSDSNTAITHS-RTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNYNVF 437

Query: 433 XXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIEARVP 492
                        N  T      + ++ A + S    +   S  S++   S NL+EA VP
Sbjct: 438 PPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVEAYVP 497

Query: 493 DYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAKTIFI 552
            YRR F DELS+LTDTFN MTD LD+HYALLE+RVRARTKQLEAAKI+AE+ANEAKT+FI
Sbjct: 498 VYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAKTVFI 557

Query: 553 ANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLK 612
           ANISHELRTPLNGILGMTAI+M ETD+ K+++SLKLIFRSG            FSKNVLK
Sbjct: 558 ANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTFSKNVLK 617

Query: 613 RTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMN 672
           RT LE+RDF + D+ALQIKSIFGK+AKDQ V+LSI L PN IRT++L+GDSNRIIQIVMN
Sbjct: 618 RTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQIVMN 677

Query: 673 LVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTE 717
           LVSNALKFTPVDGKV+VRIKL+GEYD   S   ++++V V  G+E
Sbjct: 678 LVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSE 722

 Score =  407 bits (1047), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/365 (55%), Positives = 257/365 (70%), Gaps = 32/365 (8%)

Query: 804  YDDAVFNNQFKKTPELYE-DEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPF 862
            YDDA+F++QFKK     + D + N   +L  PKTWVI++EV+DTG GIDPSLQ+SVFEPF
Sbjct: 813  YDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPF 872

Query: 863  VQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNE 922
            VQGDQTLSRQYGGTGLGLSICRQLA MM GTM+L S+VGVGS F FTVPL QT+E+  + 
Sbjct: 873  VQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDG 932

Query: 923  DDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXXHNVQEEKEEDKLGDN 982
             +  FEDEFN  SRKNR+VKF                         +VQ +K +  +   
Sbjct: 933  AEKQFEDEFNIHSRKNRKVKF------------------KINSSRKSVQTKKSKSSI--- 971

Query: 983  EETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTVPDAG 1042
                      D H +   S  K +    + +G V +DRPFLQSTGTATSTR+I +V    
Sbjct: 972  ----------DGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEV 1021

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
             + ++LVAEDN+VNQEVIKRML LEG+ ++++A DGQ+A+ +V+ +++ GE + MIFMDV
Sbjct: 1022 TRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDV 1081

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
            QMP+VDGLL+TKMIRNDL Y  PIVALTA+ADDSNIK CLE+GM+GFL KPIKRP +K I
Sbjct: 1082 QMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKI 1141

Query: 1163 LEEYC 1167
            + +YC
Sbjct: 1142 IAQYC 1146

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/711 (51%), Positives = 477/711 (67%), Gaps = 37/711 (5%)

Query: 3   VNLSKWYVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAA 62
            N+S W   K P+++ +RTQ                  +TGVYFT NY++LR  +LYIAA
Sbjct: 5   CNVSIW---KAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAA 61

Query: 63  QLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNL 122
           +LKSSQIDQ +N LYYQ  WL+ RD ++  LT+Y AGN++AENWA +  V+  FL S+ +
Sbjct: 62  RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121

Query: 123 FSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNG 182
           F    LYDS FN +L  TNN T D IP+ VL  L PL+    L S L T G+LTDPVLN 
Sbjct: 122 FLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181

Query: 183 STYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYN 242
           STY+MSMSLPI ANPS+ L+DS+V+GY+T+VMSAE ++ V NDTTALE+S VA++S    
Sbjct: 182 STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241

Query: 243 NESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVG 302
           N ++   YHFVF P+GA   ++N+ + + N++FL+ A    +GGS+ K+K  Y+K +A+G
Sbjct: 242 NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301

Query: 303 YSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIV 362
           Y PC+F   NW+  VSQ E VF+S S KL KII+GTV+AI VFV +ITFPL+ W+V+PIV
Sbjct: 302 YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361

Query: 363 RLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNG 422
           RLQKATE++S+  G         + S SSS      S+   +    HN S  NL      
Sbjct: 362 RLQKATEVISKRDG------NEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYEDVEK 415

Query: 423 HLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTT 482
           +                         TE I  AN S  + S    TD++  S+ S  +  
Sbjct: 416 Y-------------------------TE-IGKANKSTESLSKENITDYS--SSNSSAIVM 447

Query: 483 SANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAE 542
             NL + +VP  RR   DELS+LT+T+  MTDALD+H  LLE RV+ RTKQLEAAKIEAE
Sbjct: 448 RKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAE 507

Query: 543 TANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXX 602
           +ANEAKT+FIAN++HELRTPLNGILGMTAI+MEETD+ +I+SSLKLI+RSG         
Sbjct: 508 SANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTE 567

Query: 603 XXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGD 662
              FSKNVLK+T LEK  FC+ D+ALQI+SIFGK++KDQ V+LSI +LPN +R+M+L+GD
Sbjct: 568 LLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGD 627

Query: 663 SNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVK 713
            NRI+Q++MNLVSNALKFTPVDGK+ V IKL+GEYD++ S   N+K V +K
Sbjct: 628 QNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK 678

 Score =  207 bits (528), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 122/150 (81%), Gaps = 1/150 (0%)

Query: 794 QSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPS 853
           +S+ S +  S ++ +++N+FK     ++D D  +G+ L   + WVI++EV+DTGPGI+PS
Sbjct: 710 KSVASDTERSTNNTIYSNKFKNGSN-FQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPS 768

Query: 854 LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLM 913
           LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLAN+M+GTM+L+SEVGVGS F FTVPL+
Sbjct: 769 LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLL 828

Query: 914 QTRELELNEDDHPFEDEFNPASRKNRRVKF 943
           QTRE+E N ++  FEDEFN  S+KNR VKF
Sbjct: 829 QTREIEFNGNELVFEDEFNINSKKNREVKF 858

 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 73/126 (57%), Positives = 100/126 (79%)

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
            K FK+L+ EDN VNQ V+ RML LEG+EN  +A DGQ+A  ++K +  +GE++ ++ MD+
Sbjct: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
            QMPKVDG+ +TK+IR +L Y  PIVALTAFADDSNI+ C ++GM+GFL+KPIKR ++K I
Sbjct: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034

Query: 1163 LEEYCP 1168
            L E+CP
Sbjct: 1035 LTEFCP 1040

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/723 (50%), Positives = 475/723 (65%), Gaps = 54/723 (7%)

Query: 13  PPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 72
           PP+ + +R Q                  +TGVYFT+NYK+LR+++L+IAAQLKSSQ+DQ+
Sbjct: 12  PPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71

Query: 73  LNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDSS 132
           LNYLYYQS W    D L   L  Y +GNKT ENW +S   +  FLTS+++FS A +YD++
Sbjct: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131

Query: 133 FNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSLP 192
           F  +   +NNGTG  IP+ ++++L PL++++ L +S+ TIG LTDPVLN S Y+MS+SLP
Sbjct: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191

Query: 193 IFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTL-NAYH 251
           IF NPSIIL+DS+VYGY+TI+  A  +  VFNDTTALE SNVAI+S  Y N +T  + YH
Sbjct: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251

Query: 252 FVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSFV 311
           FVF PYG+ + VI+  + + NNSFL  A  E   GSV  T FFY+  +AVGYS CTFS  
Sbjct: 252 FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311

Query: 312 NWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELM 371
           NW+A+VSQ ESVF S + KL KIISGTVV I   V  +TF ++++ VKPI++L++ATEL+
Sbjct: 312 NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371

Query: 372 SEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRGXXX 431
           S GRGL+   P  +N+S  +S                     DN ST T   L+      
Sbjct: 372 SRGRGLR---PYYENLSDRTS--------------------QDNTSTRTTIDLSD----- 403

Query: 432 XXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHT---------DLSNRSKKLT- 481
                         N   + +      +R+ S+S     +           S+RS  L+ 
Sbjct: 404 ---------LDGYTNEKEKSLPTCTEDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSP 454

Query: 482 TSANLI------EARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLE 535
           TS N I        RVP +    +DEL++L +TFN M D+LD+H  LLE+RV+ARTK+LE
Sbjct: 455 TSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELE 514

