Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G002305.702ON1735172280890.0
ZYRO0G06600g5.702ON1820158513991e-162
TDEL0B021905.702ON1810162313571e-156
SAKL0E14916g5.702ON1779166611731e-132
CAGL0G02497g5.702ON1780141210391e-115
KLTH0E01056g5.702ON1771165210171e-112
NCAS0A032005.702ON1788156810071e-111
Kwal_55.196975.702ON176017619681e-106
Suva_11.3315.702ON189814049601e-104
Ecym_40185.702ON176912459181e-99
Smik_11.3585.702ON187814189021e-97
YKR095W (MLP1)5.702ON187513768726e-94
AFR286W5.702ON175812468601e-92
Skud_11.3345.702ON188513948476e-91
KLLA0A00594g5.702ON174815388377e-90
KAFR0D022205.702ON167416618011e-85
YIL149C (MLP2)5.702ON167914397653e-81
Suva_9.395.702ON168214236958e-73
Smik_9.205.702ON168213666537e-68
Skud_9.195.702ON168012706215e-64
TBLA0E017305.702ON182014995671e-57
NDAI0F002905.702ON15547155615e-57
NDAI0E050405.702ON19737275322e-53
Kpol_1043.705.702ON13216083442e-31
KNAG0L021405.702ON16086632923e-25
KAFR0H002105.702ON14545022555e-21
TPHA0E002305.702ON12846962028e-15
TPHA0D046105.702ON11834961921e-13
KNAG0C065905.702ON16513261875e-13
Kpol_2001.755.702ON10061821030.003
YOL004W (SIN3)6.29ON15361261020.005
NDAI0A084507.101ON111995950.028
NCAS0I005707.101ON109595840.59
Skud_8.785.267ON1927243821.1
CAGL0D00924g4.238ON1980345811.3
CAGL0F04609g7.488ON1311184792.4
AEL337C7.101ON109791783.2
CAGL0A02596g5.414ON872101773.9
NDAI0A007401.141ON147557765.2
Suva_2.1353.199ON49775738.6
CAGL0M07051g8.853ON92349748.7
Kpol_1051.255.267ON196874749.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G00230
         (1735 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...  3120   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   543   e-162
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   527   e-156
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   456   e-132
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   404   e-115
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   396   e-112
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   392   e-111
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   377   e-106
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   374   e-104
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   358   1e-99
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   352   1e-97
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   340   6e-94
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   335   1e-92
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   330   6e-91
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   327   7e-90
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   313   1e-85
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   299   3e-81
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   272   8e-73
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   256   7e-68
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   243   5e-64
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   223   1e-57
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   220   5e-57
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   209   2e-53
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   137   2e-31
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   117   3e-25
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   102   5e-21
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    82   8e-15
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    79   1e-13
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    77   5e-13
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    44   0.003
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...    44   0.005
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    41   0.028
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    37   0.59 
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    36   1.1  
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    36   1.3  
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    35   2.4  
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    35   3.2  
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    34   3.9  
NDAI0A00740 Chr1 complement(139425..143852) [4428 bp, 1475 aa] {...    34   5.2  
Suva_2.135 Chr2 (236118..237611) [1494 bp, 497 aa] {ON} YBR006W ...    33   8.6  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...    33   8.7  
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    33   9.6  

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 3120 bits (8089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1600/1722 (92%), Positives = 1600/1722 (92%)

Query: 1    MVNLNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKDRLNATIDNFKSKMSSQFDT 60
            MVNLNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKDRLNATIDNFKSKMSSQFDT
Sbjct: 1    MVNLNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKDRLNATIDNFKSKMSSQFDT 60

Query: 61   VKNXXXXXXXXXXXXXXXXXXXXSKCIQWEQQYAQHQDISKTDLASDDVIKENETFKRDH 120
            VKN                    SKCIQWEQQYAQHQDISKTDLASDDVIKENETFKRDH
Sbjct: 61   VKNDLELLQKEKELLIQDKKQLESKCIQWEQQYAQHQDISKTDLASDDVIKENETFKRDH 120

Query: 121  QLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYERKV 180
            QLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYERKV
Sbjct: 121  QLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYERKV 180

Query: 181  KDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLL 240
            KDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLL
Sbjct: 181  KDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLL 240

Query: 241  EENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLK 300
            EENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLK
Sbjct: 241  EENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLK 300

Query: 301  NXXXXXXXXXXXXXXDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTENEESTSDNELV 360
            N              DRLLHELVDIKKSLEKSELENVHLNDFIEQYLTENEESTSDNELV
Sbjct: 301  NTTKETTGGTSTLEKDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTENEESTSDNELV 360

Query: 361  LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER 420
            LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER
Sbjct: 361  LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER 420

Query: 421  ESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT 480
            ESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT
Sbjct: 421  ESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT 480

Query: 481  FLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSV 540
            FLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSV
Sbjct: 481  FLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSV 540

Query: 541  QKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKK 600
            QKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKK
Sbjct: 541  QKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKK 600

Query: 601  EEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKML 660
            EEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKML
Sbjct: 601  EEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKML 660

Query: 661  EDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYKQNL 720
            EDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYKQNL
Sbjct: 661  EDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYKQNL 720

Query: 721  LQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLL 780
            LQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLL
Sbjct: 721  LQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLL 780

Query: 781  KKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKI 840
            KKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKI
Sbjct: 781  KKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKI 840

Query: 841  SDLEKTLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXXINQYRDLLNLAEETKNRLQKDLN 900
            SDLEKTLSQNTNGSSSLPRVDQDF             INQYRDLLNLAEETKNRLQKDLN
Sbjct: 841  SDLEKTLSQNTNGSSSLPRVDQDFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQKDLN 900

Query: 901  KQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKN 960
            KQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKN
Sbjct: 901  KQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKN 960

Query: 961  SLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDG 1020
            SLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDG
Sbjct: 961  SLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDG 1020

Query: 1021 LKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGST 1080
            LKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGST
Sbjct: 1021 LKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGST 1080

Query: 1081 TSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQ 1140
            TSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQ
Sbjct: 1081 TSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQ 1140

Query: 1141 SFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELL 1200
            SFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELL
Sbjct: 1141 SFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELL 1200

Query: 1201 KNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEE 1260
            KNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEE
Sbjct: 1201 KNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEE 1260

Query: 1261 LSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEID 1320
            LS            NEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEID
Sbjct: 1261 LSTLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEID 1320

Query: 1321 LDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKL 1380
            LDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKL
Sbjct: 1321 LDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKL 1380

Query: 1381 TEEVNSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEVXXXXXXXXXXXXXXXXX 1440
            TEEVNSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEV                 
Sbjct: 1381 TEEVNSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEVEKTELITTLKEEFKKQL 1440

Query: 1441 XXXXXXXXXXXXXXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIR 1500
                          YYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIR
Sbjct: 1441 EEEKKKLLEEKEKEYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIR 1500

Query: 1501 LPSEEKINRVIXXXXXXXXXXXXXXXXXQGLTTETAIXXXXXXXXXXXXXXXFDNELAEV 1560
            LPSEEKINRVI                 QGLTTETAI               FDNELAEV
Sbjct: 1501 LPSEEKINRVIEKRRKELEEEYEKKLKRQGLTTETAIEEELRKEVERELRVKFDNELAEV 1560

Query: 1561 KKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKIN 1620
            KKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKIN
Sbjct: 1561 KKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKIN 1620

Query: 1621 LLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKPAFLFASNNHSQ 1680
            LLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKPAFLFASNNHSQ
Sbjct: 1621 LLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKPAFLFASNNHSQ 1680

Query: 1681 TKKQDGLPINKSPFQTTLFAPFSSKTTTPNGTPTLKRSVEEV 1722
            TKKQDGLPINKSPFQTTLFAPFSSKTTTPNGTPTLKRSVEEV
Sbjct: 1681 TKKQDGLPINKSPFQTTLFAPFSSKTTTPNGTPTLKRSVEEV 1722

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  543 bits (1399), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 480/1585 (30%), Positives = 824/1585 (51%), Gaps = 155/1585 (9%)

Query: 231  SLEKQYELLLEE--NKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHE 288
            SL  + EL LE+  N+    +N ELT ++ ++L + K L + L   K+ F  EM++ Q  
Sbjct: 245  SLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKL 304

Query: 289  NDLLKEHIEYL---------KNXXXXXXXXXXXXXXDRLLHELVDIKKSLEKSELENVHL 339
             DLL+  ++ L         K+              ++L+ EL+ +K++ E+SE E + L
Sbjct: 305  IDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRL 364

Query: 340  NDFIEQ----------------YLTENEESTSDNELVLLKEQLIKEKRQKDYLQEQVELF 383
               +++                +++   + +S  ++ +LK++LIKE+ QK+ LQ QVE F
Sbjct: 365  EALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESF 424

Query: 384  VIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENI 443
            ++ELE ++P +NS K+R   LE+EL  +  LL+ T  E + R +E    ++++K+   +I
Sbjct: 425  IVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSI 484

Query: 444  NVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISE 503
            + L  QR DLAHQVQFLL+N+ ++     LL+ +E++F+++I+ + +  ++SDSQ++ISE
Sbjct: 485  HTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISE 544

Query: 504  RLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI------TRNESKEKIAKLQE 557
            RLV+F++I+ LQ++NMELL T R LAE+LES +    +KI      T  E+KE I  LQ+
Sbjct: 545  RLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQD 604

Query: 558  SINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKK-----EEQLTKLE-RMS 611
                L SK+E L KE DA+K +  +N  +Q  +         +     EE+L  LE R++
Sbjct: 605  YNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLT 664

Query: 612  SLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKY 671
            SL    + +  K+LN  I +L + K  ++  + KE S + + E++ K+++ +LEL   + 
Sbjct: 665  SLTVE-SSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNEN 723

Query: 672  DLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYK--QNLLQYSK--DN 727
               VK+ ++ +++ +  ++   +   E     +K+++L+ ++ + +  + LLQ S+    
Sbjct: 724  QQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSR 783

Query: 728  ENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLKKSKIQL 787
            EN L KL+        + S+L T+++E E+    ++E +T YKE+    E+    ++ +L
Sbjct: 784  ENYL-KLSEERNSLRIMVSQLQTLQSEREK---FLKEIQTTYKENLDSLEQEKADARARL 839

Query: 788  EDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTL 847
            + K KE +D E  K +QI WYQ +LDS+   +  L+ EL  +   +     ++  LEK +
Sbjct: 840  DAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQV 899

Query: 848  SQN----------------TNGSSSLPRVDQDFXXXXXXXXXXXXXINQYRDLLNLAEET 891
             ++                T+  SSL +   +              I+QY++LL+  EE+
Sbjct: 900  EESEARIQSYQVLSGSEVETSPESSLRK---ELEKTKINLSDTYAEIDQYKNLLSTTEES 956

Query: 892  KNRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDK 951
             +          Q+  D   GK++L  Q+  L  E S +  ++ K        ++ +QD 
Sbjct: 957  LS----------QLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDA 1006

Query: 952  ATETENLKNSLSSLENKITTLENEM--------------------VEKTKSFEEK-ENTY 990
                EN KN+L   + KI TLE E                     +E+  SF  + +  Y
Sbjct: 1007 NKAAENEKNTL---QKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNY 1063

Query: 991  KEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQV 1050
            +E+L K S  S  I ++  +++  + ++  LK +       +    +    +K  +E Q+
Sbjct: 1064 EEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQL 1123

Query: 1051 DEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRRERDGL 1110
            +  ++ +++L+ Q        S +  +    S D  + V  +T++  E++  LRRERD L
Sbjct: 1124 ETSRQHLEDLSTQ-------NSLLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDIL 1176

Query: 1111 DIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELN 1170
              KL +SQRE  +LR  + +++N LD T++     + E++       QH++ ++QLN+LN
Sbjct: 1177 GTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLN 1236

Query: 1171 TLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSE 1230
             L+E+N  L+    E +K+N  +  +L  L+  + PL+ ++  L  S++EKDQQL L  E
Sbjct: 1237 LLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKE 1296

Query: 1231 ENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAH 1290
            E  RWK RS+EIL K  ++D E+H +L E++S            N++L+DRFNRLKKQAH
Sbjct: 1297 EANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAH 1356

Query: 1291 EKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEK 1350
            EKL+++K    +L+ ++ +L +AKS+LE   + E +++ E++ +L    ++ + + +++K
Sbjct: 1357 EKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQK 1416

Query: 1351 ELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAIN 1410
            ELSD++E+S+++E+NL  T+  + E+ KKL +E++SLK +L +LK Q+   +  + S   
Sbjct: 1417 ELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDL 1476

Query: 1411 SETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEPIDIE 1470
            S  +  ++ SFE                                   ++P    +P++ E
Sbjct: 1477 SNVVESMRRSFE-------EEKINFLKEKTEELKKLEEEKHTLQVNGNEPQ--QQPVNYE 1527

Query: 1471 KMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXXXXXX--XXXXXXXX 1528
            ++K +WE +QEE I++RIA+AEENLKKRIRLP+EE+I +V+                   
Sbjct: 1528 EIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESK 1587

Query: 1529 QGLTTETAIXXXXXXXXXXXXXXXFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLES 1588
              L +                   F+ E+  VKKKAF EGKQQ+ MK+TLLERK+SKLES
Sbjct: 1588 SSLESSDGNNSDLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLES 1647

Query: 1589 Q-ASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQIN 1647
            Q      +PD  SS+   T    K  L PSKI+    +   T+ S+   +  GEKVL+  
Sbjct: 1648 QLHGKVDSPDKSSSE---TSSVPKPNL-PSKIDEKSVT---TNQSVPNPLVSGEKVLK-- 1698

Query: 1648 RRSLEP--------SFGSSNPFTLPTQN-----------KPAFLFASNNHSQTKKQDGLP 1688
               L+P        SF   NPFT   QN           KP F  ++N++    K  G  
Sbjct: 1699 ---LDPSKPTFNFSSFSGGNPFTSSPQNNDTMGTSAFGFKPTFTLSNNSN----KSSGTK 1751

Query: 1689 INKSPFQTTLFAPFSSKTTTPNGTP 1713
            I+ S  +     PFSS T T   +P
Sbjct: 1752 IDSSSTENKPANPFSSFTETGASSP 1776

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  527 bits (1357), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 479/1623 (29%), Positives = 832/1623 (51%), Gaps = 120/1623 (7%)

Query: 150  ELQNDNIDIRTQLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSN 209
            EL NDN ++R QL   ++E + LK        + E +K     +    E   KE++  + 
Sbjct: 162  ELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTE 221