Query: 536 AAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXX 595
           AAKI AE  NEAKT+FIANISHELRTPLNGILGMTAI++EE D  K++ SLKLI+RSG  
Sbjct: 515 AAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGEL 574

Query: 596 XXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIR 655
                     FSKNVL++T LEK  FCI D+ALQIKSIFGK+AKDQ V  SI++ PN+IR
Sbjct: 575 LLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIR 634

Query: 656 TMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSG 715
           TM+ FGDSNRIIQ++MNLVSNALKFTP+DG V+VRIKL+GEYDE  S  +N+ KV +K G
Sbjct: 635 TMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEG 694

Query: 716 TEF 718
           T F
Sbjct: 695 TSF 697

 Score =  184 bits (467), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (84%)

Query: 827 LGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQL 886
           LG+ +  PK WVI+++V+DTGPGI P+LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 769 LGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQL 828

Query: 887 ANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKF 943
           A++M+GTMEL S  G+GS FTFTVPL+Q R++  +E +  FEDEFN  S+KNR+V F
Sbjct: 829 ASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNF 885

 Score =  164 bits (414), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 74/122 (60%), Positives = 98/122 (80%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            FK+L+ EDN VNQEVIKR+L LE ++ IE A DGQ+A + VK  + + + FD+IFMD+QM
Sbjct: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P VDG  +T++IRN+L+Y YPIVALTAFADDSN KEC  +GMN FL+KPIKR ++K I++
Sbjct: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059

Query: 1165 EY 1166
            E+
Sbjct: 1060 EF 1061

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/712 (52%), Positives = 484/712 (67%), Gaps = 21/712 (2%)

Query: 9   YVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQ 68
           ++ +PP++ G+ TQ                  TTGVYFT+NYK+LR+DRL +AAQL S+Q
Sbjct: 21  HMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSAQ 80

Query: 69  IDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQL 128
           I+Q LN +YYQ YWLSSRD++Q  L +Y  GN ++ N  ++++V+ KFL S+N      L
Sbjct: 81  INQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHL 140

Query: 129 YDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMS 188
           YDS+FN VL+ + N TG++I + +L+ L PL++N PL SS+   G+L++PV NGS++ MS
Sbjct: 141 YDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFMS 200

Query: 189 MSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLN 248
           MSLP+ A  SI+   S   GYIT+VMSA+ + +V     AL  S V++++GVY+  + LN
Sbjct: 201 MSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILN 260

Query: 249 AYHFVFAP--YGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPC 306
           +Y  +F P     P  ++   F I NNSFL  A      GSV KT  FY  N+AVGY+ C
Sbjct: 261 SYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319

Query: 307 TFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQK 366
           +F  VNW+A+V+Q E+VFLSPSTKL KII GTV+ I  F+ ++TF +A+WAVKPIVRLQK
Sbjct: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379

Query: 367 ATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQ 426
           ATEL++ GRGL+S    S++ SR++SI    RSN   + S      GD L  T       
Sbjct: 380 ATELIAAGRGLRSYRHSSRSSSRTTSIN---RSNSKGSPSPTLR-EGDGLRKTPPSPYTP 435

Query: 427 RGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANL 486
                               ++ ++        RA  I   + H   S R    TTSAN 
Sbjct: 436 -----MHSHVEPNPSGIGREYSVDI-------ARAIGIEVPSSHP--SERVDAFTTSANW 481

Query: 487 IEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANE 546
           IE RVP YRRLFSDELS+LTDTFN+MTD LD+HYALLEDRVRARTKQLEAAKI+AE+ANE
Sbjct: 482 IETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANE 541

Query: 547 AKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXXXXF 606
           AKT+FIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSG            F
Sbjct: 542 AKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTF 601

Query: 607 SKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRI 666
           SKN+LKR  LE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L+PN+IR M+L+GDSNRI
Sbjct: 602 SKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRI 661

Query: 667 IQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEF 718
           IQIVMNLVSNALKFTPVDGKV++RIKL+GEYDE  S + N  +V +K GTE 
Sbjct: 662 IQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEI 713

 Score =  224 bits (572), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 128/151 (84%)

Query: 1018 MDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARD 1077
            +DRPFLQSTGTATSTR+I TV      FK+LVAEDN+VNQEVIKRML LEG+ +IELA D
Sbjct: 951  VDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACD 1010

Query: 1078 GQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSN 1137
            G++A  +V  +  Q +H++++FMDVQMPK+DGL++T+ IR +L+YTYPIVALTAFADDSN
Sbjct: 1011 GEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSN 1070

Query: 1138 IKECLEAGMNGFLSKPIKRPKVKTILEEYCP 1168
            IK CLE+GM+GFLSKPIKR K++ IL EYCP
Sbjct: 1071 IKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101

 Score =  190 bits (483), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (80%), Gaps = 2/151 (1%)

Query: 795 SIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGI--ELTNPKTWVIAIEVQDTGPGIDP 852
           S+VS+ TSSYDDA+F+++FKK P + + ++G+L    +    K WVI+IEV+DTGPGIDP
Sbjct: 758 SVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDP 817

Query: 853 SLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPL 912
           SLQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTM+L SEVGVGS F FTVPL
Sbjct: 818 SLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPL 877

Query: 913 MQTRELELNEDDHPFEDEFNPASRKNRRVKF 943
            QT  +E  +D+  FEDEFN  S+ NRRVKF
Sbjct: 878 RQTGTVEDLDDEDLFEDEFNAQSKINRRVKF 908

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/738 (48%), Positives = 456/738 (61%), Gaps = 72/738 (9%)

Query: 10  VLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQI 69
           VLKPPF+ G+RTQ                  TTGVYFTSNY+ LR+DRL++AA+L SSQ+
Sbjct: 12  VLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQV 71

Query: 70  DQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLY 129
           DQ+L  LYYQ   LS++DT+Q  L++Y AGN++AENW ++++++  FL  +  F  A LY
Sbjct: 72  DQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLY 131

Query: 130 DSSFNAVLTATNNGTGDLIPESVLKKLYPLAT-----NQPLSSSLETIGILTDPVLNGST 184
           D  +  VL+  NN T   + E  L +L PL       N+ L   +ET+        N + 
Sbjct: 132 DEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP------YNKTL 185

Query: 185 YIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNE 244
            +MSM+LP+ A  S I+    V G++TIVMSA+ + T  NDT+ L +S V+I++G+ N++
Sbjct: 186 NLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPI-TAVNDTSVLGESMVSILTGIPNDK 242

Query: 245 STLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYT-------- 296
             L  Y FVF P      V  + + I N SFL  A        V  T  FY         
Sbjct: 243 GNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDF 302

Query: 297 KNIAVGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHW 356
           K +AVGYS C F  ++W+A+VSQDESVFLSP+ KL KII GTV+ + VF+ ++TF LA W
Sbjct: 303 KKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASW 362

Query: 357 AVKPIVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNL 416
           AVKPIVRLQKATE ++ GRGL++     ++ S+++SI    RSN                
Sbjct: 363 AVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSID---RSN---------------- 403

Query: 417 STTTNGHLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHTD---- 472
                     RG                  F TE     N +  + S S  +DH      
Sbjct: 404 ---------SRGSDHSLPRELFEKKHHVSPFVTE-----NHAANSGSCSSMSDHERYLHH 449

Query: 473 -------------LSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQH 519
                        LS+  K  T++ N I+ RVP YRRLF+DELS+LTDTFN MTD LD+ 
Sbjct: 450 IARYHDGETSTNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQ 509

Query: 520 YALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDI 579
           Y +LEDRVRARTKQLEAAKI+AE ANEAKT+FIANI HELRTPLNGILGMTAI+M E D 
Sbjct: 510 YVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQ 569

Query: 580 AKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAK 639
            KI++SLKLIFRSG            FSKNVLKRT LE+R F I D+ALQ+KSIFGK+AK
Sbjct: 570 EKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAK 629

Query: 640 DQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDE 699
           DQ V+LSI L+PN IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDGKV+VRIKL+GEYD 
Sbjct: 630 DQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDS 689

Query: 700 NLSRESNFKKVLVKSGTE 717
             S   NF +V +  GTE
Sbjct: 690 ARSEACNFSEVYILPGTE 707

 Score =  423 bits (1087), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/375 (57%), Positives = 265/375 (70%), Gaps = 34/375 (9%)