Query: 210  KFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLEN 269
            +    +  +  EL+ +   +  L+  Y+L     +   ++N E++  + ++L++ K L +
Sbjct: 222  QLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSD 281

Query: 270  DLNELKESFTREMTLTQHENDLLKEHIEYLKNXXXXXXXXXXXXXXD--------RLLHE 321
            +LN  K+ F+REM+L Q   DL  E ++  K               D        R + +
Sbjct: 282  ELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTEEKHNSTEADNLQSTQQARFMDD 341

Query: 322  LVDIKKSLEKSELENVHLNDFIEQYLTENEE----STSD-------NELVLLKEQLIKEK 370
            L  +++ LE+S  E + L   + + + ++EE    ST++        ++ +LK+QLIKE+
Sbjct: 342  LAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKER 401

Query: 371  RQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELT 430
             QK+ LQ Q+E FV+ELE ++P +NSLK+R+ TLE+EL  I  LLE T  E + + +EL 
Sbjct: 402  HQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELE 461

Query: 431  TENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRN 490
            +   ++K+   N + L+ QR DLA QVQFLL N  L+   +  LT DE+ F++KII++ N
Sbjct: 462  SATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENEN 521

Query: 491  SQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSD------TKSVQKIT 544
              N+SDSQ II+ERLV+F DI+ LQ++N ELL T R LA++LE  +        S+++ T
Sbjct: 522  PSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKT 581

Query: 545  RNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLL------SLQNTGEQTPTEELRSQLQ 598
             +E+KE I  LQE  + + SK+  ++KE+DAYK +      S  N G+    ++     Q
Sbjct: 582  IDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDS----Q 637

Query: 599  KKEEQLTKLE-RMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKS 657
            + +E +  LE ++S+L +  ++   ++LNQ I  L + K  L  +  KE S R +AE + 
Sbjct: 638  ENQELIKSLEDKLSTLTTETSKNN-ELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRL 696

Query: 658  KMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKE---IE 714
            K+L+ +LE+   +    +++    +++L+   A N +   +  + Q+K+S+L+     ++
Sbjct: 697  KLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLD 756

Query: 715  SYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDS 774
            + K  L   S      + K++        + ++L T+++E E   NL++E +  +K   +
Sbjct: 757  AEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERE---NLLKESQASHKAAIA 813

Query: 775  ISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKIN 834
              E    + K ++  K  E+K  E  K +Q  W+Q+++D +++   K++ EL  +   + 
Sbjct: 814  QLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVA 873

Query: 835  IQRLKISDLEK-------------TLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXXINQY 881
               L+++DL+K             TL+   NG ++  ++ +D                ++
Sbjct: 874  QLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEF 933

Query: 882  RDLLNLAEETKNRLQKDLNKQRQIVDDAMEG----KEQLDQQLAELTQECSSMNSLLQKQ 937
            + + + AEET   L  +  ++ + +    E     K QL+Q ++ L +    +N+    Q
Sbjct: 934  KQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQ 993

Query: 938  KAKCEDDQKIIQDKATETENLKNSLSSL----ENKITTLENEMVEKTKSFEEKENTYKEQ 993
            K + E+++  I  K    E+ ++SL  +    + K+  L+ ++ ++T      +  Y+E+
Sbjct: 994  KNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEE 1053

Query: 994  LHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEF 1053
            L K +E S +I ++ +E ++ ++ +  LKA+    ++ +    +   ++K   +  +D+ 
Sbjct: 1054 LQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDL 1113

Query: 1054 KETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRRERDGLDIK 1113
            K  +DN++ Q  +   +   +    S +  + +  ++  +S   EL+++LRRERD L+ K
Sbjct: 1114 KRQVDNISSQNKLLFSQVELL----SKSEREFENKLLPGSS---ELLISLRRERDILETK 1166

Query: 1114 LDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLK 1173
            L +S+RE   L ++   L++ L E R+    L+   S      +QH++ ++QLN++N L+
Sbjct: 1167 LTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLR 1226

Query: 1174 ETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENE 1233
            E+N  L+  +    ++N+ + ++L  L++++ PL  ++   + SI EKDQ++ LL +E +
Sbjct: 1227 ESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEAD 1286

Query: 1234 RWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKL 1293
            RWK RS +IL + +++D EE+ KL EE+S            N DLNDRF RLKKQAHEKL
Sbjct: 1287 RWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKL 1346

Query: 1294 DAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEKELS 1353
            +A+K   A+L+AE+ +L   K+K+E  L E + ++  +E  L ++         L  EL 
Sbjct: 1347 NASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELD 1406

Query: 1354 DSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAINSET 1413
            D++E  K+IE  L ETV SS  L  +L EE+NSLK Q+   K +    S  +GS   S  
Sbjct: 1407 DALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKEN-DSTLEGSQGLSNV 1465

Query: 1414 IAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEPI---DIE 1470
            +  +K++FE                                   S+    +EP+   D+ 
Sbjct: 1466 VESMKKAFE---------EEKIKFIQEKTEEYNKKFEEEKAKLSSENGSPAEPVSAPDVN 1516

Query: 1471 KMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXXXXXXXXXXXXXXQG 1530
             +K +WEE+ E I  QRI +AEENLKKRIR+P+EE+I +V+                   
Sbjct: 1517 SLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENN 1576

Query: 1531 LTTETAIXXXX---XXXXXXXXXXXFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLE 1587
            L  E                     +   LA  KKKAF EGKQQ+ MK+TLLERK+SKLE
Sbjct: 1577 LQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLE 1636

Query: 1588 SQASPSRTPDLESSQKENTEGATKTTLG-PSKINLLPFSMSNTDDSIEKQVPQGEKVLQI 1646
            SQ + S  P          E A  T++G P+KI+      S T++        GEKVL++
Sbjct: 1637 SQLNSSNNP--------TPEKAAATSVGLPTKID-----ESRTENMATGTPAFGEKVLKL 1683

Query: 1647 NRR---SLEPSFGSSNPFT--LPTQN-----KPAFLFASNNHSQTKKQDGLPINKSPFQT 1696
            + +   S +PS   SNPFT  LP  N     KP F F   +          P ++  F +
Sbjct: 1684 SDKPAFSFQPS-SKSNPFTSALPGNNNVFGMKPTFSFTPGSSQ--------PESRPTFGS 1734

Query: 1697 TLF 1699
            T F
Sbjct: 1735 TGF 1737

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  456 bits (1173), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 479/1666 (28%), Positives = 834/1666 (50%), Gaps = 174/1666 (10%)

Query: 158  IRTQLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTS 217
            +R Q+   ++E +  KS   R   + + L    + +K+  +   KEL+  S +F + +  
Sbjct: 169  LRKQVLELENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQR 228

Query: 218  SSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKES 277
             ++EL+ A   L+S+  + E+    ++  K R N+L+  + D++ + KSL +  +  K+ 
Sbjct: 229  VNSELQTALSELNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQE 288

Query: 278  FTREMTLTQHENDLLKEHIEYLKNXXXXXXXXXXX------XXXDRLLHELVDIKKSLEK 331
            FTREMTL Q   DLL++ IE  K                     ++++ EL++ KK LE 
Sbjct: 289  FTREMTLKQRLIDLLEKQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEI 348

Query: 332  SELENVHLNDFIEQYLTENEESTSDN------------------ELVLLKEQLIKEKRQK 373
            SE + V L + +++ L+ + E  + N                  ++ LLK++LI+E+RQK
Sbjct: 349  SESKAVKLEETVDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQK 408

Query: 374  DYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTEN 433
            + LQ QVE FV+ELE+++P +NS K+R + LE+EL  +  +LE T ++ + +  ELT+  
Sbjct: 409  EQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVK 468

Query: 434  RRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQN 493
             ++ +    I+ L+ QR DLAHQVQ LL+ + ++      LTP+E  F++KII S  S  
Sbjct: 469  SKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPV 528

Query: 494  DSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI------TRNE 547
            + D+Q+IISERLV+F  +  LQ++NMELL + RNLA++LE+ + +S  K       T  E
Sbjct: 529  EQDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKE 588

Query: 548  SKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQ---LQKKEEQL 604
            +KE I  LQE    L S+LE + KE+DA+K+L+        P+    S+   L   EE++
Sbjct: 589  AKEAILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKI 648

Query: 605  TKLE-RMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDS 663
             +LE  +SSL    A+   K+LN+ I  L + + D +  + KE S R +AE +SK++ ++
Sbjct: 649  KELENHLSSLTEESAK-NIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNT 707

Query: 664  LELLHKKYDLAVKKYEHYETLLNDHNAENI--KHSRENET------TQAKISILQKEIES 715
            LE+   + D   K++   +        ENI  + S+  +T       ++++S LQ ++ +
Sbjct: 708  LEMTKMENDELRKRFHSLQ--------ENILKQDSKTQQTIESLISCKSQLSALQSQLNN 759

Query: 716  YK--QNLLQYSKDN---ENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYK 770
             +  ++LL+  ++N   EN    L+        L ++L T++ E E   +L++E +  ++
Sbjct: 760  SQSERDLLRSIQENLKKEN--ESLSEERNNMRILITQLQTLQTERE---SLLEETQKNFQ 814

Query: 771  EHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKEL 830
               +  E  L  +  +L+ K KE+ D+ + K+SQ  WYQ++ D L    +  + +L+ +L
Sbjct: 815  GKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKL 874

Query: 831  TKINIQRLKISDLEKTLSQN---------TNGSSSLPR----VDQDFXXXXXXXXXXXXX 877
            T I    LK+  L   L ++          N S S+      + Q+              
Sbjct: 875  TDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQ 934

Query: 878  INQYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEG----KEQLDQQLAELTQECSSMNSL 933
            + QY+ + + +EE+   ++  L + +    + +E     ++    Q+  L  + S++N+ 
Sbjct: 935  VEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNE 994

Query: 934  LQKQKAKCEDDQKIIQDKATETENLKNSLSSLEN-------KITTLENEMVEKTKSFEEK 986
            L  QK++ E     I D     E+LK   S L+N       KI+ ++ ++ ++T      
Sbjct: 995  LNHQKSQFESQ---ISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTA 1051

Query: 987  ENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNH 1046
            +  Y+++L K ++ S  I  + AE + YK+  + L+    A E+A  A  Q  L  +   
Sbjct: 1052 QKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRN---AAENAKKALEQSELSWEKQS 1108

Query: 1047 ELQVDEFK---ETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILAL 1103
                DE +   + I++LN Q  I   +  F++    T+S D    ++  +++   L+ +L
Sbjct: 1109 SDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSED----LMPISTETRNLLTSL 1164

Query: 1104 RRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAV 1163
            RRE+D L+ KL++S RE   LR++++ +++ L+ +R     L+   SG   T +  +E +
Sbjct: 1165 RREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASGNSATLKDQEEIM 1224

Query: 1164 KQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQ 1223
             QLN+LN L+E+N  L+ + ++N + +  +  +L+ L  ++ PL+ KV  L+NS+ EKD 
Sbjct: 1225 TQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDL 1284

Query: 1224 QLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFN 1283
            Q++L +EE ERWK RS++IL K +++D EEH KL +++S            NE+L+ RF 
Sbjct: 1285 QISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFK 1344

Query: 1284 RLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPD 1343
            RLK+QAHEKL+AAK   ++LT+++ DL   K KLE DL  +++ ++ +ES+         
Sbjct: 1345 RLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESK--------- 1395

Query: 1344 VITALEK-------ELSDSVENSK----KIEENLQETVNSSLELNKKLTEEVNSLKSQLE 1392
             IT +EK       +L + +ENS+    + E  L++  +SS  L K+L E + SL ++++
Sbjct: 1396 -ITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIK 1454

Query: 1393 TLK---NQNGVISVADGSAIN------SETIAHLKESFEVXXXXXXXXXXXXXXXXXXXX 1443
             L+    +    S  DGS  +      S+ + +LK  FE                     
Sbjct: 1455 LLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELREQFEEE 1514

Query: 1444 XXXXXXXXXXXYYDSKPTGG-SEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLP 1502
                         +   T     P++I+++K +WEE+ E+   QRI ++ E LKKRIRLP
Sbjct: 1515 KASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLP 1574

Query: 1503 SEEKINRVIXXXXXXXXXXXXXXXXXQG--LTTETAIXXXXXXXXXXXXXXXFDN----- 1555
            +EEKIN+++                 +   +    +                 +N     
Sbjct: 1575 TEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEM 1634

Query: 1556 ------ELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQ--ASPSRTPDLESSQKENTE 1607
                  ++A++KK+AF EGKQQ+ MK+T LE+K++KLE+Q  A  S  P  ++S      
Sbjct: 1635 QKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNS------ 1688

Query: 1608 GATKTTLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQN 1667
             AT    GP+           T D     V Q   +L  N+ ++ P  G   PF     N
Sbjct: 1689 SATPAESGPT-----------TQD-----VKQLTPILN-NQAAILP--GKPLPF-----N 1724

Query: 1668 KPAFLFASNNHSQTKKQDGLPINKSPFQTTLFAPFSSKTTTPNGTP 1713
               F F       T      P N  P + T  +P         G+P
Sbjct: 1725 PAHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSP 1770

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  404 bits (1039), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 400/1412 (28%), Positives = 713/1412 (50%), Gaps = 124/1412 (8%)

Query: 361  LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER 420
            +LK QL++EKRQK+ LQ QVE FVIELE+++P +NS ++R   LE+EL     LLE   +
Sbjct: 397  ILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATK 456

Query: 421  ESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT 480
            E++++  EL +  +++ +    + +L+ QR DLAHQ+Q+LL+N+ +     HLL  DEI 
Sbjct: 457  ENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIK 516

Query: 481  FLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSV 540
            F++ ++ + N  + +DSQK+ISE L+KF DI  LQ++NMEL+ T R LA+QLE ++ K  
Sbjct: 517  FIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEK-- 574

Query: 541  QKITRN-----------ESKEKIAKLQESINGLTSKLEKLQKEKDAYKLL-------SLQ 582
            +K T N           E+KE I  L++    L   L+ + KE+DA+KLL       + +
Sbjct: 575  KKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFK 634

Query: 583  NTGEQTPTEELRSQ----LQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYD 638
            ++       EL+S     ++  E +LT+L   S  ++H     +K L + +  L KE   
Sbjct: 635  SSNSVHKYHELKSYNETVVKDLENRLTQLTNDS--NAH-----SKALTEELNLLHKEISQ 687

Query: 639  LNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYD-LAVKKYEHYETLLNDHN------AE 691
            LN  I K  S +++AE++ K+ ++S+ELL K+ + L ++     ++LL          + 
Sbjct: 688  LNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSS 747

Query: 692  NIKHSRENETTQAKISILQKEIESYKQNLLQYSKDNENTL-SKLAAATQEKETLGSRLST 750
             ++   +N + +  +  L+ E+      LL   KD E +L S+L+  T+EK  L   ++ 
Sbjct: 748  YVEAISKNSSLETSVRNLETEV-----TLL---KDREISLKSELSNTTEEKTKLRIMVTQ 799

Query: 751  VKNELEQKINLMQERETYYK----EHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQIN 806
            +++   ++  L++  ++ +K    E + I+E+L K    QL +++ E+   E ++N+Q  
Sbjct: 800  LQSLQSERETLLERVQSDFKKRISEVNYINEKLDK----QLSERVHEIDKIEKERNAQYE 855

Query: 807  WYQKRLDSLT-----------TTNDKLQ-VEL-NKELTK-INIQRLKISDLEKTLSQNTN 852
            WYQK++D  +           T ND+L+ + L NK L K +   +++I   E T++QN +
Sbjct: 856  WYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYE-TINQNNS 914

Query: 853  GSSSLPRVDQDFXXXXXXXXXXXXXINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAM-- 910
             +     V ++              + ++++L   +E+    L    N + +   DA+  
Sbjct: 915  ENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAIKT 974

Query: 911  --EGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSL--- 965
              E K +++ +   L Q+  ++ + L  Q  + E ++K +     E +     +  +   
Sbjct: 975  LTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKM 1034

Query: 966  -ENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKAN 1024
             E K+  LEN++ E+T      +  Y+++L + ++ S  I ++  +N+  K     L A 
Sbjct: 1035 FEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAE 1094

Query: 1025 IAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSND 1084
            + + +D +S   + L  E+  + +Q+D  ++ ID++  Q  +   +   +    S   N 
Sbjct: 1095 LQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENS 1154

Query: 1085 TDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKG 1144
            +D+     T+    L+L+LRRERD LD K+++ + E  SL++++++++N L+ T++S   
Sbjct: 1155 SDDEANGSTA----LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAAL 1210

Query: 1145 LESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEM 1204
            LESE S        ++     L +LN L+E+N  L+ +L++   E + I   L++ +NE+
Sbjct: 1211 LESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNEL 1270

Query: 1205 NPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXX 1264
             PL+  +E   N I EKD ++   ++E++RWK R  E++ K Q+V+++++ KL E L+  
Sbjct: 1271 LPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNET 1330

Query: 1265 XXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEE 1324
                        +LNDRFNRLKKQAHEKL+ +K   +SL  +I++LI  K  +   LD +
Sbjct: 1331 KQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVK 1390

Query: 1325 RKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEV 1384
             +   E+ S+L    +  + +  L +EL+  +  S+++E  LQ  + SS   ++   +E+
Sbjct: 1391 TEENSELLSELNNFREKQNDLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEI 1450

Query: 1385 NSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXX 1444
              L+  ++ LK Q    S  D     +  +  +K  FE                      
Sbjct: 1451 EELQKVIDDLKTQLAANST-DADEQTNRNVEAIKREFE----NQKTKFIAEKTEEFNKRL 1505

Query: 1445 XXXXXXXXXXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSE 1504
                      + +++       +D+E ++ +WEE  EE+I +RIA+AE+NLKKRIRLPSE
Sbjct: 1506 IEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSE 1565

Query: 1505 EKINRVIXXXXXXXXXXXXXXXXXQG---LTTETA--IXXXXXXXXXXXXXXXFDNELAE 1559
            EKIN++I                 +    L  + +                  F++EL  
Sbjct: 1566 EKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNELKEALEKELKERFEDELQA 1625

Query: 1560 VKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKI 1619
             +KKAF EGKQQ+ MKTTLLERK+ KLESQ         E+   +  E +T     PS +
Sbjct: 1626 ARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENST-----PS-V 1679

Query: 1620 NLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKPAFLFASNNHS 1679
              +P +++++D                       SFG+SN   +   + P    ++ N+ 
Sbjct: 1680 KKIPETLNSSD----------------------TSFGNSNNVKVLKPSSPFGATSAFNNP 1717

Query: 1680 QTKKQDGLPINKSPFQTTLFAPFSSKTTTPNG 1711
             T   +G P    P   + FAP      +  G
Sbjct: 1718 FTFNNNGNP----PAFASAFAPTFKDLMSGQG 1745

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  396 bits (1017), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 450/1652 (27%), Positives = 810/1652 (49%), Gaps = 132/1652 (7%)

Query: 150  ELQNDNIDIRTQLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSN 209
            +L  +N  +R Q  + +SE++  KS+  ++  +   L    S  ++  E    +L + + 
Sbjct: 159  DLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNA 218

Query: 210  KFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLEN 269
            +F   + ++ ++L      L +LE++ +     NK+ +E N  +T  +  +L   K L +
Sbjct: 219  EFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTD 278

Query: 270  DLNELKESFTREMTLTQHENDLLKEHIEYLKNXXXXXXXXXXXXXX------DRLLHELV 323
            +LN  K+ FTREM+L +   DLL+  ++ LK+                    + L  EL 
Sbjct: 279  NLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELA 338

Query: 324  DIKKSLEKSELENVHLNDFIEQYLTENEES------------TSD--NELVLLKEQLIKE 369
               + LE+SE +   L   ++  ++ ++ES             +D   ++ LLK Q+I E
Sbjct: 339  QKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHE 398

Query: 370  KRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKEL 429
            KRQK++LQ QVE FV+ELE+++P ++S KDRN  LE++L +   +LE   ++ +    +L
Sbjct: 399  KRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDL 458

Query: 430  TTENRRLKEQTENINVLMS----QRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKI 485
                RR K Q  +  + +S    QR DLA QVQ+LL+   ++   +  LT +EI F+R+I
Sbjct: 459  ----RRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRI 514

Query: 486  IKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSD------TKS 539
            ++  +   + D+QK+ISERLV+F DI  LQ +N +LL T RNLA++LES +      +K+
Sbjct: 515  LEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKT 574

Query: 540  VQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQ-NTGEQTPTEELRSQLQ 598
            V+     E+KE I  LQE    L S++E L KE+DAYK +    N G +     L +   
Sbjct: 575  VENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKG 634

Query: 599  KKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSK 658
            K   ++  LER    +   AE+  K+LN  I +L ++K  L   I KE + + +AE++ K
Sbjct: 635  KMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLK 694

Query: 659  MLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETT----QAKISILQKEIE 714
            + + SL+L  ++ +   K+Y     ++ D+  +    ++E  +     Q+K++ L+ E++
Sbjct: 695  VSQGSLKLTKQENEELNKRYH----IIQDNLLKQDTKTQETLSCLIECQSKLATLESELK 750

Query: 715  SYK---QNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKE 771
            S     ++L    K N  ++ +L A       L ++L T++ E ++   L+ E E  YKE
Sbjct: 751  SSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGERDK---LLAETEKSYKE 807

Query: 772  HDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSL------TTTNDKLQVE 825
                 E    + + QL  K +E  DF    +S+  WYQ+++DSL       T+  + Q +
Sbjct: 808  KVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQ 867

Query: 826  LNKEL---TKINIQRLKISDLEK----TLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXXI 878
              ++L    K+   RLK  + +      L+Q  +  +    +  +              I
Sbjct: 868  TTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQI 927

Query: 879  NQYRDLLNLAEET----KNRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLL 934
             ++R     AEE      N  ++  N+  +   +  + +++L  Q+  L  + S++N+ L
Sbjct: 928  EEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNEL 987

Query: 935  QKQKAKCEDDQKIIQDKATETENLKNSLSSL----ENKITTLENEMVEKTKSFEEKENTY 990
              QK + + ++  ++++    ++ + +++S+    E ++  L  ++ ++     + +  Y
Sbjct: 988  GHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENY 1047

Query: 991  KEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQV 1050
            +++L + ++ S  I ++  E++ YK     L+++I   E  +     K L++K  +E Q+
Sbjct: 1048 EQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQL 1107

Query: 1051 DEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTD-ETVVNDTSDK-NELILALRRERD 1108
                + I++L     +Q G    +  +    + D + E   ++  +K  ELI +LRRERD
Sbjct: 1108 RSLNQRIEDLT----VQNG---LLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERD 1160

Query: 1109 GLDIKLDISQR-EVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLN 1167
             L  KL++S+R E  SLR ++E ++  L   ++    L++  S      ++H + ++QLN
Sbjct: 1161 ILQTKLEVSKRSETVSLR-KLEAIEQELSFAKEELSSLQALSSQNSIMADEHNKLLEQLN 1219

Query: 1168 ELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTL 1227
            +LN L+E+N  L+ ++++  +    +  +++ L+  + PL+ ++  LK S+  KD Q++L
Sbjct: 1220 QLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKDSQISL 1279

Query: 1228 LSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKK 1287
            +SEE  RWK RS++IL K +++D EEH KL EELS            N +L DRF RLKK
Sbjct: 1280 ISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKK 1339

Query: 1288 QAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEE-------RKRIQEVESQLKQ-KP 1339
            QA E+LDAAKA   +L+ E+    +A+S +E+ L +E       ++ +Q VES+ K    
Sbjct: 1340 QARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADST 1399

Query: 1340 DNPDVITALEKELSDSVENSKKIEEN---LQETVNSSLELNKKLTEE----VNSLKSQLE 1392
              P++ +AL+K LS + + ++ IE +   +++ + S LE  K   EE    ++  + ++E
Sbjct: 1400 TQPELESALQK-LSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRLDEARREVE 1458

Query: 1393 TLKNQNGVISVADGSAINSETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1452
            +L+       V  G+  +S  +  +K   E                              
Sbjct: 1459 SLEE------VKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYE 1512

Query: 1453 XXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIX 1512
                ++   G   P+DIE +K +WEE  E+  ++RI ++ E L+KRIRLP+EEKIN+++ 
Sbjct: 1513 KELEEN---GKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVE 1569

Query: 1513 XXXXXXXXXXXXXXXXQG------------LTTETAIXXXXXXXXXXXXXXXFDNELAEV 1560
                            +              T                     D E+A+V
Sbjct: 1570 TRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQV 1629

Query: 1561 KKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKIN 1620
            +KKAF EGKQQ+ MK+  LE+K++KLE+Q   S T        E    A  +   P++  
Sbjct: 1630 RKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGT--------EAVPSAPTSKNSPTEKP 1681

Query: 1621 LLPFSMSNTDDSIEKQVPQGE--KVLQINRRSLEPSFGSSNPFTLPTQNKPAFLFASNNH 1678
            +     S  +D++ +  P  E   + +I+  SL P    S P   P   + A        
Sbjct: 1682 VRILEASPLEDALSRNDPNKESLPIKKISLPSLTPEPQQSQPEEAPNGQQQATKTQLTEG 1741

Query: 1679 SQTKKQDGLPINKSPFQTTLFAPFSSKTTTPN 1710
            + T  QDGL   K   +    +P  SK T P+
Sbjct: 1742 NAT--QDGLTPTKRAIEVGNESP--SKRTKPD 1769

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  392 bits (1007), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 436/1568 (27%), Positives = 754/1568 (48%), Gaps = 153/1568 (9%)

Query: 205  SEMSNKFYTLKTSSSN---ELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDEL 261
            +E+ NK   +    SN   E++  +  + +LE    ++  EN A K+ N  +++ + ++ 
Sbjct: 208  TELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKS 267

Query: 262  FKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLKNXXXX---XXXXXXXXXXDRL 318
             K + L N  N  KE   +E++L Q   D+L+  ++ L++                 +R 
Sbjct: 268  SKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDYTRILNTKQPIVQNDEERN 327

Query: 319  LHELVDIKKSLEKSELENVHLNDFIEQ---YLTENEESTSDNE----LVLLKEQLIKEKR 371
            L E+ ++K+ L ++E     LN  +E+      + E ST  N+    L  +K++LI+E+ 
Sbjct: 328  L-EVEELKQKLIETE---TQLNKELEERRNITMQTESSTLSNQQQEDLDTIKKELIQERY 383

Query: 372  QKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTT 431
            QK+ LQ QVE+F++ELE ++PT+NS K R   LE+EL   T LLE   RE +    EL  
Sbjct: 384  QKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDA 443

Query: 432  ENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNS 491
              +  K        L  QR DLAHQ+Q++L++  ++      L+ +E+ F++ I+ + ++
Sbjct: 444  LRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESN 503

Query: 492  QNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLE------SSDTKSVQKITR 545
            +  SDSQ++ISERLV F +I  LQ++N++LL + R LA +LE       S ++ V++   
Sbjct: 504  EESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAI 563

Query: 546  NESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKKEEQLT 605
            +E+KE I  LQ     L  K++ L  E D YK  SL     +  TE LR  L ++   L 
Sbjct: 564  DEAKEAIISLQSYNTKLEDKIKTLNDELDCYK--SLPKPDTKVETEHLR--LNEENTDLI 619

Query: 606  KLERMSSLDSHLA---EEKAKV---LNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKM 659
            K      L++ LA   EE  K    LN  I  +++           E + R +AE++ K+
Sbjct: 620  K-----ELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKL 674

Query: 660  LEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYKQN 719
            +++SL L   + +   K+ E  + +    +    +  +E  + +  +S  Q E+ +Y Q+
Sbjct: 675  IQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNEL-NYIQS 733

Query: 720  LLQYSKDNENTL----SKLAAATQEKETLGSRLSTVKNELEQKINLMQ----------ER 765
             L  SK NE +L    + ++    E + L S+L +++ E EQ  N  +          ER
Sbjct: 734  QLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVER 793

Query: 766  ETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVE 825
            E Y      ISE+L        ++K +E+K+ E+ + S+I WYQ ++D++    D  Q E
Sbjct: 794  ELY-----DISEKL--------KNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDE 840

Query: 826  L---NKELTKINIQRLKIS-DLE---------KTLSQNTNGSSSLPRVDQDFXXXXXXXX 872
            L     E+ ++N +  K+  DL+         K L+ + N  + +  +  +         
Sbjct: 841  LLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLS 900

Query: 873  XXXXXINQYR-----------DLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLDQQLA 921
                 ++QY+           +  N  EETK    + +   ++  D+ ++ K  L +Q+ 
Sbjct: 901  EAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQIT 960