Query: 795  SIVSTSTSSYDDAVFNNQFKKTPEL--YEDEDGNLGI-ELTNPKTWVIAIEVQDTGPGID 851
            SI S+  +SYDDAV + Q KK P     ED D N+ + +L  P++WVI IEVQDTGPGI+
Sbjct: 754  SISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIE 813

Query: 852  PSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVP 911
            PSL +SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTM+L+S+VG GS FTFTVP
Sbjct: 814  PSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVP 873

Query: 912  LMQTRELELNEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXXHNVQ 971
            L QT  ++ N+ D  FEDEFN  S+KNR+VKF                         N  
Sbjct: 874  LQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQL-----------------------NRS 910

Query: 972  EEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTATS 1031
             +  + K+  N     G   E A +    S  + +       G+V +DRPFLQSTGTATS
Sbjct: 911  GKSRKGKM--NNSNGAGSIAESAIESFGKSESEAS------FGSVRVDRPFLQSTGTATS 962

Query: 1032 TRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQ 1091
            TR++ T+  A    +ILVAEDN+VNQEVIKRML+LEG  NI+LA DG+DA+ +V A+VEQ
Sbjct: 963  TRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQ 1022

Query: 1092 GEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLS 1151
            GEH+D+IFMDVQMP++DGLL+TK++R  LHY YPIVALTAFADDSNIKECLE+GMN FL+
Sbjct: 1023 GEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLA 1082

Query: 1152 KPIKRPKVKTILEEY 1166
            KPIKRP +K IL E+
Sbjct: 1083 KPIKRPMLKKILLEH 1097

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/737 (44%), Positives = 454/737 (61%), Gaps = 33/737 (4%)

Query: 1   MKVNLSKWYVLKPPFRLGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 60
           +K+ ++K  V KPP+R  +R Q                   TGVYFT++YK+L  +RLYI
Sbjct: 8   IKLKMNKQTV-KPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYI 66

Query: 61  AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120
           A+QLKSSQIDQ LNYLYYQ YW++SR+T+Q  + +   G   A    +S+ V+ KF+ ++
Sbjct: 67  ASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTS 126

Query: 121 NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLA-TNQPLSSSLETIGILTDPV 179
           +LF    +YD +  +++ +TNN +G  +  S+L +L PL+ TN  +   +   GILTDP+
Sbjct: 127 DLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPI 186

Query: 180 LNGSTYIMSMSLPI---FANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAI 236
           LN + Y+MSMSLPI   ++  + I   S +YGY+T+VMSAE LK+VFNDT  L  S  A+
Sbjct: 187 LNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTAL 246

Query: 237 VSGVYNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYT 296
           +S +Y N++    +HFVF P+     +I+    I N +F   A  + K GS KK K    
Sbjct: 247 LSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNK 306

Query: 297 KNIAVGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHW 356
           KN A+GY+P  F    W+A+V+  +  F S S KL KII GTVV I VFVFLI+ PL++W
Sbjct: 307 KNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYW 366

Query: 357 AVKPIVRLQKATELMSEGRGLKSTTPGSKNV-----SRSSSIKHYVRSNIPSTASSVHNF 411
           AV+PIVRLQ+A+EL+++ RGL++    S +      +  S+  H   S + S+  ++ N 
Sbjct: 367 AVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDHTYDSNDDHTYESKLISSTPTLKN- 425

Query: 412 SGDNLSTTTNGHLNQRGXXXXXXXXXXXXXXXXXNFATEMISNANTSQRANSISRFTDHT 471
           S  N+    +G    RG                         + N  +R  S+S    H 
Sbjct: 426 SDSNIHDEKSGR--TRGDANSGTLNSNNTIT-----NNTNNKDFNRLRRNVSVST---HV 475

Query: 472 DLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRART 531
            LS             E +VP YR+LF DEL++LTDTFN M++ALD+HYALLE RV  RT
Sbjct: 476 SLSE----------FDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRT 525

Query: 532 KQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFR 591
           KQLEAAK++AE ANEAKT+FIANISHELRTPLNGILGMT+ S+EE DI KI+  LKLIFR
Sbjct: 526 KQLEAAKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFR 585

Query: 592 SGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLP 651
           SG            FSKNVL +T LE R+F I ++  QIK+IF K+ + Q V+L I LLP
Sbjct: 586 SGELLLNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLP 645

Query: 652 -NIIRTMILFGDSNRIIQIVMNLVSNALKFTP-VDGKVNVRIKLMGEYDENLSRESNFKK 709
              +++++ +GDSNRI+Q++MNL+SNA+KFTP V+GKV V + L+GEYDE  S+  N+ K
Sbjct: 646 KKFLKSLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSK 705

Query: 710 VLVKSGTEFIETKAKAI 726
           V +K  T+ +    + I
Sbjct: 706 VCIKPSTQIVTESGELI 722

 Score =  265 bits (678), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 209/368 (56%), Gaps = 34/368 (9%)

Query: 804  YDDAVFNNQFKKTPELYEDEDGNLGI-----ELTNPKTWVIAIEVQDTGPGIDPSLQKSV 858
            YD+ +FN   K+      + DG++       ++   K WVI  EV D GPGID +L  SV
Sbjct: 798  YDNLMFNRLIKR------EGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSV 851

Query: 859  FEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTREL 918
            F+PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT+EL+SE+G GS F +T+PL+Q    
Sbjct: 852  FKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQVGGT 911

Query: 919  ELNEDDHPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXXHNVQEEKEEDK 978
            + + DD+  E++ N  +  N  V                           N         
Sbjct: 912  KKDNDDN--EEDHNDNT--NSSVDIDIIEDTPVSITSSSQTHSDLNSLQSN--------- 958

Query: 979  LGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTV 1038
               NE   D    E  +     S DK+      +L    MD   +++          + +
Sbjct: 959  -STNEVGLDDSFSEAENDSTVASLDKS------VLQKTRMDAQKVEANEIDDIDHCNKGI 1011

Query: 1039 PDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMI 1098
            P    K K+LVAEDN VNQEVIKRML LE + +IELA DG +AF +VK  +   + +D+I
Sbjct: 1012 P---SKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDII 1068

Query: 1099 FMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPK 1158
            FMD+QMPK+DGL ST  IR +L Y   IVALTAFAD+SNIKEC +AGM+GF+ KPIKR  
Sbjct: 1069 FMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVA 1128

Query: 1159 VKTILEEY 1166
            + T+LEE+
Sbjct: 1129 LHTLLEEF 1136

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  384 bits (985), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/425 (49%), Positives = 265/425 (62%), Gaps = 58/425 (13%)

Query: 804  YDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFV 863
            YD+ VFN+QFKK   L + ++  LG+E+  PKTWVI IEV+DTGPGI P+LQ+SVFEPFV
Sbjct: 782  YDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFV 841

Query: 864  QGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNED 923
            QGDQ LSRQYGGTGLGLSICRQLA MMNGTM L+S+VG GS FTFTVPL QTRE+ + ED
Sbjct: 842  QGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGED 901

Query: 924  D---HPFEDEFNPASRKNRRVKFXXXXXXXXXXXXXXXXXXXXXXXXHNVQEEKEEDKLG 980
            +     F+DEFN  S+KNR+VKF                         N     E   + 
Sbjct: 902  EDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRKSKGSL-NSSFVGEIQNVN 960

Query: 981  DNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTVP- 1039
            + EE     K+ ++  E +  H   +  NN+ + +  +DRPFLQSTGTATST  I  +  
Sbjct: 961  EAEEDAYNSKDINSSGELKIRHISTSTSNNNSIPS--LDRPFLQSTGTATSTMKIPVLKD 1018

Query: 1040 ------------DAGKK----------------------------------FKILVAEDN 1053
                        D GK                                    +ILV EDN
Sbjct: 1019 FSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDN 1078

Query: 1054 HVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMV-----EQGEHFDMIFMDVQMPKVD 1108
            HVNQEVIKRML LE + NI+LA DG++A+ +VK +      ++  ++D+IFMDVQMP++D
Sbjct: 1079 HVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMD 1138

Query: 1109 GLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCP 1168
            GL STK+IR++L YT PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPK+K IL E+CP
Sbjct: 1139 GLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCP 1198