Query: 922  ELTQECSSMNSLLQKQKAKCEDDQKI---IQDKATETENLKNSLSSLENKITTLENEMVE 978
            +L  E    N      KA  E+  +I   + +   +  N++   +  E K++TL+N++ +
Sbjct: 961  DLNNELDHQN------KAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQ 1014

Query: 979  KTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQK 1038
            +       +N Y+++L K +E +  I ++  +   Y+  +D ++AN    E+ +    + 
Sbjct: 1015 QASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKL 1074

Query: 1039 LLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNE 1098
              +++ ++E Q+   K+ I++L+ Q  +   +   ++   ++ +  +  T   D      
Sbjct: 1075 WEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNED------ 1128

Query: 1099 LILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQ 1158
            L+L+LR +RD L  +L +++ E  +LR ++ ++   L  TR     +  +      + E+
Sbjct: 1129 LVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEE 1188

Query: 1159 HKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSI 1218
            H   + QLN+LN L+E+N  L+ +  ++ ++   +   LE L+ ++ PL+ +  RLK  I
Sbjct: 1189 HDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVI 1248

Query: 1219 MEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDL 1278
             E +QQL    EE  RWK RS++IL K +++D  EH KL  E++            NE+L
Sbjct: 1249 KENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEEL 1308

Query: 1279 NDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQK 1338
            NDRFNR+KKQAHE+L+++KA   +L  +I  L D  + ++  L+ ER  IQ  E + +Q 
Sbjct: 1309 NDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQM 1368

Query: 1339 PDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQN 1398
                + +TAL  +L +++ +SK+ E     +V SS E++  L + ++SL ++L  LK   
Sbjct: 1369 NKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESK 1428

Query: 1399 GVISVADGSAINSETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDS 1458
               +   G    S  +  +K+SFE                                  D+
Sbjct: 1429 NNEATVTGQPDLSNVVEEMKKSFE----EEKIKFVQDQTTEFKEKLAEEVKRIEAQATDT 1484

Query: 1459 KPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXXXX 1518
            +    +   DI   + +WE++ EEI+++RI  AEENLK+RIRLP+EEKIN VI       
Sbjct: 1485 QNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNEL 1544

Query: 1519 XXXXXXXXXXQG---LTTE--TAIXXXXXXXXXXXXXXXFDNELAEVKKKAFLEGKQQSQ 1573
                      +    L++E                     D EL   K KAF EGKQQ+ 
Sbjct: 1545 EKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAM 1604

Query: 1574 MKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSMSNTDDSI 1633
            MKTT LE+K+SKLESQ   S   +     K + E   KT   PS  N +P   S  ++++
Sbjct: 1605 MKTTFLEKKISKLESQLQGSNAAN---ENKNDVEVLLKT---PSDENNVP---SKQEETL 1655

Query: 1634 EKQVPQ-------------GEKVLQINR----RSLEPSFGSSNPFTLPTQ---------- 1666
             K  PQ             G   L +N+     SL+    SSNPFT P Q          
Sbjct: 1656 SK--PQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPA 1713

Query: 1667 -NKPAFLF 1673
              +PAFL 
Sbjct: 1714 VTQPAFLL 1721

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  377 bits (968), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 476/1761 (27%), Positives = 836/1761 (47%), Gaps = 194/1761 (11%)

Query: 7    LATSLEVTATDLETIEPTVLEKINAKLLSSEQ---EKDRLNATIDNFKSKMSSQFDTVKN 63
            +A+ LE+    L  +  TV  +I AK+   +Q   E  + + TID  +S  S +    K+
Sbjct: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80

Query: 64   XXXXXXXXXXXXXXXXXXXXSKCIQWEQQYAQHQDISKTDLASDDVIK-ENETFKRDHQL 122
                                ++ +Q EQ+ AQ     +  +   D ++  NE  ++  Q+
Sbjct: 81   QIHSLLQEIEAVR-------AENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQV 133

Query: 123  LTS---DLMNLSKKLSSCDAALEKKSTAYLE----LQNDNIDIRTQLNNFKSETKGLKSK 175
            L +   D+  L  +     A L++++   L+    L+  N+++  Q   +KSE   LK K
Sbjct: 134  LEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEE--LKHK 191

Query: 176  YERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQ 235
                  DF +L    S + T  E    +L++ +++F   +  + +EL +    L + E  
Sbjct: 192  A-----DFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGD 246

Query: 236  YELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEH 295
             +   +  K  +E+N +  + +  +    K L ++L   K+ FTREM+L Q   +LL+  
Sbjct: 247  LQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQ 306

Query: 296  IEYLK------NXXXXXXXXXXXXXXDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTE 349
            +  LK      N               ++  ELV   + LE+SEL+   L   +EQ L+ 
Sbjct: 307  VSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSA 366

Query: 350  NEESTSDNE--------LVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRN 401
            +E++ S ++        + +LK+Q+I E+RQK++LQ QVE FV+ELEN++P ++S KDRN
Sbjct: 367  DEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRN 426

Query: 402  QTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLL 461
              LE+EL +   +L+   ++ D    +L     ++++    I+ L  QR DLA QVQ+LL
Sbjct: 427  DVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLL 486

Query: 462  LNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMEL 521
            + + ++      L+ +E  F++K++   N+Q D D+Q IISERLV+F +I  LQ +N +L
Sbjct: 487  IQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADL 546

Query: 522  LTTTRNLAEQLES------SDTKSVQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDA 575
            L T RNLA QLE+      S T++++  T  E+KE I  LQ+ I  L ++++ + +E+DA
Sbjct: 547  LHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDA 606

Query: 576  YKLLSLQNTGEQTPTEELRSQLQKKEE----QLTKLERMSSLDSHLAEEKAKVLNQSIIK 631
            YK +  Q T  +     LR    K  E    ++ +LE + S     AE   K+L     +
Sbjct: 607  YKAIQSQ-TSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQE 665

Query: 632  LKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAE 691
            L + K +L   + KE S R +AE++ K+ + SL LL K+ +  + K      L+ ++N  
Sbjct: 666  LARSKSELVVNVEKEKSSRLLAEERLKISKSSL-LLTKQENEELNKR----GLVLENNL- 719

Query: 692  NIKHSRENETTQAKISILQKEIESYKQNLLQYSKDNENTLSK---LAAATQEKETLGSRL 748
                ++++  TQ  IS    E+   K  L   S + +N+++K   L  + Q+ +    +L
Sbjct: 720  ----AKQDTRTQETIS----ELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQL 771

Query: 749  STVKNELE----QKINLMQERETYYKEHD--------SISERLLKKSKIQLEDKIKEVKD 796
            +  +NEL     Q   L +ER+T  K+ D        S+ E  + + +  L  K  E+ D
Sbjct: 772  TKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSL-EAEISQLRTLLSQKATELSD 830

Query: 797  FEAKKNSQINWYQKRLDSL------TTTNDKLQVELNKEL-TKINIQRLKISDLE----- 844
            F +  +S+  WYQ+++D+L      TT++   + ++ +EL ++ ++   K+ D E     
Sbjct: 831  FMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQS 890

Query: 845  -KTLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXXINQYRDLLNLAEETKNRLQKDL--NK 901
               L+Q  +  +    +  +              +++Y+ L    +ET   +   L  +K
Sbjct: 891  YSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSK 950

Query: 902  QRQIVD--------DAMEGKEQ-LDQQLAELTQECSSMNSLLQKQKA---KCEDDQKIIQ 949
            Q   ++        DA+      L  QLA L  E     +LL+  K    KCE+      
Sbjct: 951  QDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEE------ 1004

Query: 950  DKATETENLKNSLSSLENK----ITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIE 1005
                E ++ K +L+S++++    ++ L  ++ ++     + +  Y+++L + ++ S  I 
Sbjct: 1005 ----EVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTIS 1060

Query: 1006 KMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIH 1065
            ++  E + +K  +  L+A+I   + ++         +K  +E Q     + I++L+ Q  
Sbjct: 1061 QLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNR 1120

Query: 1066 IQKGKRSFITSEGSTTSNDTDETVVND--TSDKNELILALRRERDGLDIKLDISQREVYS 1123
            +   + S           DTD   +ND   S+  ELI  L+RE D L  KL++++R+   
Sbjct: 1121 LLFDQISL---------KDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDES- 1170

Query: 1124 LREQVENLKNSLDETRQSFKGLESEVSGEMTTT-------EQHKEAVKQLNELNTLKETN 1176
                  NLK  L+ T Q     +SE+     T+       E++ + ++QLN++N L+E+N
Sbjct: 1171 ------NLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESN 1224

Query: 1177 EQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWK 1236
              L+ +L+   + N  +   +E L+  + PL++ +  L+ S+  KD+Q++L++EE  RWK
Sbjct: 1225 ITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWK 1284

Query: 1237 LRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAA 1296
             RS++IL+K ++VD EEH KL EELS              +L DRF RLKKQA E+LD A
Sbjct: 1285 QRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNA 1344

Query: 1297 KAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNP-DVITALEKELSDS 1355
            +    +L AE+T+  +++  LE  LD+ER++ + ++  +K   +N  +  +A   +L D+
Sbjct: 1345 RTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDA 1404

Query: 1356 VENSKKIEENLQETVNSSLELNKKLTEE-------VNSLKSQLETLKNQNGVISVADGSA 1408
            ++  +  +  + E   +  +  + L EE       V  L+  L   +N+  V+  A    
Sbjct: 1405 LQKLEDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQV 1464

Query: 1409 INSET-IAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEPI 1467
              +E  IA +K                                       S+    S   
Sbjct: 1465 SGTEAEIARVKTELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLASSESLKSS--- 1521

Query: 1468 DIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXXXXXXXXXXXXX 1527
            DIE +K EWEE+ E+  ++RI +A E L+KRIRLP+EEKIN++I                
Sbjct: 1522 DIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKII--ENRKRELDEEFEAK 1579

Query: 1528 XQGLTTETAIX--------------XXXXXXXXXXXXXXFDNELAEVKKKAFLEGKQQSQ 1573
             Q  T+E A                               D E+A+ KKKAF EGKQQ+ 
Sbjct: 1580 LQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQAS 1639

Query: 1574 MKTTLLERKLSKLESQA-------------SPSR------TPDLE-SSQKENTEGATKTT 1613
            MK+  LE+K++KLE+QA             SP R      +P  E S Q++ T  A +  
Sbjct: 1640 MKSMFLEKKIAKLEAQAKAAAEKPDDTTVNSPDRKQLDKPSPIAEISHQEDKTHIAEELA 1699

Query: 1614 LGPSKINLLPFSMSNTDDSIE 1634
             GP  I   P   S++ + I+
Sbjct: 1700 EGPRPITTSPIPPSSSGELID 1720

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  374 bits (960), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 401/1404 (28%), Positives = 721/1404 (51%), Gaps = 111/1404 (7%)

Query: 173  KSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSL 232
            KS+ ER+ ++     N   S K + E   KELS  + ++ + +  ++  +   ++ L+ +
Sbjct: 194  KSQLERRTQEL----NLLQSNKDWLE---KELSSKNQQYLSYRQKTNTIISEIRNDLNRI 246

Query: 233  EKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLL 292
               ++L    N   +++NNEL+  + ++L + K+L +  N  K  F+ E+TL Q   DLL
Sbjct: 247  RNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLL 306

Query: 293  KEHIEYLK-----------NXXXXXXXXXXXXXXDRLLHELVDIKKSLEKSELENVHLND 341
            +  +  +K           +              ++LL +L   K  L + E E + L+ 
Sbjct: 307  ESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSS 366

Query: 342  FIEQYLTENE--ESTSDNELVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKD 399
              E+   E+    S S+ + +LLK+QLIKEKR K++LQ Q+E F++ELE+++P +NS K+
Sbjct: 367  ITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKE 426

Query: 400  RNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQF 459
            R  TLE EL     LLE T  E + +IKEL  +N +L E  + I++L  QR+DL  Q+Q+
Sbjct: 427  RTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQY 486

Query: 460  LLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQN-DSDSQKIISERLVKFHDISVLQKQN 518
            LL+   +    +  L  +EI F++ I+++ +S   +SDSQKI++ERLV+F DI  LQ++N
Sbjct: 487  LLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKN 546

Query: 519  MELLTTTRNLAEQLESSDTKS------VQKITRNESKEKIAKLQESINGLTSKLEKLQKE 572
             ELL  TRNLA++LES++ KS      ++  T NE+KE I  LQ     L SK+ +L+KE
Sbjct: 547  SELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKE 606

Query: 573  KDAYKLLSL------QNTGEQTPTE---ELRSQLQKKEEQLTKLERMSSLDSHLAEEKAK 623
            ++ +K  ++       N+  Q  TE   EL SQ Q  + +++++ R S+       E   
Sbjct: 607  REKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTREST-------ENMS 659

Query: 624  VLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYET 683
            +LN+ +  L   K  L+  + +E S R +AE++ K+L ++L+L   + D   K+      
Sbjct: 660  LLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRS----- 714

Query: 684  LLNDHNAENIKHSRENET------TQAKISILQKEIESYK--QNL-LQYSKDNENTLSKL 734
             +N  NA + + S+  ET       ++K+S ++ E+ + K  + L ++  K+ +  LS+L
Sbjct: 715  -INLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSEL 773

Query: 735  AAATQEKETLGSRLSTVKNELEQKINLMQE-RETYYKEHDSI--SERLLKKSKIQLEDKI 791
            ++       + ++L T++ E E   NL+ E +++   + D++  ++  LK   I+   K 
Sbjct: 774  SSEKTSLHIMVTQLQTLQKERE---NLLDETKKSCQNKIDALQNAQNELKTEAIR---KD 827

Query: 792  KEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQNT 851
            + +K  E   +S+I WYQ ++++L   ++ +   LN++  ++   + +I  LEK + +N 
Sbjct: 828  QYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENK 887

Query: 852  NGSSSLPRVDQDFXXXXXXXXXXXXXIN------QYRDLLNLAEETKNRLQ--------- 896
                +   +D+               IN      Q ++   L E T   LQ         
Sbjct: 888  IRLHTYNVLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDES 947

Query: 897  -KDLNKQRQIVDD---AMEGKEQL-DQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDK 951
             K  + Q Q + D   ++E K  L  +Q++ L  E    N  ++K+KA+ +    I+Q+ 
Sbjct: 948  NKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNN 1007

Query: 952  ATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAEN 1011
              E E +K   +  E+K++ ++ ++ ++T      +N Y+++L K ++ S  I ++  + 
Sbjct: 1008 NKEIEAVK---TEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQL 1064

Query: 1012 KAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKR 1071
              YK  ++ L      +E A+         +K +   Q+D     I++L+ Q  +   + 
Sbjct: 1065 HTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQI 1124

Query: 1072 SFITSEGSTTSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENL 1131
               T+ G+  ++    +V+N     N++++ LRRERD LD K+ +++R+   LR+++  +
Sbjct: 1125 ELYTTTGNKPTDAKSGSVLN-----NDILITLRRERDILDTKVAVAERDAKMLRQKISLI 1179

Query: 1132 KNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENN 1191
               L E R      + E        +QH E +++LN+LN L+E+N  L+ +L  ++ +N 
Sbjct: 1180 DVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNK 1239

Query: 1192 IIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDL 1251
             + ++LE L+  + P++ ++  LK SI EK+Q++ L  EE  RWK RS++I+ K QQ+  
Sbjct: 1240 ELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSS 1299

Query: 1252 EEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLI 1311
             ++ KL  E+               D  ++FNRL++QA EKL A+K    S   ++ +L 
Sbjct: 1300 TDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELK 1359

Query: 1312 DAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVN 1371
            DAK  LE  L+    RIQE+E    +  +N + ++ ++K   D+ ENSK++E  L+E   
Sbjct: 1360 DAKLALEKSLNNANARIQELED--AKVAENRNQLSMIKKLQEDTEENSKELETKLEENAI 1417

Query: 1372 SSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAIN--SETIAHLKESFEVXXXXXX 1429
            S     KKL EE+  LK +LE  +        A G+  +  S+ +  +K SFE       
Sbjct: 1418 SYDSTVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMKRSFE------- 1470

Query: 1430 XXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEP--IDIEKMKSEWEEKQEEIIMQR 1487
                                             G +P  I+I+++K +WE +  E + ++
Sbjct: 1471 ---EDKIKFIEEKTREVNQKIREFQEAQEAEETGLKPSNINIDEIKKQWEAEHNEEVSKK 1527

Query: 1488 IADAEENLKKRIRLPSEEKINRVI 1511
            I +AEE LKKRIRLP+EEKI+++I
Sbjct: 1528 IREAEEALKKRIRLPTEEKISKII 1551

 Score = 63.9 bits (154), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 67/118 (56%), Gaps = 12/118 (10%)

Query: 1553 FDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATK- 1611
            F++EL  +KKK+F EGKQQ+ MKTTLLERKL+K+ESQ S +         K++ +   K 
Sbjct: 1639 FNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSET---------KQSVDSPPKH 1689

Query: 1612 TTLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKP 1669
             +  P+ +  LP  +    +     +  GEK+L+    S   S G  NPFT P+ NKP
Sbjct: 1690 LSKMPNPLLGLPRKIEENSNPPYNPLLSGEKLLK--LNSKSSSSGGFNPFTSPSPNKP 1745

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  358 bits (918), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 355/1245 (28%), Positives = 641/1245 (51%), Gaps = 104/1245 (8%)

Query: 150  ELQNDNIDIRTQLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSN 209
            EL+  +ID+   +  +KS+    KS+ +R       L    + +K+  +   KEL   + 
Sbjct: 165  ELRKSSIDLEFIIQGYKSQELREKSEIQR-------LHQELNLVKSNADWLSKELESKNE 217

Query: 210  KFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLEN 269
            +  + +  +++EL+N  + ++SL+ Q E     N   K +  EL+  + ++L + K L +
Sbjct: 218  QLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLAD 277

Query: 270  DLNELKESFTREMTLTQHENDLLKEHIEYLKN-----XXXXXXXXXXXXXXDRLLHELVD 324
             LN  KE FTREM+L Q   DLL+  +  +K+                   D+LL EL+D
Sbjct: 278  VLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELID 337

Query: 325  IKKSLEKSELENVHLNDFIEQYLTENEES--------TSD--------------NELVLL 362
             KK+LE ++ EN+ L   + + L+ N ++         SD               ++ +L
Sbjct: 338  TKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGIL 397

Query: 363  KEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERES 422
            K+QL++E+RQK+ LQ QVE FV+ELE+++P +NS K+R   LE+EL  +T LLE T ++ 
Sbjct: 398  KKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQR 457

Query: 423  DIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFL 482
            D +  EL     ++      +  L+ QR DLAHQVQ+LL+ L ++      LT  E+ F+
Sbjct: 458  DQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFV 517

Query: 483  RKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKS--- 539
            ++II S +    SD+Q IISERLV+F  +  LQ +N ELL T R LA++LE  + KS   
Sbjct: 518  KRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFR 577

Query: 540  ---VQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQN-TGEQTPTEELRS 595
               V+  T  E+KE I  LQE +  L  +L+ + KE+DA+KL +  N  G+  P+   +S
Sbjct: 578  LKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQS 637

Query: 596  QLQKKEEQLTKLE-RMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAE 654
            +  K +E + +LE R+ +L +  +++  K+LN  I  L K K ++   + +E S + +AE
Sbjct: 638  K--KLDEHIMELEKRLKNL-AEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAE 694

Query: 655  KKSKMLEDSLEL-------LHKKYD----LAVKKYEHYETLLNDHNAENIKHSRENETTQ 703
            ++ K+++ +L L       LHK+ D    + +K+ E  ++ +++  A   K    N T+ 
Sbjct: 695  ERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIA--TKSQLSNLTS- 751

Query: 704  AKISILQKEIESYKQNLLQYSKDNE-----NTLSKLAAATQEKETLGSRLSTVKNELEQK 758
             K++IL  E +  ++   +   +NE     NT SK+         L S+L T++ E   +
Sbjct: 752  -KLAILTSERDFLRKIEAELKNENEALTKENTTSKI---------LVSQLQTLQRE---R 798

Query: 759  INLMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTT 818
              L++E +T Y+++    E  L +++  L  + +E ++      SQ  W+Q ++DSL   
Sbjct: 799  DILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQ 858

Query: 819  NDKLQVELNKELTKINIQRLKISDLEKTLSQ---NTNGSSSLPRVD----------QDFX 865
             D  +  L ++   I   +L    L   L +    T   S L   D          ++  
Sbjct: 859  LDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIETLRKNLE 918

Query: 866  XXXXXXXXXXXXINQYRDLLNLAEETKNRLQKDL-----NKQRQIVDDAMEGKEQLDQQL 920
                        I QY+ +  ++E++   + K L     N ++ I     E K  L  Q+
Sbjct: 919  KANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERK-SLTDQI 977

Query: 921  AELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSL----ENKITTLENEM 976
            A L  +   +NS L  QK++ + ++  +  K +  +  + SL  L    E KI+ L+ ++
Sbjct: 978  ALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDL 1037

Query: 977  VEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYR 1036
             ++     + +  Y+++L K ++ +  I  +  E++ YK+ ++G K + +  + A+    
Sbjct: 1038 TQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKSALERNE 1097

Query: 1037 QKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDK 1096
            Q    +  + E Q+   ++  + LN Q  +   +   ++     TS+D+ E   + +++ 
Sbjct: 1098 QSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSK---ATSSDS-EAAASMSAES 1153

Query: 1097 NELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTT 1156
             ELI+ LRRERD L+ KLD+S RE   LR+++   K  L+  R  F   ++     +   
Sbjct: 1154 RELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPDSIFAR 1213

Query: 1157 EQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKN 1216
            E  ++ +++LN+LN L+E+N  L+ + ++  +++     ++  L+ ++ PL+ +++ L  
Sbjct: 1214 ESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQLKSLTI 1273

Query: 1217 SIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNE 1276
            +I E+DQQ++LL EE+ RWK RS++IL K +++D  EH KL +E++            N 
Sbjct: 1274 TISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNELEKKSLENL 1333

Query: 1277 DLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDL 1321
            +  +RF +L+KQA+E+LD  KA  A + +E   +  AK++LE +L
Sbjct: 1334 ESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAEL 1378

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 112/252 (44%), Gaps = 36/252 (14%)

Query: 1461 TGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXXXXXX 1520
            T  +  ID E +KS+ E + E+  ++RI +AEE LKKRIRLPSEE+IN+VI         
Sbjct: 1528 TPNAPLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQ 1587

Query: 1521 XXXXXXXXQGL----------TTETAIXXXXXXXXXXXXXXXFDNELAEVKKKAFLEGKQ 1570
                    + L            +TA                FD +LA V+KKAF EGKQ
Sbjct: 1588 EFELRVRARALELFKENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQ 1647

Query: 1571 QSQMKTTLLERKLSKLESQAS--------PSRTPDLESSQKENTEGATKTTLGPSKINLL 1622
            Q  MK  LLE K++KLE Q +        PS+ P ++++   + +GA    + PS     
Sbjct: 1648 QLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIP-IDNNNNSSPQGAQPIAIKPS----- 1701

Query: 1623 PFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKPAFLFASNNHSQT- 1681
            PF           QV  G+ +   +  S + S   S  F   T +        N  + T 
Sbjct: 1702 PF-----------QVAFGKAMENTSFGSFKGSLLDSKQFIANTADTSTSTLTGNVGTNTN 1750

Query: 1682 KKQDGLPINKSP 1693
            K+Q    + +SP
Sbjct: 1751 KRQSEDELAQSP 1762

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  352 bits (902), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 391/1418 (27%), Positives = 735/1418 (51%), Gaps = 116/1418 (8%)

Query: 156  IDIRTQLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLK 215
            ID+ T+  +  +     +++ ERK ++     N   S   + E   KEL   + ++ + +
Sbjct: 177  IDLETKQQDLITSDLNSRAELERKAQEL----NILQSTNDWLE---KELCSKNEQYLSYR 229

Query: 216  TSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELK 275
              +   +   ++ L+ L   +++   +N    ++N+EL+ ++ ++L + KSL + L+  K
Sbjct: 230  KKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEK 289

Query: 276  ESFTREMTLTQHENDLL-------KEHIEYLKNXXXXXXXXXXXXXXDRLLHELVDIKKS 328
            + F+ E+ L Q   DLL       KE ++  +               + L+ EL   K+ 
Sbjct: 290  QEFSTEINLKQRLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEE 349

Query: 329  LEKSELENVHLNDFIEQYLTENEESTSDN--ELVLLKEQLIKEKRQKDYLQEQVELFVIE 386
            L + + E + L+  I +   E+  STS +  + +LLK+QLIKEKR K++LQ Q+E F++E
Sbjct: 350  LAQCKSECIRLSSIIGETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILE 409

Query: 387  LENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVL 446
            LE+++P +NS K+R  TLE EL     LLE T  E + +I+EL+ ++ +LK+   +I  L
Sbjct: 410  LEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTL 469

Query: 447  MSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKS-RNSQNDSDSQKIISERL 505
            + QR+DL  QVQ+LL+   + K  +  L  +EI F++ I+++  ++  ++DSQKI++ERL
Sbjct: 470  IKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERL 529

Query: 506  VKFHDISVLQKQNMELLTTTRNLAEQLESSDT---KSVQKI---TRNESKEKIAKLQESI 559
            V+F  I  LQ++N ELL   RNLA++LES++    +S+QKI   T NE+KE I  L+   
Sbjct: 530  VEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEK 589

Query: 560  NGLTSKLEKLQKEKDAYK-LLSLQNTGEQTPT--------EELRSQLQKKEEQLTKLERM 610
              L SK+E+L+KE +  K LLS + T     T          L  Q+Q  +  ++++ R 
Sbjct: 590  EQLESKVEELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRE 649

Query: 611  SSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKK 670
            S+       E   +LN+ I  L   K D++  + KE S R +AE++ K+L ++L+L   +
Sbjct: 650  ST-------ENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAE 702

Query: 671  YDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYK--QNLLQYSKDN- 727
             D   K+++  ++ +   +++  +   E  + ++K++I + E+ + K  Q L   S+ N 
Sbjct: 703  NDQLRKRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNL 762

Query: 728  ENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQE-RETYYKEHDSISERLLKKSKIQ 786
            +  + KL++       + ++L T++ E E   NL+ E R++Y  + D + E    + K +
Sbjct: 763  KQEMQKLSSEKTGLRIMVTQLQTLQKERE---NLLDETRKSYQNKIDEL-EHAHNELKGE 818

Query: 787  LEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKT 846
               K + +K  E   NS I WYQ +++ L   N+ +   +N +  +I   + K+  LEK 
Sbjct: 819  ASHKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKE 878

Query: 847  LSQN---------TNGSSSLPRVDQDFXXXXXXXXXXXXXINQYRDLLNLAEETKNRLQ- 896
            + +N          +G+ +   + ++              I +Y++L     ++  ++  
Sbjct: 879  IDENKIRLHTYNVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHS 938

Query: 897  ------KDL-NKQRQIVDDAMEGKEQ---LDQQLAELTQECSSMNSLLQKQKAKCEDDQK 946
                  KD  N+ + + ++    +E+   L +Q+  L  E    N  ++++KA+      
Sbjct: 939  KFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKIS 998

Query: 947  IIQDKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEK 1006
            I+Q+   E E +K   S  E+K++ ++ ++ ++T      +N Y+++L K ++ S  I +
Sbjct: 999  ILQNNNKEVEAVK---SEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISE 1055

Query: 1007 MEAENKAYKT-------SLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDN 1059
            +  +   Y+        S + L++ +   E + ++ R+ L++       Q++     I++
Sbjct: 1056 LREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIE-------QLESSNSRIED 1108

Query: 1060 LNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDK---NELILALRRERDGLDIKLDI 1116
            L  Q      K  +   E  TT++      V DT+DK   N ++L+LRRERD LD K+ +
Sbjct: 1109 LTSQ-----NKLLYDQIELYTTADKG----VTDTNDKPALNSILLSLRRERDILDTKVTV 1159

Query: 1117 SQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETN 1176
            ++R+   LR+++  +   L E R        E     T  +QH++ +++LN+LN L+E+N
Sbjct: 1160 AERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESN 1219

Query: 1177 EQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWK 1236
              L+ +L  N++E  ++ ++L+ LK ++ P++ ++  LK S+ EK+Q+L L  EE  RWK
Sbjct: 1220 ITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWK 1279

Query: 1237 LRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAA 1296
             RS++IL K +Q+   ++ KL  E+               +  +RFNRL++QA E+L  +
Sbjct: 1280 KRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLKTS 1339