Query: 1169 NWQMK 1173
             + ++
Sbjct: 1199 GYHLQ 1203

 Score =  339 bits (869), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 179/243 (73%), Positives = 208/243 (85%)

Query: 484 ANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAET 543
           + ++E +VP YRRLF DELS+LTDTFN M+DALDQHYALLE+RVRARTKQLEAAKIEAE 
Sbjct: 472 STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 544 ANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGXXXXXXXXXX 603
           ANEAKT+FIANISHELRTPLNGILGMTAISMEE DI  I+SSLKLIFRSG          
Sbjct: 532 ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 604 XXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDS 663
             FSKNVL+RT LE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L+PN IRT++L+GDS
Sbjct: 592 LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 664 NRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKA 723
           NRIIQIVMNLVSNALKFTP+DGKV+VR+ L+GEYD+  S+ +++K+V VK+GTE  E  +
Sbjct: 652 NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 724 KAI 726
           K +
Sbjct: 712 KIL 714

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
            K F +L+ ED+ V  ++  + L   G   + +  DG  A +     V +   FD++ MD+
Sbjct: 414  KGFHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAIS-----VLENHRFDLVLMDI 467

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
             MP +DG  +T ++RN  +YT PI+A+T   +D ++   L+ GMN  L+KP  +  + ++
Sbjct: 468  VMPNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSM 526

Query: 1163 LEEY 1166
            L  Y
Sbjct: 527  LVRY 530

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 75/136 (55%), Gaps = 8/136 (5%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ V  ++  + L   G  ++E+  DG  A   V+        +D++ MD+ M
Sbjct: 329  FCVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVM 382

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P +DG  +T +IR+  + T PI+A+T   +D ++   L+ GMN  L+KP  +  + ++L 
Sbjct: 383  PNLDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1165 EYCPNWQMKVAEDNKS 1180
             Y  + ++ +AE N S
Sbjct: 442  RYLKD-RVPLAEQNSS 456

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
            K F +L+ ED+ ++ ++  + L   G   +++  DG  A   +     +   +D++ MD+
Sbjct: 401  KGFHVLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAITTL-----ENSRYDLVLMDI 454

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
             MP +DG  +T +IR+  + T PI+A+T   DD ++   L+ GMN  L+KP  R  + ++
Sbjct: 455  VMPNLDGATATSIIRSFDNQT-PIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSM 513

Query: 1163 LEEY 1166
            L  Y
Sbjct: 514  LIRY 517

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 69/122 (56%), Gaps = 7/122 (5%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ V  ++  + L   G  ++E+  DG  A + +     + + FD++ MD+ M
Sbjct: 329  FHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAISTL-----EKQRFDLVLMDIVM 382

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P +DG  +T ++R+  + T PI+A+T   DD ++   L+ GMN  L+KP  +  + ++L 
Sbjct: 383  PNLDGATATSIVRSFDNET-PIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1165 EY 1166
             Y
Sbjct: 442  RY 443

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 69/124 (55%), Gaps = 7/124 (5%)

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
            K F +L+ ED+ ++ ++  + L   G   +E+  DG  A + ++        +D++ MD+
Sbjct: 351  KGFHVLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDI 404

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
             MP +DG  +T +IR+  + T PI+A+T   +D ++   L+ GMN  L+KP  R  + ++
Sbjct: 405  VMPNLDGATATSIIRSFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSM 463

Query: 1163 LEEY 1166
            L  Y
Sbjct: 464  LIRY 467

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
            K F +L+ ED+ V+ ++  + L   G   +++  DG  A + ++        FD++ MD+
Sbjct: 380  KGFHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAISILEKF-----RFDLVLMDI 433

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
             MP +DG  +T +IRN  + T PI+A+T   +  ++   L+ GMN  L+KP  R  + +I
Sbjct: 434  VMPNLDGATATSIIRNFDNRT-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSI 492

Query: 1163 LEEY 1166
            L  Y
Sbjct: 493  LIRY 496

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ V  ++  + L   G  ++E+  DG  A   V+        +D++ MD+ M
Sbjct: 318  FHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVM 371

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P +DG  +T +IR+  + T PI+A+T   +D ++   L+ GMN  L+KP  +  + ++L 
Sbjct: 372  PNLDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLV 430

Query: 1165 EY 1166
             Y
Sbjct: 431  RY 432

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 7/127 (5%)

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
            K F +L+ ED+ V+ ++  + L   G   +++  DG  A + ++        FD++ MD+
Sbjct: 348  KGFNVLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKY-----RFDLVLMDI 401

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
             MP +DG  +T +IRN  + T PI+A+T   +  ++   L+ GMN  L+KP  R  + ++
Sbjct: 402  VMPNLDGATATSIIRNFDNET-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSM 460

Query: 1163 LEEYCPN 1169
            L  Y  N
Sbjct: 461  LTRYLKN 467

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 77/139 (55%), Gaps = 7/139 (5%)

Query: 1025 STGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNE 1084
            S+ ++++T+ +       K F +L+ ED+ V+ ++  + L   G   +++  DG  A + 
Sbjct: 385  SSNSSSTTKEVDQNIVLRKGFHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISN 443

Query: 1085 VKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEA 1144
            ++        +D++ MD+ MP +DG  +T ++R+  + T PI+A+T   +D ++   L+ 
Sbjct: 444  LEKF-----RYDLVLMDIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLITYLQH 497

Query: 1145 GMNGFLSKPIKRPKVKTIL 1163
            GMN  L+KP  R  + +IL
Sbjct: 498  GMNDILAKPFTRNDLHSIL 516

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ V+  +  + L   G   +E+  DG  A + ++        +D++ MD+ M
Sbjct: 381  FHVLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVM 434

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P +DG  +T +IRN  + T PI+A+T   +D ++   L+ GMN  L+KP  +  + ++L 
Sbjct: 435  PNLDGATATSIIRNFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1165 EY 1166
             Y
Sbjct: 494  RY 495

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 68/123 (55%), Gaps = 9/123 (7%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ V  ++  + L   G   +E+  DG  A + ++        +D++ MD+ M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKF-----RYDLVLMDIVM 429

Query: 1105 PKVDGLLSTKMIRN-DLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTIL 1163
            P +DG  +T ++R+ D+H   PI+A+T   +D ++   L+ GMN  L+KP  +  + ++L
Sbjct: 430  PNLDGATATSIVRSFDIHT--PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSML 487

Query: 1164 EEY 1166
              Y
Sbjct: 488  IRY 490

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 68/122 (55%), Gaps = 7/122 (5%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ V  ++  + L   G   +E+  DG  A + ++        +D++ MD+ M
Sbjct: 334  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVM 387

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P +DG  +T ++R+  ++T PI+A+T   +D ++   L+ GMN  L+KP  +  + ++L 
Sbjct: 388  PNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 446

Query: 1165 EY 1166
             Y
Sbjct: 447  RY 448

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 66/121 (54%), Gaps = 7/121 (5%)

Query: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102
            K + +L+ ED+ V+ ++  + L   G   +E+  DG  A + ++A       +D++ MD+
Sbjct: 422  KGYHVLLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAF-----RYDLVLMDI 475

Query: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162
             MP +DG  +T +IRN      PI+A+T   +D ++   L+ GM   L+KP  R  + ++
Sbjct: 476  VMPNLDGATATSIIRN-FDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSM 534

Query: 1163 L 1163
            L
Sbjct: 535  L 535

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 75/147 (51%), Gaps = 7/147 (4%)

Query: 1023 LQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAF 1082
            + S   +T+   I   P     F +L+ ED+ +  ++  + L   G   +E+  DG  A 
Sbjct: 283  MDSNPASTTPNMILDHPILRPGFHVLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAI 341

Query: 1083 NEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECL 1142
            + ++        +D++ MD+ MP +DG  +T ++R+  + T PI+A+T   +D ++   L
Sbjct: 342  STLEKF-----RYDLVLMDIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYL 395

Query: 1143 EAGMNGFLSKPIKRPKVKTILEEYCPN 1169
            + GMN  L+KP  +  + ++L  Y  N
Sbjct: 396  QHGMNDILAKPFTKDDLHSMLIRYLRN 422

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 68/122 (55%), Gaps = 7/122 (5%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ V  ++  + L   G  ++E+  DG  A + ++        +D++ MD+ M
Sbjct: 307  FHVLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKF-----RYDLVLMDIVM 360

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P +DG  +T ++R+  + T PI+A+T   +D ++   LE GMN  L+KP  +  + ++L 
Sbjct: 361  PNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLI 419

Query: 1165 EY 1166
             Y
Sbjct: 420  RY 421

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 84/166 (50%), Gaps = 9/166 (5%)

Query: 1002 HDKNNEHN-NHLLGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVI 1060
            H  NN +N +    TV++  P L    + T      TV    K F +L+ ED+ V+ ++ 
Sbjct: 336  HSNNNTNNASPAASTVSLQLPNLPDENSLTPNAQGTTV-TLRKGFHVLLVEDDAVSIQLC 394

Query: 1061 KRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDL 1120
             + L   G   +++  DG  A + ++        +D++ MD+ MP +DG  +T ++R+  
Sbjct: 395  SKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVRSFD 448

Query: 1121 HYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEY 1166
            + T PI+A+T    + ++   L+ GMN  L+KP  R  + +IL  Y
Sbjct: 449  NET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 83/167 (49%), Gaps = 10/167 (5%)

Query: 1002 HDKNNEHNNH--LLGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEV 1059
            H  +N  NN      TV++  P L    + T      TV    K F +L+ ED+ V+ ++
Sbjct: 335  HGNSNHTNNASPATSTVSLQLPSLPDENSLTPNAQANTV-TLRKGFHVLLVEDDVVSIQL 393

Query: 1060 IKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRND 1119
              + L   G   +++  DG  A + ++        +D++ MD+ MP +DG  +T ++R+ 
Sbjct: 394  CSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVRSF 447

Query: 1120 LHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEY 1166
             + T PI+A+T    + ++   L+ GMN  L+KP  R  + +IL  Y
Sbjct: 448  DNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104
            F +L+ ED+ +  ++  + L ++    +E+  DG  A + ++        FD++ MD+ M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVM 355

Query: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164
            P +DG  +T ++R+  + T PI+A+T   +D ++   L+ GMN  L+KP  +  + ++L 
Sbjct: 356  PNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1165 EYCPN 1169
             Y  N
Sbjct: 415  RYLRN 419

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 78/152 (51%), Gaps = 8/152 (5%)

Query: 1015 TVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIEL 1074
            TV++  P L    + T      TV    K F +L+ ED+ V+ ++  + L   G   +++
Sbjct: 348  TVSLQLPNLPDQNSLTPNAQNNTV-TLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQV 405

Query: 1075 ARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFAD 1134
              DG  A + ++        +D++ MD+ MP +DG  +T ++R+  + T PI+A+T    
Sbjct: 406  VSDGLSAISTLEKY-----RYDLVLMDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIM 459

Query: 1135 DSNIKECLEAGMNGFLSKPIKRPKVKTILEEY 1166
            + ++   L+ GMN  L+KP  R  + +IL  Y
Sbjct: 460  NQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 82/165 (49%), Gaps = 8/165 (4%)

Query: 1002 HDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIK 1061
            H+ N  + +    TV++  P L    + T       V    K F +L+ ED+ V+ ++  
Sbjct: 336  HNNNGNNASPTTSTVSLQMPNLPDENSLTPNAQGNAV-TLRKGFHVLLVEDDAVSIQLCS 394

Query: 1062 RMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLH 1121
            + L   G   +++  DG  A + ++        +D++ MD+ MP +DG  +T ++R+  +
Sbjct: 395  KFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVRSFDN 448

Query: 1122 YTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEY 1166
             T PI+A+T    + ++   L+ GMN  L+KP  R  + +IL  Y
Sbjct: 449  ET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 70/139 (50%), Gaps = 34/139 (24%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + E+A++G +A   V+   + G H  +I MD+Q
Sbjct: 548  KINVLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEA---VEKWRQGGIH--LILMDLQ 601

Query: 1104 MPKVDGLLSTKMIR--------NDLH------------------YTYP--IVALTAFADD 1135
            +P + GL +TK IR        N  H                  +  P  IVALTAF+  
Sbjct: 602  LPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSH 661

Query: 1136 SNIKECLEAGMNGFLSKPI 1154
            ++ +E L AG N +L+KP+
Sbjct: 662  ADRREALVAGCNDYLTKPV 680

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 33/138 (23%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + +LA++GQ+A N  K   E G H  +IFMD+Q
Sbjct: 502  KINVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQ 555

Query: 1104 MPKVDGLLSTKMIR--------------NDLHYTYP-------------IVALTAFADDS 1136
            +P + G+ + K IR              N+ HY +              IVALTA     
Sbjct: 556  LPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQM 615

Query: 1137 NIKECLEAGMNGFLSKPI 1154
            + ++ L +G N +L+KP+
Sbjct: 616  DKRKALLSGCNDYLTKPV 633

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 70/138 (50%), Gaps = 33/138 (23%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + +LA++GQ+A N  K   E G H  +IFMD+Q
Sbjct: 485  KINVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQ 538

Query: 1104 MPKVDGLLSTKMIRN-----------DLHYTYP----------------IVALTAFADDS 1136
            +P + G+ + K IR+            L+ +YP                IVALTA     
Sbjct: 539  LPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQM 598

Query: 1137 NIKECLEAGMNGFLSKPI 1154
            + ++ L +G N +L+KP+
Sbjct: 599  DKRKALVSGCNDYLTKPV 616

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 58.5 bits (140), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 26/131 (19%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ +++  L    + + ++A++GQ+A +  K   E G   D+IFMD+Q
Sbjct: 500  KITVLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWK---EGG--IDLIFMDLQ 553

Query: 1104 MPKVDGLLSTKMIR-----NDLHYTYP---------------IVALTAFADDSNIKECLE 1143
            +P   G+ + K IR     N    T P               IVA TA    ++ +E L 
Sbjct: 554  LPVFSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALL 613

Query: 1144 AGMNGFLSKPI 1154
            +G N +L+KP+
Sbjct: 614  SGCNDYLTKPV 624

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 76/159 (47%), Gaps = 30/159 (18%)

Query: 1019 DRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDG 1078
            D PFL+S     +T +I T      K  +LV EDN +NQ ++   L    + + ++A++G
Sbjct: 394  DSPFLRSAMETFTTESI-TRDKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVAKNG 451

Query: 1079 QDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIR-----NDLHYTYP-------- 1125
             +A +  K   E G H  +I MD++MP + G+ + K IR     N +    P        
Sbjct: 452  IEAVDRWK---EGGMH--LILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPA 506

Query: 1126 ----------IVALTAFADDSNIKECLEAGMNGFLSKPI 1154
                      IVALTA    S+  E L AG N +L+KP+
Sbjct: 507  KRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPV 545

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 64/117 (54%), Gaps = 13/117 (11%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + ++A++G++A   V+     G H  +IFMD+Q
Sbjct: 474  KINVLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEA---VEMWKNGGLH--LIFMDLQ 527

Query: 1104 MPKVDGLLSTKMIRNDLHYTYP------IVALTAFADDSNIKECLEAGMNGFLSKPI 1154
            +P + G+ + K IR D     P      IVALTA     + +  L +G N +L+KP+
Sbjct: 528  LPVLSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPV 583

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 68/138 (49%), Gaps = 33/138 (23%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + +LA++GQ+A N  K   E G H  +IFMD+Q
Sbjct: 492  KINVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQ 545

Query: 1104 MPKVDGLLSTKMIR--------------NDLHYTYP-------------IVALTAFADDS 1136
            +P + G+ + K IR              N+ H  +              IVALTA     
Sbjct: 546  LPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQM 605

Query: 1137 NIKECLEAGMNGFLSKPI 1154
            + ++ L +G N +L+KP+
Sbjct: 606  DKRKALLSGCNDYLTKPV 623

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 34/139 (24%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + E+A++G +A   V+   + G H  +I MD+Q
Sbjct: 508  KINVLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEA---VEKWRKGGIH--LILMDLQ 561

Query: 1104 MPKVDGLLSTKMIR--------------------------NDLHYTYP--IVALTAFADD 1135
            +P + G+ + K IR                          N   +  P  IVALTAF+  
Sbjct: 562  LPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSH 621