Query: 1297 KAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNP-DVITALEKELSDS 1355
            K    +LT ++ DL +AK KLE  LD+   +I+E+E+   ++ +N  D I  L+++  +S
Sbjct: 1340 KLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQDAENS 1399

Query: 1356 VENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAIN--SET 1413
               SK+ +  L+E         KKL EE+ +L+ ++E  +     +     +  N  S+ 
Sbjct: 1400 ---SKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKI 1456

Query: 1414 IAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEPIDIEKMK 1473
            +  +K++FE                                   ++P+     I+I+++K
Sbjct: 1457 VESMKKTFEEDKINFIREKTKEVNEKILEAQERL----------NQPSN----INIDELK 1502

Query: 1474 SEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511
             +W+ + EE ++ RI +AEE LKKRIRLP+EEKI+++I
Sbjct: 1503 IKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKII 1540

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 75/159 (47%), Gaps = 22/159 (13%)

Query: 1553 FDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKT 1612
             DNEL  +KKK+F EGKQQ+ MKTTLLERKL+K+ESQ S   T  +  S  ++       
Sbjct: 1624 LDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSE--TKKITESPSKHVNHTQNQ 1681

Query: 1613 TLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKPAFL 1672
             LG      LP  +     S    +  GEK+L+    S   S G  NPFT P+ NK +  
Sbjct: 1682 LLG------LPRKIEENSSSSFNPLLSGEKLLK--LNSKSSSSGGFNPFTSPSPNKSS-- 1731

Query: 1673 FASNNHSQTKKQDGLPINKSPFQTTLFAPFSSKTTTPNG 1711
                   +   Q  L  NK+   T L   F+     P G
Sbjct: 1732 ------QKVDDQRELTTNKADPPTHLTPSFN----IPAG 1760

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  340 bits (872), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 376/1376 (27%), Positives = 698/1376 (50%), Gaps = 113/1376 (8%)

Query: 202  KELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDEL 261
            KEL   + ++ + +  +   + + ++ L+ L   +++    N   K++NNEL+ ++ ++L
Sbjct: 216  KELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKL 275

Query: 262  FKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLKN-----------XXXXXXXXX 310
             + K L + LN  K+ F+ EM+L Q   DLL+  +  +K                     
Sbjct: 276  LEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKK 335

Query: 311  XXXXXDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTENE--ESTSDNELVLLKEQLIK 368
                 + LL EL   K+ L + E E + L+   ++   +NE   + S ++ + LK+QLIK
Sbjct: 336  QTPENEDLLKELQLTKEKLAQCEKECLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIK 395

Query: 369  EKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKE 428
            E+R K++LQ Q+E F++ELE+++P +NS K+R   LE EL     LLE T  E + ++KE
Sbjct: 396  ERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKE 455

Query: 429  LTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKS 488
            L  +N++L E   ++  L  QR+DL  Q+Q+LL+   +    +  L  +EI F++ I++ 
Sbjct: 456  LNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQE 515

Query: 489  RNSQ-NDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDT---KSVQKI- 543
             +S   +SDSQK+++ERLV+F +I  LQ++N ELL   RNLA++LES +    +S+QKI 
Sbjct: 516  DDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIE 575

Query: 544  --TRNESKEKIAKLQESINGLTSKLEK-----------LQKEKDAYKLLSLQNTGEQTPT 590
              T NE+KE I  L+     L S++E+           +  E  +Y  ++++   E    
Sbjct: 576  SETVNEAKEAIITLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQLTE--TK 633

Query: 591  EELRSQLQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQR 650
             +L SQ+Q  + +++++ R S+       E   +LN+ I  L   K D++  + KE S R
Sbjct: 634  RDLESQVQDLQTRISQITREST-------ENMSLLNKEIQDLYDSKSDISIKLGKEKSSR 686

Query: 651  AIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQ 710
             +AE++ K+L ++L+L   + D   K++++ +  +   +++  +   E  + ++K+SI++
Sbjct: 687  ILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVE 746

Query: 711  KEIESYK--QNL-LQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQE-RE 766
             E+ + K  Q L +   K+ +  L+KL+        + ++L T++ E E   +L++E R+
Sbjct: 747  TELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKERE---DLLEETRK 803

Query: 767  TYYKEHDSISERL--LKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQV 824
            +  K+ D + + L  LKK   Q   K   +K  E   NS I WYQ ++++L    + +  
Sbjct: 804  SCQKKIDELEDALSELKKETSQ---KDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVIT 860

Query: 825  ELNKELTKINIQRLKISDLEKTLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXXIN----- 879
             ++ + T I   + K+  LEK + ++     +   +D+               IN     
Sbjct: 861  SVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETINDDSLRKELEKSKINLTDAY 920

Query: 880  -QYRDLLNLAEETKNRLQ----------KDLNKQRQIVDD---AMEGK-EQLDQQLAELT 924
             Q ++  +L E T   LQ          KD   Q + + D   ++E K   L +Q+  L 
Sbjct: 921  SQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLN 980

Query: 925  QECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLENEMVEKTKSFE 984
             E       ++K+KA  +    I+Q+   E E +K   S  E+K++ ++N++ ++T    
Sbjct: 981  NELDLQKKGMEKEKADFKKRISILQNNNKEVEAVK---SEYESKLSKIQNDLDQQTIYAN 1037

Query: 985  EKENTYKEQLHKLSESSTLIEKMEAENKAYKT-------SLDGLKANIAAYEDAISAYRQ 1037
              +N Y+++L K ++ S  I ++  +   YK        S D L+  +   E + S+ ++
Sbjct: 1038 TAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKE 1097

Query: 1038 KLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKN 1097
             LL+       Q+D     I++L+ Q  +   +    T+     +N T+   +N+     
Sbjct: 1098 SLLE-------QLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNN----- 1145

Query: 1098 ELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTE 1157
             +++ LRRERD LD K+ +++R+   LR+++  +   L + R        E     +  +
Sbjct: 1146 -ILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQ 1204

Query: 1158 QHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNS 1217
            QH + +++LN+LN L+E+N  L+ +L  N+ +   + ++L+ LK  + P++ ++  LK S
Sbjct: 1205 QHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYS 1264

Query: 1218 IMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNED 1277
            + EK+Q+L L  EE  RWK RS++IL K +Q+   ++ KL  E+               +
Sbjct: 1265 MQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAE 1324

Query: 1278 LNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQ 1337
              ++FNRL++QA E+L  +K    SLT ++  L DAK+ LE  L E   RI+E+++    
Sbjct: 1325 AEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVA 1384

Query: 1338 KPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQ 1397
            + +N   + A+ K   D+ + S++++  L+E+  S       L EE+ +LK ++E  +  
Sbjct: 1385 QGNNQ--LEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQI 1442

Query: 1398 NGVISVADGSAIN--SETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY 1455
               +     +  N  S  +  +K+SFE                                 
Sbjct: 1443 QQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERL-------- 1494

Query: 1456 YDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511
              ++P+     I++E++K +WE + E+ + Q+I +AEE LKKRIRLP+EEKIN++I
Sbjct: 1495 --NQPSN----INMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKII 1544

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 67/116 (57%), Gaps = 11/116 (9%)

Query: 1553 FDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKT 1612
            F+NEL  +KKK+F EGKQQ+ MKTTLLERKL+K+ESQ S ++      S  ++       
Sbjct: 1632 FNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQS--AESPPKSVNNVQNP 1689

Query: 1613 TLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNK 1668
             LG      LP  +    +S    +  GEK+L++N +S   S G  NPFT P+ NK
Sbjct: 1690 LLG------LPRKIEENSNSPFNPLLSGEKLLKLNSKS---SSGGFNPFTSPSPNK 1736

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  335 bits (860), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 346/1246 (27%), Positives = 623/1246 (50%), Gaps = 98/1246 (7%)

Query: 173  KSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSL 232
            +S+  R+  + + L+   + +++  E +  +L+E + +  + +  ++ E+++ +  L+ +
Sbjct: 178  RSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIV 237

Query: 233  EKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLL 292
            + + E+      A + +N EL+  + D L + K L + L+  K+ F REM L Q   +LL
Sbjct: 238  KNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELL 297

Query: 293  KEHIEYLKNX-----XXXXXXXXXXXXXDRLLHELVDIKKSLEKSELENVHLNDFIEQYL 347
               +  +K                    +RLL++L D KK LE S+     L D I++ L
Sbjct: 298  NGQVATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELL 357

Query: 348  -TENEESTSDN---------------------ELVLLKEQLIKEKRQKDYLQEQVELFVI 385
             T+N +S   N                     +L  L++QL++E+R K+ LQ QVE FV+
Sbjct: 358  ETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVV 417

Query: 386  ELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINV 445
            ELE+++P +NS K R + LE++L  +T LLE T RE D ++ ++     ++ +    +  
Sbjct: 418  ELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGH 477

Query: 446  LMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERL 505
            L+ QR DLA QVQ LL+++ ++      LT +E+ F++K+   R+S   SD+Q IIS RL
Sbjct: 478  LVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRL 537

Query: 506  VKFHDISVLQKQNMELLTTTRNLAEQLES------SDTKSVQKITRNESKEKIAKLQESI 559
            V+F  +  LQ++N ELL   R LA++LE       S  KS+++ T NE+KE I  LQE +
Sbjct: 538  VEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHV 597

Query: 560  NGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKKE--EQLTKLERMSSLDSHL 617
              L  +LE +  E+D++KLL  +      P     + LQ +E  + +  LE      +  
Sbjct: 598  QMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEE 657

Query: 618  AEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKK 677
            +E+ AK+LN+ I  L K    L   + +E S R +A++K  +++ SLEL+  +      +
Sbjct: 658  SEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNR 717

Query: 678  YEHYETLLNDHNA-------ENIKHSRENETTQAKISILQKEIESYKQNLLQYSKDNENT 730
                + LL + +        E +    E  +  ++++ILQ E +  ++      K+NE+ 
Sbjct: 718  AGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENES- 776

Query: 731  LSKLAAATQEKETLGSRLSTVKNELEQKINLMQER-ETYYKEHDSISERLLKKSKIQLED 789
               L     + + L  +L T + E +  I   ++R ET  +E D      L  +K QLE 
Sbjct: 777  ---LNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGE----LSATKQQLER 829

Query: 790  KIKEVKDFEAKKNSQINWYQKRLDSL--------------TTTNDKLQVELNKELTKINI 835
            K +E  +  +  ++Q  W+Q +LDSL              T+  D L+  LN   +K+  
Sbjct: 830  KQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKL-- 887

Query: 836  QRLKISDLEKTLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXXINQYRDLLNLAEE---TK 892
            +   +   + +L   ++ +S +  + +D              I +Y+   N  E    + 
Sbjct: 888  EPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSY 947

Query: 893  NRLQ--KDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQD 950
            N +Q  KD +KQ  I  +A   K  L+  +A        +   L +++A    ++  +Q+
Sbjct: 948  NAVQDNKDGSKQAAISLEAELTK--LNSDIAMANDRIKVLEDELNRREATYSTERSELQE 1005

Query: 951  K----ATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEK 1006
            K     T+ + ++ + +  + KIT L+ ++ ++  S  E E  Y+  L K +E S  IE 
Sbjct: 1006 KINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIES 1065

Query: 1007 MEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHI 1066
            +   +++YK+ +   K+        +    Q    +K + E  +D   + I+ L+ Q   
Sbjct: 1066 LRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQ--- 1122

Query: 1067 QKGKRSFITSEGSTTSNDTDETVVNDT---SDKNELILALRRERDGLDIKLDISQREVYS 1123
                   +  +    S     ++  DT   SD  ELI+ LRRERD L+ K+D+S+RE   
Sbjct: 1123 ----NRLLYDQIELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKM 1178

Query: 1124 LREQVENLKNSLDETRQSF---KGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQ 1180
            LR+++E  K+ LD  R      KGL   V+    +++  +E  ++LN+LN L+E N  L+
Sbjct: 1179 LRQRLELTKSELDNLRAQLSESKGL---VTEGTDSSQNQEELFEKLNQLNLLREHNMSLR 1235

Query: 1181 QKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSR 1240
             +  +  + N  +  ++  L+ ++ P++++++ L  ++ EK+Q+L LL EE++RWK RS+
Sbjct: 1236 NESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQ 1295

Query: 1241 EILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAAKAQN 1300
            +IL K +++D EE+ KL  E+             + D  +RF +L+KQA+E+LD  KA  
Sbjct: 1296 DILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAK 1355

Query: 1301 ASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKP----DNP 1342
            A + +E+   +  KS+LE  L E R++I  +E+QL ++P    DNP
Sbjct: 1356 AKVESELELALSGKSQLEAKLSEAREKITSLETQLTERPASEDDNP 1401

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 87/182 (47%), Gaps = 33/182 (18%)

Query: 1468 DIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXXXXXXXXXXXXX 1527
            ++E +K +WEE+ E+  +QRI +AEE LKKRIRLPSEE+IN+VI                
Sbjct: 1531 NLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVN 1590

Query: 1528 XQGLT----TETAIXXXXX----------XXXXXXXXXXFDNELAEVKKKAFLEGKQQSQ 1573
               L        +I                         F+ +L +VKKKAF EG+QQ  
Sbjct: 1591 ATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGI 1650

Query: 1574 MKTTLLERKLSKLESQAS-------PSRTPDLESSQKENTEG-ATKTTLGPSKINLLPFS 1625
            MK  LLE K+SKLESQA        P++ P       ENT+  A +  + PS     PF 
Sbjct: 1651 MKVKLLESKISKLESQAKAPLGTNVPTKIP------LENTQPLAQQVPVKPS-----PFQ 1699

Query: 1626 MS 1627
            ++
Sbjct: 1700 LA 1701

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  330 bits (847), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 384/1394 (27%), Positives = 710/1394 (50%), Gaps = 97/1394 (6%)

Query: 173  KSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSL 232
            +S+ ERK ++     N   S K + E   KELS  S ++ + +  +   +   +  L+ L
Sbjct: 194  RSELERKTQEL----NLLQSNKDWLE---KELSSKSEQYLSYRQRTDATISEIRSELNRL 246

Query: 233  EKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLL 292
            +  ++L    N   K++NNEL+ ++ +++   K+L + LN  K+ F+ E+ L Q   DLL
Sbjct: 247  KNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLL 306

Query: 293  KEHI----EYLKNXXXXXXXXXXXXXXDRLLHE----LVDI---KKSLEKSELENVHLND 341
            +  +    E LK+               +L+ E    L D+   K+ L + E E + L+ 
Sbjct: 307  ETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSS 366

Query: 342  FIEQYLTENEE--STSDNELVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKD 399
              E+   E+    S S  + +LLK+Q IKEKR K+ LQ Q+E F++ELE+++P +NS K+
Sbjct: 367  ITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKE 426

Query: 400  RNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQF 459
            R   LE EL     LLE T  E + +I+EL  +N ++ +   +I++L  QR+DL  QVQ+
Sbjct: 427  RTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQY 486

Query: 460  LLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQN-DSDSQKIISERLVKFHDISVLQKQN 518
            LL+   +    +  L  +EI F++ I+++ NS   +SDSQKI++ RLV+F ++  LQ++N
Sbjct: 487  LLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKN 546

Query: 519  MELLTTTRNLAEQLESSDTKSVQKI------TRNESKEKIAKLQESINGLTSKLEKLQKE 572
             ELL  TRNLA++LES++ KS Q +      T NE+KE I  LQ     L SK+E+L++E
Sbjct: 547  TELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELERE 606

Query: 573  KDAYK------LLSLQNTGEQTPTE---ELRSQLQKKEEQLTKLERMSSLDSHLAEEKAK 623
            ++  K        S  N+  Q  T+   EL SQ+Q  + +++++ R S+ +  L      
Sbjct: 607  RETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL------ 660

Query: 624  VLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYET 683
             LN+ I  +   K D++  + KE S R +AE++ K+L ++L+L   + D   K+ +  ++
Sbjct: 661  -LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQS 719

Query: 684  LLNDHNAENIKHSRENETTQAKISILQKEIESYK--QNL-LQYSKDNENTLSKLAAATQE 740
             ++  +++  +   E  + ++K+S+ +  + + K  Q L +   K  +  L KL++    
Sbjct: 720  SISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTS 779

Query: 741  KETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAK 800
               + ++L T++ E E   +L+ E     +   +  E    + K++   K + +   E  
Sbjct: 780  LRIMVTQLQTLQKERE---DLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEED 836

Query: 801  KNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQNTNGSSSLPRV 860
              S+I WYQ ++++L   ND +   +N++ T+I   + K+  LEK + +N     +   +
Sbjct: 837  NTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVM 896

Query: 861  DQDFXXXXXXXXXXXXXIN------QYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEGKE 914
            D+               IN      Q ++   L E T   L +++N +    ++A   + 
Sbjct: 897  DETINDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSL-REMNSKLDESNEAFSNQI 955

Query: 915  Q--------LDQQLAELTQECSSMNSLLQKQKAKCEDDQ-------KIIQDKATETENLK 959
            Q        L+ +++ L ++  ++N+ L  QK + E  +        I+Q+   E E +K
Sbjct: 956  QSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVK 1015

Query: 960  NSLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLD 1019
               S  E+K++ +++++ ++T      +N Y+++L K ++ S  I ++  +   Y+  + 
Sbjct: 1016 ---SEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVK 1072

Query: 1020 GLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGS 1079
             L  + +  E+ +    +    +K +   Q+D     I++L+ Q  +   +    T+ G+
Sbjct: 1073 TLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGN 1132

Query: 1080 TTSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETR 1139
               +  +   +N     N++++ LRRERD LD K+ +++R+   LR+++  +   L + R
Sbjct: 1133 GVGDARNGPTLN-----NDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDAR 1187

Query: 1140 QSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLEL 1199
                    E     +  +QH   +++LN+LN L+E+N  L+ +L    K+N  + ++L  
Sbjct: 1188 TKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVK 1247

Query: 1200 LKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLME 1259
            LK  + P++ ++  LK S+ EK+Q++ L  EE  RWK RS++IL K QQ+   ++ KL  
Sbjct: 1248 LKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLES 1307

Query: 1260 ELSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEI 1319
            E+               +  +RFNRL++QA EKL  +K    +LT ++ +L DAK  LE 
Sbjct: 1308 EVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALER 1367

Query: 1320 DLDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKK 1379
             L++   RIQE+E +   + +N   +    +E  D+ ++S+++EE L+E   S     +K
Sbjct: 1368 SLNDANTRIQELEGEKVAEDNNRSEMIKRSQE--DAEKSSRELEEKLEENAISYSSTVRK 1425

Query: 1380 LTEEVNSLKSQLETLKNQNGVISVADGSAIN--SETIAHLKESFEVXXXXXXXXXXXXXX 1437
            L EE+ +LK ++E        +  A G      S  +  +K+SFE               
Sbjct: 1426 LNEEIATLKEEIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVN 1485

Query: 1438 XXXXXXXXXXXXXXXXXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKK 1497
                                ++P+     ++I++MK +WE + EE + +R+ +AEE LKK
Sbjct: 1486 KKIQEAQERL----------NQPSS----VNIDEMKKQWEAEHEEEVAERVREAEEALKK 1531

Query: 1498 RIRLPSEEKINRVI 1511
            RIRLP+EEKI+++I
Sbjct: 1532 RIRLPTEEKISKII 1545

 Score = 70.5 bits (171), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 66/117 (56%), Gaps = 12/117 (10%)

Query: 1553 FDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKT 1612
             ++EL  VKKK+F EGKQQ+ MKTTLLERKL+K+ESQ S           K++ E   K 
Sbjct: 1633 LNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEI---------KQSAESPPKH 1683

Query: 1613 TLG-PSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNK 1668
                P+ +  LP  +    +S    +  GEK+L+ N +S   S G+ NPFT P+  K
Sbjct: 1684 ANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNSKS--SSSGAFNPFTSPSPKK 1738

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  327 bits (837), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 409/1538 (26%), Positives = 750/1538 (48%), Gaps = 161/1538 (10%)

Query: 214  LKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNE 273
             + S+ +EL++++  + ++E + E+    N+  K+  + L   +  +L + K ++++ N 
Sbjct: 214  FRESTISELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNF 273

Query: 274  LKESFTREMTLTQHENDLLKEHIEYLKNXXXXX-----XXXXXXXXXDRLLHELVDIKKS 328
             K+  T+EM+L Q   D L++H+E LK                    D L+ EL  +K  
Sbjct: 274  SKQELTKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYR 333

Query: 329  LEKSELENVHLNDFIEQYLTEN---EESTSDN-----------------ELVLLKEQLIK 368
            L+ SE   + L + I++ LT N   E+S   N                 +L +LK+QL+ 
Sbjct: 334  LDASESNCIKLKETIDE-LTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVI 392

Query: 369  EKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKE 428
            EKRQKD L+ QVE FV+ELE+++P +NS K+R++ LE+EL ++T LLE T ++ D +  +
Sbjct: 393  EKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQ 452

Query: 429  LTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKS 488
            L      +K     I  L  QRVDLAHQ+Q+LL+N  +K      L+ +E+ F++ +  S
Sbjct: 453  LDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNS 512

Query: 489  RNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI----- 543
            +     SD+Q II++RLV+F  +  LQ++N ELL+T RNLA++LE  + ++  +I     
Sbjct: 513  QEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLED 572

Query: 544  -TRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSL-QNTGEQTPTEELRSQLQKKE 601
             T  E+KE I  L +    L ++L  L KE+DAYK LS+  ++G  TP + +       +
Sbjct: 573  ETVREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTP-KAITYPSPDND 631

Query: 602  EQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLE 661
            +++  LE   +     AE  AK  +     L+K+ Y+++     E + R +AE +  +L+
Sbjct: 632  DKVKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQ 691

Query: 662  DSLELLHKKYDLAVKKYEHYETLLNDHNAEN-------IKHSRENETTQAKISILQKEIE 714
             +LEL  ++ +   K+    + +L   +          IK      + Q+++SIL+ E  
Sbjct: 692  STLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSE-- 749

Query: 715  SYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDS 774
              KQ + +  K+ +    + +  + E + L ++L T++ E E    L++E +  YKE   
Sbjct: 750  --KQFMAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREM---LLKETQNSYKEK-- 802

Query: 775  ISERLLKKSKIQLEDKIKEVKDFE-------AKKNSQINWYQKRLDSLT-------TTND 820
                 L+K +I+L   ++ +++ E       + K  Q NW+Q+++D LT       TT +
Sbjct: 803  -----LRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLE 857

Query: 821  KLQVELNKELTKINIQRLKISDLEK-----TLSQNTNGSSSLPR-VDQDFXXXXXXXXXX 874
            + + +L K  + IN Q  K+ + E      T+  N + + +L   + Q+           
Sbjct: 858  EKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDS 917

Query: 875  XXXINQYRDLLNLAEETKNRLQK---DLNKQRQIVDDAMEG-KEQLDQQLAELTQECSSM 930
               I  ++ L   + ++ N + +   +  K+ Q     +E  + QL   +  L  +   +
Sbjct: 918  YSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDL 977

Query: 931  NSLLQKQKAKCEDDQKIIQDKATETENLKNSL----SSLENKITTLENEMVEKTKSFEEK 986
            N+ +  QK++ + ++    ++ ++ + +K S+    +  E KI  ++ ++  +T+   E 
Sbjct: 978  NNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANES 1037

Query: 987  ENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIA-AYEDAISAYRQKLLDE-KF 1044
            + +Y+ +L K ++ S  I  +  E ++YK+ L+ LK     A E+  ++  +KL +E K 
Sbjct: 1038 QRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNS--EKLWNEQKT 1095

Query: 1045 NHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALR 1104
             +E ++   ++ +  L+ Q      K  +   E    + D D +  +D+SD   L+++LR
Sbjct: 1096 EYEDKLSVLEQRVQELSTQ-----NKLLYDQIELLNKTEDRDNS--HDSSD---LLISLR 1145

Query: 1105 RERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVK 1164
            RERD L+ KL+++  E   L+++++  K+ +++       +++  S      EQ +  +K
Sbjct: 1146 RERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMK 1205

Query: 1165 QLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQ 1224
            +L++L+ L+E+N  L+ +     KE + + ++L+   + + PL+  +  L+N I  K+Q+
Sbjct: 1206 ELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQE 1265

Query: 1225 LTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEE-------LSXXXXXXXXXXXXNED 1277
            L    EE ERWK RS++IL K +++D EEH KL EE       L              +D
Sbjct: 1266 LIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDD 1325

Query: 1278 LNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLD---------EERKRI 1328
               +F R++ QA ++L+A+K +  SL++EI  + +AKS++E DL          EER ++
Sbjct: 1326 WESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQV 1385

Query: 1329 QEVESQLKQKPDNPDVITALEKELSD---SVENSKKIEENLQETVNSSLELNKKLTEEVN 1385
               E++ K++  N   ++ L+++L      +EN+ K E+N  +    S E  K LTE V 
Sbjct: 1386 VTQEAETKEQTFNSQ-LSKLQEDLHSIQVQMENASKTEQNNAD----SDEKIKSLTETVE 1440

Query: 1386 SLKSQLETLK----NQNGVISVADGSAINSETIA----------------------HLKE 1419
             L S+++ L+    N   +++      IN +T +                       L+ 
Sbjct: 1441 MLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRS 1500

Query: 1420 SFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEPIDIEKMKSEWEEK 1479
             FE                                   S P+  +  IDI+ +K+EWE++
Sbjct: 1501 KFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQS-PSQPTLDIDIDALKNEWEKE 1559

Query: 1480 QEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXX--XXXXXXXXXXXXQGLTTET-- 1535
             E+  +++I  AEE LKKRIRLP+++KI++++                   Q L  E   
Sbjct: 1560 YEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGN 1619

Query: 1536 -AIXXXXXXXX----XXXXXXXFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQA 1590
             AI                   F+ +LAE+K+K+F EGKQQ  +K   LE K+  LE Q 
Sbjct: 1620 DAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQK 1679

Query: 1591 SPSRTPDLESSQKENTEGATKT-TLGPSKINLLPFSMS 1627
            S  +  + ++S   N   A +    G       PFS S
Sbjct: 1680 STIKPVENDTS---NMSAAFQAPVFGSHSTFTSPFSTS 1714

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  313 bits (801), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 446/1661 (26%), Positives = 772/1661 (46%), Gaps = 200/1661 (12%)

Query: 133  KLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYERKVKDFEELKNAYSS 192
            +++  +A     +T+   + ++ + ++ +L   KSE    +S+ ER +K  E ++     
Sbjct: 81   RITGVEAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQW 140

Query: 193  MKTYEETSRKELSEMSNKFYTLKTSSSN-ELRNAKDALHSLEKQYELLLEENKAFKERNN 251
            ++ +   + +EL  M+ K   LK    + E+ N +  +  L+K  +LLL        +N 
Sbjct: 141  LEEHLVKTTEEL--MTQKQSILKMEEKDQEIDNLRHEVSILKKNNDLLLG-------KNQ 191

Query: 252  ELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHI-EYLKNXXXXXXXXX 310
            EL+  V ++L + K   +D +  ++ F  E+ L    N  L+  + E  +          
Sbjct: 192  ELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNEDNT 251

Query: 311  XXXXXDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTE-NEESTSDNELVLLKEQLIKE 369
                  +++ +L+D +K L+ S  E   L  ++ +++ + N E +S + L+  K++L+K 
Sbjct: 252  SRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYSSSSSLL--KKELLKV 309

Query: 370  KRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKEL 429
            K QKDYL+ QVE F+ ELE ++P ++SL+ +N+ LE+EL  +T L++    E +   KE 
Sbjct: 310  KEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEF 369

Query: 430  TTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSR 489
             +  R+ +     I  L +QR DLAHQ+QFLLL L  +     LL+ DE  F+R++ ++ 
Sbjct: 370  QSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEND 429

Query: 490  NSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLE------SSDTKSVQKI 543
                ++DSQ IISERL+KF DI+ LQKQNM++L T R+LA QLE       +D  ++++ 
Sbjct: 430  TYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERK 489

Query: 544  TRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQ-----------NTGEQTPTEE 592
            T  E+K+ +  LQE  N L  KLE  +KE+D YKLLS             N  ++  T +
Sbjct: 490  TLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTTGK 549

Query: 593  LRSQLQKKEEQLTK-LERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRA 651
            L+++LQ+  E LTK +E+++              N+ I+  KKE   L  ++ K  S + 
Sbjct: 550  LQNELQQTREYLTKEIEKLTR------------TNKDILNKKKE---LEYSMKKMESAKE 594

Query: 652  IAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQK 711
             AE K++++E++L +L +     +++ +H + LL+   A+  + +++     ++ ++LQ 
Sbjct: 595  YAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQI 654

Query: 712  EIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSR---LSTVKNE---LEQKINL-MQE 764
                 +         ++ T  +L    +EK  L  +   L   +NE   ++  + L + E
Sbjct: 655  RFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNE 714