Query: 1136 SNIKECLEAGMNGFLSKPI 1154
            ++  E L AG N +L+KP+
Sbjct: 622  ADRNEALVAGCNDYLTKPV 640

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 72/137 (52%), Gaps = 23/137 (16%)

Query: 1035 IQTVPDAG----------KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNE 1084
            ++T+P+ G           K  +L+ EDN +NQ ++   L    + + ++A++G++A   
Sbjct: 497  LKTIPNNGTNTSTSANVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEA--- 552

Query: 1085 VKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRN-------DLHYTYPIVALTAFADDSN 1137
            V    E G H  +IFMD+Q+P + G+ + K IR+         +    IVALTA     +
Sbjct: 553  VDIWKEGGLH--LIFMDLQLPVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIED 610

Query: 1138 IKECLEAGMNGFLSKPI 1154
             ++ L +G N +L+KP+
Sbjct: 611  KRKALISGCNDYLTKPV 627

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 33/138 (23%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + +LA++GQ+A N  K   E G H  +IFMD+Q
Sbjct: 503  KINVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK---EGGLH--LIFMDLQ 556

Query: 1104 MPKVDGLLSTKMIR--------------NDLHYTYP-------------IVALTAFADDS 1136
            +P + G+ + K IR              N+ H                 IVALTA     
Sbjct: 557  LPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQM 616

Query: 1137 NIKECLEAGMNGFLSKPI 1154
            + ++ L +G N +L+KP+
Sbjct: 617  DKRKALLSGCNDYLTKPV 634

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 29/156 (18%)

Query: 1021 PFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQD 1080
            PF+ S   + +T +I T      K  +LV EDN +NQ ++   L    + + ++A++G +
Sbjct: 383  PFILSAMESVTTESI-TRDKVFPKISVLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVE 440

Query: 1081 AFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIR-----NDLHYTYP---------- 1125
            A +  K   E G H  +I MD++MP + G+ + K IR     N +    P          
Sbjct: 441  AVDRWK---EGGMH--LILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGL 495

Query: 1126 -------IVALTAFADDSNIKECLEAGMNGFLSKPI 1154
                   IVALTA    ++  E L AG N +L+KP+
Sbjct: 496  TCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPV 531

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 32/137 (23%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    +   ++A++GQ+A   +    E G H  +IFMD+Q
Sbjct: 564  KINVLIVEDNVINQTILSSFLRKHKI-FYKVAKNGQEA---IDVWREGGIH--LIFMDLQ 617

Query: 1104 MPKVDGLLSTKMIR--------------------------NDLHYTYPIVALTAFADDSN 1137
            +P + G+ + K IR                          + ++    IVA TA    S+
Sbjct: 618  LPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSD 677

Query: 1138 IKECLEAGMNGFLSKPI 1154
             KE L +G N +L+KP+
Sbjct: 678  KKEALISGCNDYLTKPV 694

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 25/130 (19%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + ++A++G++A   V    E G H  +IFMD+Q
Sbjct: 544  KINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEA---VDIWKEGGLH--LIFMDLQ 597

Query: 1104 MPKVDGLLSTKMIR-------------------NDLHYTYPIVALTAFADDSNIKECLEA 1144
            +P + G+ + + IR                   N       IVALTA     + +  L +
Sbjct: 598  LPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALIS 657

Query: 1145 GMNGFLSKPI 1154
            G N +L+KP+
Sbjct: 658  GCNDYLTKPV 667

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 36/141 (25%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + ++A++G++A ++ K   E G H  +IFMD+Q
Sbjct: 510  KINVLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWK---EGGLH--LIFMDLQ 563

Query: 1104 MPKVDGLLSTKMIR------------------------------NDLHYTYPIVALTAFA 1133
            +P + G+ + K IR                              N       IVA TA  
Sbjct: 564  LPVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASN 623

Query: 1134 DDSNIKECLEAGMNGFLSKPI 1154
              ++ +E L +G N +L+KP+
Sbjct: 624  SLTDKREALISGCNDYLTKPV 644

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 33/138 (23%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + ++A++G++A ++ K    +G +  +IFMD+Q
Sbjct: 462  KINVLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWK----EG-NLHLIFMDLQ 515

Query: 1104 MPKVDGLLSTKMIR----------NDLHYTYP-----------------IVALTAFADDS 1136
            +P + G+ + K IR               + P                 IVALTA     
Sbjct: 516  LPVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQE 575

Query: 1137 NIKECLEAGMNGFLSKPI 1154
            + +E L +G N +L+KP+
Sbjct: 576  DKREALISGCNDYLTKPV 593

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 29/134 (21%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + ++A++G++A   V    E G H  +IFMD+Q
Sbjct: 669  KINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEA---VDIWKEGGLH--LIFMDLQ 722

Query: 1104 MPKVDGLLSTKMIR------------NDL-HYTYP----------IVALTAFADDSNIKE 1140
            +P + G+ + + IR            N+L     P          IVALTA     + ++
Sbjct: 723  LPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRK 782

Query: 1141 CLEAGMNGFLSKPI 1154
             L +G N +L+KP+
Sbjct: 783  ALLSGCNDYLTKPV 796

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            +  +L+ EDN +NQ ++   L   G+ + ++A+DG +A  + K   E   H  +I MD+Q
Sbjct: 393  RINVLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKWK---EGDSH--LILMDLQ 446

Query: 1104 MPKVDGLLSTKMIR 1117
            +P + GL +TK IR
Sbjct: 447  LPLLSGLEATKKIR 460

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 34/136 (25%)

Query: 1047 ILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPK 1106
            +L+ EDN +NQ ++   L    + +  +A++G++A   V+   E G H  +IFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKI-SYRIAKNGREA---VEKWKEGGIH--LIFMDLQLPV 526

Query: 1107 VDGLLSTKMIRND----------------------------LHYTYPIVALTAFADDSNI 1138
            + G+ + K IR                              L     +VA TA    ++ 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1139 KECLEAGMNGFLSKPI 1154
            +E L +G N +L+KP+
Sbjct: 587  REALVSGCNDYLTKPV 602

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 40/185 (21%)

Query: 1000 HSHDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEV 1059
            H   + ++ N++++GT +     L+ST      +   T  +   +  IL+ EDN +NQ +
Sbjct: 524  HKGLQTSQTNSNIVGTTDE----LKSTTNPVKPKMRSTSENIFPRINILIVEDNVINQTI 579

Query: 1060 IKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIR-- 1117
            +   L    +   ++A++G++A ++ K   E G H  +IFMD+Q+P + G  + K IR  
Sbjct: 580  LGSFLRKNKIF-YKVAKNGREAVDKWK---EGGIH--LIFMDLQLPVLSGTDAAKEIRQY 633

Query: 1118 ----------------------------NDLHYTYPIVALTAFADDSNIKECLEAGMNGF 1149
                                        +       IVA TA    ++ +  L AG N +
Sbjct: 634  EKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNSLADKRAALIAGCNDY 693

Query: 1150 LSKPI 1154
            L+KP+
Sbjct: 694  LTKPV 698

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  +L+ EDN +NQ ++   L    + + ++A++G++A ++ K   + G H  +I +D+Q
Sbjct: 461  KINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWK---QGGIH--LILLDLQ 514

Query: 1104 MPKVDGLLSTKMIRN 1118
            +P + G+ +TK IRN
Sbjct: 515  LPILSGIEATKEIRN 529

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 66/140 (47%), Gaps = 13/140 (9%)

Query: 1031 STRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVE 1090
            S R    V D G +  ILV E   +++  + R L   G   + +      A +E+ +   
Sbjct: 1528 SGRKSSGVNDVGYRMDILVCEPIPIHRYRVTRDLESVGCTVVSVG-----AGDELVSRAN 1582

Query: 1091 QGEHFDMIFMDVQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEAGM-N 1147
             G  FD+I   +++PK+  +   K+I+  N ++   PI+A+T F       E + A + +
Sbjct: 1583 SGVKFDLIVTALKLPKLGAIDIVKLIKHTNGINSRTPIIAITNF-----YHEAISAKVFD 1637

Query: 1148 GFLSKPIKRPKVKTILEEYC 1167
              L KPI   +++ ++ +Y 
Sbjct: 1638 DVLEKPIMLDEIRHLVAKYA 1657

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 839 IAIEVQDTGPGIDPSLQKSVFEPFV-----------QGDQTLSRQ----YGGTGLGLSIC 883
           + I ++D G GIDP ++  VF+                D  L  Q      G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 884 RQLANMMNGTMELKSEVGVGS 904
           +    + NGT++++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 6/110 (5%)

Query: 1060 IKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIR-- 1117
            I R    E +E+I  +        E+      G  FD+I   +++PK+  +   K+IR  
Sbjct: 1449 IHRYRVAEDLESIGCSVVSAGNGEELVRRATTGVKFDLIITAMKLPKLGAIDIAKLIRHT 1508

Query: 1118 NDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYC 1167
            N ++ T PIVALT +  D+   +  +      L KP+   +++ ++ +Y 
Sbjct: 1509 NSVNCTTPIVALTVYYHDAKESKVFD----DVLEKPVSVEQLRKLVSKYA 1554

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 55/110 (50%), Gaps = 6/110 (5%)

Query: 1060 IKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIR-- 1117
            I R   ++ +E++  +  G  A +E+      G  FD+I   +++PK+  +   K++R  
Sbjct: 1450 IHRYRLVKDLESLGCSVVGVGAGDELVRRATAGVKFDLIITALKLPKLGAVDIAKLLRHT 1509

Query: 1118 NDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYC 1167
            N  +   PIVA+TA+  ++   +  +      L KP+   +++ ++ +Y 
Sbjct: 1510 NSANCNTPIVAVTAYYGEAESTQVFD----DVLEKPVGIEQIRCLIAKYA 1555

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 839 IAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 883
           + I ++D G GI P ++  +F+       T ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 884 RQLANMMNGTMELKSEVGVGS 904
           +    M NGT++++S  G G+
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGT 399

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 15/81 (18%)

Query: 839 IAIEVQDTGPGIDPSLQKSVFE-------------PFVQGDQTLSR--QYGGTGLGLSIC 883
           ++I V+D G GI P  +  + +             P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 884 RQLANMMNGTMELKSEVGVGS 904
           R  A +  G++ ++S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 839 IAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 883
           + I ++D G GI P ++  +FE      Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 884 RQLANMMNGTMELKSEVGVGS 904
           +    M +G+++++S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>CAGL0L00869g Chr12 complement(107233..108492) [1260 bp, 419 aa]
           {ON} similar to uniprot|P40530 Saccharomyces cerevisiae
           YIL042c
          Length = 419

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 15/81 (18%)

Query: 839 IAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 883
           + I ++D G GI P+++  +FE      ++  ++ G               G G GL +C
Sbjct: 319 LEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMC 378

Query: 884 RQLANMMNGTMELKSEVGVGS 904
           +    M +G ++++S  G G+
Sbjct: 379 KAYIEMFDGKLDIQSLWGWGT 399

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 1060 IKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIR-- 1117
            I R     G+E++        A +E+      G  FD+I   +++PK+  +   K+++  
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1118 NDLHYTYPIVALTAF---ADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYC 1167
            N ++ T PIVA T +   A ++N+        +  L KPI    ++ ++ +Y 
Sbjct: 1454 NGINSTTPIVAATCYFEEASNTNV-------FSDVLEKPISIQTLRKLISKYA 1499

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 60/128 (46%), Gaps = 11/128 (8%)

Query: 1042 GKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMD 1101
            G    +LV E   +++  + + L   G   + +      A +E+ +    G  FD+I   
Sbjct: 1632 GYHMDVLVCEPIPIHRYRVTKDLENLGCTVVSVG-----AGDELVSRATSGVSFDLIMTA 1686

Query: 1102 VQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKV 1159
            +++PK+  +   ++++  N  + T PIVA+T +  ++      +      L KP+K  ++
Sbjct: 1687 LKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAATSRVFD----DVLEKPVKLDEL 1742

Query: 1160 KTILEEYC 1167
            K ++ +Y 
Sbjct: 1743 KKLVAKYA 1750

>Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON}
           YIL042C (REAL)
          Length = 393

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 45/109 (41%), Gaps = 13/109 (11%)

Query: 808 VFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVF-------- 859
           VF N F+     +  E   + I L  P    + I ++D G GI P ++  +F        
Sbjct: 268 VFKNAFEAQIA-HGQEHVPIEINLLKPDDDELYIRIRDHGGGITPEVEALMFDYSYSTHS 326

Query: 860 -EPFVQGDQTLSRQ---YGGTGLGLSICRQLANMMNGTMELKSEVGVGS 904
            +P  +       Q     G G GL +C+    +  G M+++S  G G+
Sbjct: 327 QQPSEEATDLPGEQINNVSGMGFGLPMCKTYLELFGGKMDIQSLPGWGT 375

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 1095 FDMIFMDVQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSK 1152
            FD+IF  +++PK+  +   K++R  N ++ T  I+A+TA+  ++  + C     +  L +
Sbjct: 1434 FDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLER 1489

Query: 1153 PIKRPKVKTILEEY 1166
            P+   +++++L +Y
Sbjct: 1490 PVSVQQLRSLLLKY 1503

>Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar to
           Ashbya gossypii ADL116C
          Length = 443

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 37/82 (45%), Gaps = 17/82 (20%)

Query: 839 IAIEVQDTGPGIDPSLQKSVFE----------------PFVQGDQTLSRQYGGTGLGLSI 882
           + + ++D G GI P ++  +F+                 ++   Q +S    G G GL +
Sbjct: 345 LEVRIRDFGGGIPPDVEDKMFDYSYSTSEKDAKDTGMSAYIIPGQDVS-NVSGMGFGLPL 403

Query: 883 CRQLANMMNGTMELKSEVGVGS 904
           C+    M NG ++++S  G G+
Sbjct: 404 CKAYLEMFNGQLDIQSLWGWGT 425

>Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} similar to
            Ashbya gossypii ACR218W
          Length = 1694

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 60/134 (44%), Gaps = 16/134 (11%)

Query: 1038 VPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDM 1097
            + D G    +L+ E   +++  + R L L G   + +        +E+      G  FD+
Sbjct: 1555 ISDVGYNMDVLLCEPIPIHRYRLARDLELLGCSVVAVG-----TGDEIVRRATSGVRFDL 1609

Query: 1098 IFMDVQMPKVDGLLSTKMIRN--DLHYTYPIVALTAFADD--SNIKECLEAGMNGFLSKP 1153
            I   +++PK+  +   +++R+   ++   PIVA+     D  SNI        +  L +P
Sbjct: 1610 IITTLKLPKIGAIDIARLLRHTTSINCNTPIVAVAVNYHDVGSNI-------FDDVLERP 1662

Query: 1154 IKRPKVKTILEEYC 1167
            I   +++ ++ +Y 
Sbjct: 1663 IGVEQLRKMVSKYA 1676

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 55/111 (49%), Gaps = 8/111 (7%)

Query: 1060 IKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIR-- 1117
            I R    + +EN+        A +E+ +    G  FD+I   +++PK+  +   +++R  
Sbjct: 1633 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQT 1692

Query: 1118 NDLHYTYPIVALTAFADDSNIKECLEAGM-NGFLSKPIKRPKVKTILEEYC 1167
            N  + T PIVA+T +      +E + + + +  L KP+   ++K ++ +Y 
Sbjct: 1693 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKYA 1738

>ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL042C
          Length = 435

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 18/93 (19%)

Query: 829 IELTNPKTWV-IAIEVQDTGPGIDPSLQKSVFE----------------PFVQGDQTLSR 871
           IE+T  +++  + I ++D G GI P ++  +F+                 ++   Q +S 
Sbjct: 326 IEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVS- 384

Query: 872 QYGGTGLGLSICRQLANMMNGTMELKSEVGVGS 904
              G G GL +C+    M NG +++ S  G G+
Sbjct: 385 NVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGT 417

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 60/132 (45%), Gaps = 18/132 (13%)

Query: 1040 DAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIF 1099
            + G    +L+ E   +++  + R L   G   + +        +E+      G  FD+I 
Sbjct: 1433 EVGYNMDVLLCEPIPIHRYRLTRDLESLGCSVVAVG-----TGDEIVRRATSGVRFDLII 1487

Query: 1100 MDVQMPKVDGLLSTKMIRN--DLHYTYPIVALTAFADDSNIKECLEAGMNGF---LSKPI 1154
              +++PK+  +  T+++R    ++ T PIVA+T    D        AG + F   L +PI
Sbjct: 1488 TTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTVNYHD--------AGTHIFDDVLERPI 1539

Query: 1155 KRPKVKTILEEY 1166
               +++ ++ +Y
Sbjct: 1540 GTEQLRKLVSKY 1551

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 1095 FDMIFMDVQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSK 1152
            FD+I   +++PK+D +   K+I+  N ++   PI+A T +  ++          N  + K
Sbjct: 1884 FDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQEAETCHVF----NDIMEK 1939

Query: 1153 PIKRPKVKTILEEYCPNWQMKVAEDN 1178
            PI+   ++ ++  Y    + ++ EDN
Sbjct: 1940 PIQLDILRRVVSRYALQ-KSQIEEDN 1964

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1602

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 62/130 (47%), Gaps = 13/130 (10%)

Query: 1040 DAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIF 1099
            D   +  +LV E   +++  + + L   G   I +      A +E+ +    G  FD+I 
Sbjct: 1463 DVNYRMDVLVCEPIPIHRYRVTKDLESLGCTVISVG-----AGDELVSRATSGVKFDLII 1517

Query: 1100 MDVQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEAGM-NGFLSKPIKR 1156
              +++PK+  +   ++++  N ++ T P+VA+T +      +E +   + +  L KP+  
Sbjct: 1518 TALKLPKLGAVDIVRLLKHTNSINATTPVVAVTNY-----YQEAVSGNVFDDVLEKPVAY 1572

Query: 1157 PKVKTILEEY 1166
             +++ I  +Y
Sbjct: 1573 DQLRKIAAKY 1582

>KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {ON}
           Anc_7.222 YIL042C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 409

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 39/99 (39%), Gaps = 19/99 (19%)

Query: 829 IELTNPKTWVIAIEVQDTGPGIDPSLQKSVFE-----------------PFVQGDQTLSR 871
           + L  P    + + V D G GI P ++  +F+                     G+    +
Sbjct: 303 VTLLRPHETELTLRVSDRGGGIPPGVESHIFDYSYTTTTEAADTDTATAQMHAGEAV--K 360

Query: 872 QYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTV 910
              G G GL +CR    + +G ++++S  G G+    T+
Sbjct: 361 SVAGMGFGLPLCRTYLELFDGKIDVQSLWGHGTDVYLTM 399

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 13/129 (10%)

Query: 1042 GKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMD 1101
            G    +LV E   +++  + + L     EN+        A +E+ +    G  FD+I   
Sbjct: 1615 GYHMDVLVCEPIPIHRYRVAKDL-----ENLGCTVVSVGAGDELVSRATSGVSFDLIMTA 1669

Query: 1102 VQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEA-GMNGFLSKPIKRPK 1158
            +++PK+  +   ++++  N ++ T PIV++T +      +E + +   +  L KP+   +
Sbjct: 1670 LKLPKLGAIDIVQLLKQTNGVNSTTPIVSITNY-----FQEAIASKAFDDVLEKPVNLDE 1724

Query: 1159 VKTILEEYC 1167
            +K ++ +Y 
Sbjct: 1725 LKRLVAKYA 1733

>Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR023W
            (MYO1) - Class II Myosin [contig 11] FULL
          Length = 1907

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 10/99 (10%)

Query: 453  SNANTSQRANSISRFTDHTDLSNRS-KKLTTSANLIEARVPDYRRLFSDELSDLTDTFNA 511
            +NAN       ++   D  D  N+S +KL     L+EA+  +YRR + +  S L +    
Sbjct: 1632 ANANQKTLEEKLALLQDKVDTLNQSLEKLLEEKGLLEAQKEEYRRRYEESRSGLGEVSKE 1691

Query: 512  MTDALDQHYAL-----LE----DRVRARTKQLEAAKIEA 541
                LD+ +AL     LE    DR  A  +QL+AA  +A
Sbjct: 1692 RESILDKVHALEKSLQLEREQSDRNEALVEQLQAAASKA 1730

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 62/129 (48%), Gaps = 13/129 (10%)

Query: 1042 GKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMD 1101
            G    +LV E   +++  + + L     EN+        A +E+ +    G  FD+I   
Sbjct: 1622 GYHMDVLVCEPIPIHRYRVTKDL-----ENLGCTVVSVGAGDELVSRATSGVSFDLIMTA 1676

Query: 1102 VQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEAGM-NGFLSKPIKRPK 1158
            +++PK+  +   ++++  N  + T PIVA+T +      +E + + + +  L KP+   +
Sbjct: 1677 LKLPKLGAIDIVQLLKQTNGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDE 1731

Query: 1159 VKTILEEYC 1167
            +K ++ +Y 
Sbjct: 1732 LKKLVAKYA 1740

>TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1536

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 62/129 (48%), Gaps = 17/129 (13%)

Query: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103
            K  IL+ E   +++  I + L   G   + +A     A +E+ +    G  FD+I   ++
Sbjct: 1403 KLDILLCEPIPIHRYYITKDLETLGCTVVSVA-----AGDELISRATSGIKFDLIITALK 1457

Query: 1104 MPKVDGLLSTKMIR--NDLHYTYPIVALTAF---ADDSNIKECLEAGMNGFLSKPIKRPK 1158
            +PK+  +   K+++  N ++   P+VA+T++   A ++NI        +    KPI    
Sbjct: 1458 LPKLGAVDIVKLLKHTNGINSFTPVVAVTSYYHEATNANI-------FSDVFEKPITLDV 1510

Query: 1159 VKTILEEYC 1167
            +K ++ +Y 
Sbjct: 1511 LKKLVSKYA 1519

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 11/88 (12%)

Query: 832 TNPKTWVIAIEVQDTGPGIDP---SLQKSVFEPFVQGDQTLSRQYGGTG--------LGL 880
           TN  T  +A+ ++ T P +DP   +L       + QGD      +G T         LG 
Sbjct: 89  TNRATITVAVRIKPTAPNVDPQWHALGPRCIAHWDQGDFQFDHVFGPTATNEDLFAELGG 148

Query: 881 SICRQLANMMNGTMELKSEVGVGSTFTF 908
            +  +L +  N T+      G G T+T 
Sbjct: 149 GLVEKLFDGCNATLLAYGTTGSGKTYTM 176

>KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} similar to
            uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
            Folylpolyglutamate synthetase catalyzes extension of the
            glutamate chains of the folate coenzymes required for
            methionine synthesis and for maintenance of mitochondrial
            DNA present in both the cytoplasm and mitochondria
          Length = 493

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 1101 DVQMPK--VDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPK 1158
            D ++P+  VDGL S K   N    T    A+T   D ++ K+ +EA    F S+ IK P+
Sbjct: 312  DTELPQRFVDGLTSAKW--NGRCQTVQDGAITWLIDGAHTKDSIEAASGWFKSEVIKTPR 369

Query: 1159 VKTIL 1163
             K +L
Sbjct: 370  KKVLL 374

>Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {ON}
            YFL033C (RIM15) - Trehalose-associated protein kinase
            related to S. pombe cek1+ [contig 244] FULL
          Length = 1521

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 8/72 (11%)

Query: 1095 FDMIFMDVQMPKVDGLLSTKMIR--NDLHYTYPIVALTAFADDSNIKECLEAGM-NGFLS 1151
            FD+IF  +++PK+  +   K++R  N ++ T  I+A+TA+      +E  +AG+    L 
Sbjct: 1431 FDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAY-----YQEAQQAGVFEDVLE 1485

Query: 1152 KPIKRPKVKTIL 1163
            +P    +++++L
Sbjct: 1486 RPATVQQLRSLL 1497

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 112,865,506
Number of extensions: 4790945
Number of successful extensions: 27123
Number of sequences better than 10.0: 154
Number of HSP's gapped: 27623
Number of HSP's successfully gapped: 201
Length of query: 1183
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1062
Effective length of database: 39,606,813
Effective search space: 42062435406
Effective search space used: 42062435406
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)