Query: 765  RETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQV 824
            R T Y+ H+    ++++K + Q       ++D E K+  ++NWYQK   + T T   L V
Sbjct: 715  RLTEYQLHEQDLLKIIEKQEDQ-------IRDMEVKRAEELNWYQKNFPTQTETEIGLPV 767

Query: 825  ELNKE-----------LTKINIQRLKISDLEKTLSQNTNGSSSLPRVDQDFXXXXXXXXX 873
            ++ KE           L          +DL      +   S+SLP +             
Sbjct: 768  DMKKEGETGRQSNRDTLESQKSGSPGFTDL--GTDSSVRKSTSLPVMQVGRTEEESKEAK 825

Query: 874  XXXXINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSL 933
                +     ++ L E    + +KDL  Q   ++     K++L   L  +  E   ++  
Sbjct: 826  KCDALTDSSQVVGLPENVTKK-EKDLIAQ---IEQLASDKKELKTSLQAIRAEYQHLHDQ 881

Query: 934  LQKQKAKCEDDQKIIQ---DKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENTY 990
            LQ +K   + ++  +    DK  E     NSL+ +  K  +LE+++ +     EE+   +
Sbjct: 882  LQLEKNSFDTEKASLNNELDKIMEN----NSLTEVAKK--SLEDDLHDVEMKLEEERQKH 935

Query: 991  KEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQV 1050
            +E    LSE   L EKM  E                     IS YR++L     + E+QV
Sbjct: 936  EETNATLSEKELLCEKMIEE---------------------ISGYREEL---SKSAEMQV 971

Query: 1051 D-----EFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRR 1105
            D     E ++ +D  N +I     + + +  + + T +  D    +D  D   +I+ ++R
Sbjct: 972  DIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIKD---IIVCMKR 1028

Query: 1106 ERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQ 1165
            ERD L  KL I +RE   LRE+   LK+ LD   +  +     +S  +T    H++ + +
Sbjct: 1029 ERDTLQKKLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPLSNLLTG---HEKILDE 1085

Query: 1166 LNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQL 1225
            L E++ L+E N  L  ++ +   +N I++ +L  ++    PL+D+    +    EKDQ++
Sbjct: 1086 LKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEI 1145

Query: 1226 TLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRL 1285
            +L  +E ERWK R ++ ++ RQ   L        E+              E L+++F  L
Sbjct: 1146 SLYKDEIERWKKRWQQ-MVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLL 1204

Query: 1286 KKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVI 1345
            KKQAHEKLDA K    +L  +++++  +  +LE  + E+ K+I+E+E  LK+   N +  
Sbjct: 1205 KKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKE---NLEKF 1261

Query: 1346 TALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQ----NGVI 1401
               EK +S+     K+ E  L +T+    +LN+ L +EV SL+ ++  L+ +    N +I
Sbjct: 1262 DKDEKLVSEKT--FKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETNQLI 1319

Query: 1402 SVA------DGSAINSETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY 1455
            S        +   +  E +  L E FE                                 
Sbjct: 1320 STMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENV------------------- 1360

Query: 1456 YDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXX 1515
                 T  +   +++K+K E  +  EE  +QRI +A+ENLK+ IRLPSEEKI R+I    
Sbjct: 1361 -----TNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRR 1415

Query: 1516 XXXXXXXXXXXXXQGLTTETA---------IXXXXXXXXXXXXXXXFDNELAEVKKKAFL 1566
                         +      A         +                  +L  ++ KAF 
Sbjct: 1416 AELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFE 1475

Query: 1567 EGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSM 1626
            EGK+Q++MKTTLLERKLSKLESQ +     D ES  K       K+  G +KI++    +
Sbjct: 1476 EGKRQAEMKTTLLERKLSKLESQVA----KDNESGSK-----VRKSISGLTKIDVNSPQL 1526

Query: 1627 SNTDDSIEKQVPQGEKVLQINRRSLEPSFG-----SSNPFTLPTQ-----NKPAFL---F 1673
               +        + E VL++ R + +   G      SNPFT PTQ     N PA L    
Sbjct: 1527 YKDNTG-----TRTEAVLKL-RPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVH 1580

Query: 1674 ASNNHSQTKKQDGLPINKSPFQTTLFAPFSSKTTTPNGTPT 1714
             +   S T  +    +NK     T  A F + T +  GT T
Sbjct: 1581 MAPTFSFTPGKSTGTVNKE-LNKTAQATFGAPTFSNFGTST 1620

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  299 bits (765), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 402/1439 (27%), Positives = 692/1439 (48%), Gaps = 216/1439 (15%)

Query: 162  LNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNE 221
            L   KS    L+ KY+  V++ E +     S K  EE    +LS  S K  T + + S+ 
Sbjct: 160  LQRCKSNAISLQLKYDTSVQEKELM---LQSKKLIEE----KLSSFSKKTLTEEVTKSSH 212

Query: 222  LRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTRE 281
            + N ++ L+ ++  YE +   NK    +N +L+ +V +++ + K+L++  +  K  F++E
Sbjct: 213  VENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKE 272

Query: 282  MTLTQHENDLLKEHIEYLKNXXXXXXXXXXXXXXDR------LLHELVDIKKSLEKSELE 335
            MTL ++ NDLL+  +  L+                R      ++ EL+D K  LEKS+ E
Sbjct: 273  MTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNE 332

Query: 336  NVHLNDFIEQYLTENEESTSDNELV------------LLKEQLIKEKRQKDYLQEQVELF 383
               L + +    T+ EE+T     V            +LK QLIKE+ QK  LQ Q+E F
Sbjct: 333  CQRLQNIV-MDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDF 391

Query: 384  VIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENI 443
            ++ELE++ P + S K+R ++LE EL + T LLE        + +E+T+  +++     NI
Sbjct: 392  ILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANI 451

Query: 444  NVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISE 503
            + L+ QR+DLA QV+ LLLN    +     L+ DE+  LRKI++S N  N++DSQ II+E
Sbjct: 452  HSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITE 511

Query: 504  RLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTK---SVQKI---TRNESKEKIAKLQE 557
            RLV+F +++ LQ++N+ELL   R LA++LE+ + K   ++QK+   T  E+K+ I +L E
Sbjct: 512  RLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIEL-E 570

Query: 558  SING-LTSKLEKLQKEKDAYKLLSL-----QNTGEQTPTEELRSQLQKKEEQLTKLERMS 611
            +IN  + +++  L +E+D+YKLL+       NT   T  E  R +            ++ 
Sbjct: 571  NINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREK------------KIR 618

Query: 612  SLDSHLAEEKAKVLNQSIIK-LKKEKYDLNNAIIKETSQ-------RAIAEKKSKMLEDS 663
             L++ L+    KV N +II+ L+KE      +  K+ +        + +A++K +MLE++
Sbjct: 619  ELEAELS--STKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEA 676

Query: 664  LELLHKKYDL-----AVKKYEHYETLLNDHNAENIKHSRENETTQAKISI--LQKEIESY 716
            ++  H K +L      V  Y H E           K     E +Q++I I  L+ EI   
Sbjct: 677  ID--HLKAELEKQKSWVPSYIHVE-----------KERASTELSQSRIKIKSLEYEISKL 723

Query: 717  KQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLM--QERETYYKEHDS 774
            K+    +    E+         +EK+ L  RL   ++E+    N M    +E  YK    
Sbjct: 724  KKETASFIPTKESLTRDFEQCCKEKKELQMRLK--ESEISHNENKMDFSSKEGQYKAKIK 781

Query: 775  ISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDS--------LT------TTND 820
              E  L++ +  L+ KI+E++   + K+SQ+ W Q  +D         LT      TT +
Sbjct: 782  ELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIE 841

Query: 821  KLQVE---LNKELTKINIQRLKISDLEKTLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXX 877
            KL  E   L+KEL K   Q        K L QN++ S+  P + ++              
Sbjct: 842  KLSSEIENLDKELRKTKFQY-------KFLDQNSDASTLEPTLRKELEQIQVQLKDANSQ 894

Query: 878  INQYRDLLNLAEETKNRLQKDLNKQRQIVDDA--MEGKEQL--DQQLAELTQECSSMNSL 933
            I  Y ++++  E     L+ +L K ++  D    +E KE+   ++ L+ L  E   + +L
Sbjct: 895  IQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRAL 954

Query: 934  LQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLE--NEMVE--KTKSFEEKENT 989
              K K   E     +Q    ++E L+N +  ++  I  +E  + +V+  K K   + ++T
Sbjct: 955  QPKLK---EGALHFVQ----QSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQST 1007

Query: 990  YKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQ 1049
             KE    LSE   L+ ++E +    +  L   K+++ + +D +  + +K ++EK ++E  
Sbjct: 1008 MKEN-KDLSE---LVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYE-- 1061

Query: 1050 VDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILA-----LR 1104
                +E I N+         +   +  E S      D+T  N+  DK+ L L      LR
Sbjct: 1062 ----RELISNIE--------QTESLRVENSVLIEKVDDTAANN-GDKDHLKLVSLFSNLR 1108

Query: 1105 RERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVK 1164
             ER+ L+ KL   +RE+  ++++ ++L+ ++++ +++    E E        ++ K+  K
Sbjct: 1109 HERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITK 1168

Query: 1165 QLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQ 1224
            ++ ++N LKE N  LQ+ L+      N+     E+ K ++N  ++++ RL+  +++  +Q
Sbjct: 1169 EVTQVNILKENNAILQKSLK------NVTEKNREIYK-QLNDRQEEISRLQRDLIQTKEQ 1221

Query: 1225 LTL-----LSEENERWKLRSREILMKRQQVDLEEHN--KLMEELSXXXXXXXXXXXXNED 1277
            +++     L  E+E  + + R   + +QQ D ++ +  KL  E+S            N D
Sbjct: 1222 VSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANAD 1281

Query: 1278 LNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQ 1337
            L ++FNRLKKQAHEKLDA+K Q A+LT E+ +L   K KLE DL  E  ++         
Sbjct: 1282 LENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKV--------- 1332

Query: 1338 KPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQ 1397
                 D+ T L+     S + S+  E++   T          L EE+ SLK +L+  K  
Sbjct: 1333 ----IDLDTKLKAHELQSEDVSRDHEKDTYRT----------LMEEIESLKKELQIFKTA 1378

Query: 1398 NGVISVADGSAINSE-----TIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1452
            N      +   +N E      I    + FE                              
Sbjct: 1379 NSSSDAFEKLKVNMEKEKDRIIDERTKEFE--------------------------KKLQ 1412

Query: 1453 XXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511
                 S  +      DIE +K EW ++ E+  ++RI +AEENLKKRIRLPSEE+I ++I
Sbjct: 1413 ETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKII 1471

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  272 bits (695), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 377/1423 (26%), Positives = 690/1423 (48%), Gaps = 182/1423 (12%)

Query: 162  LNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNE 221
            L   KS T  LK KY+  V++ E +     + K  EE    +LS    K      + ++ 
Sbjct: 160  LQTCKSNTLSLKLKYDTVVQEKELI---LENKKWMEE----QLSFRDEKTLVDDVTRTSH 212

Query: 222  LRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTRE 281
            ++N ++ L+  +  YE +   N+    +N +L+ ++  ++ + K+L++ +N  K  F++E
Sbjct: 213  VQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKE 272

Query: 282  MTLTQHENDLLKEHI-EYLKNXXXXXXXX-----XXXXXXDRLLHELVDIKKSLEKSELE 335
            MTL ++ NDLL+  +  + KN                     ++ +L+D K  LEKS+ E
Sbjct: 273  MTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDE 332

Query: 336  NVHLNDFIEQYLTENEESTSDN-------------ELVLLKEQLIKEKRQKDYLQEQVEL 382
               L + +   + E +E+  DN             ++  LK QLIKE+ QK  LQ Q+E 
Sbjct: 333  CQRLQNIVADCI-EEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMES 391

Query: 383  FVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTEN 442
            F+ ELE + P + S K+R ++LEQEL   T LLE          KELT+  +++     N
Sbjct: 392  FIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEAN 451

Query: 443  INVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIIS 502
            I+ L+ QR+DLA QV+ LLLN+   + +   L+ DE+  L+K+++S +  N+ DSQ II+
Sbjct: 452  IHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIIT 511

Query: 503  ERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDT---KSVQKI---TRNESKEKIAKLQ 556
            ERLV+F++ + LQ++NMELL   R LA++LE+ +    KS+ K+   T  E+K+ I +L+
Sbjct: 512  ERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELE 571

Query: 557  ESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKKEEQLTKLERMSSLDSH 616
               + L S+++ L +E+D+YKLL+  N        ++ +    K E    L+++  L+S 
Sbjct: 572  HVNSTLESRIDILSRERDSYKLLASANGN------KIYADAANKTEA-ANLKKIKELESE 624

Query: 617  LAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKM-LEDSLELLHKKYDLAV 675
            L+  K +                N+A+++  ++  +  KKS+   + +L+       LA+
Sbjct: 625  LSLTKVE----------------NSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAI 668

Query: 676  KKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYKQNLLQYSKDNENTLSKLA 735
            +K    +T ++D     +K   E + + A  SI    I S +  L QY    ++ + +++
Sbjct: 669  EKENLLQTRIDD-----LKTKLEKQRSSAPSSI-HGSIGSEETELSQYKNKTKSLMCEIS 722

Query: 736  AATQEKETLGSRLSTVKNELE----QKINL---MQERETYYKEH--DSISERLLKKSKI- 785
              +++   L     ++  +LE    +K+ L   + E ET + E    S S+++   +KI 
Sbjct: 723  NLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIK 782

Query: 786  -----------QLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKIN 834
                       +L  K++E++  +  KNSQ+ W Q  +D        L  +L+++ T I 
Sbjct: 783  NLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIR 842

Query: 835  IQRLKISDLE----------KTLSQNTNGSSSLPRVDQDFXXXXXXXXXXXXXINQYRDL 884
               L++ DLE          K L+ +++ ++    + ++              I  Y ++
Sbjct: 843  KLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEI 902

Query: 885  LNLAEETKNRLQKDLNKQR-------QIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQ 937
            ++  E T   L   L K +       Q +D+    KE   ++++ L +E   +  L  K 
Sbjct: 903  ISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKE---EEISFLRRELDEIRGLQPKL 959

Query: 938  KAKCEDDQKIIQDKATETENLKNSLSSLE------NKITTLENEMVEKTKSFEEKENTYK 991
            K   E   +++Q    ++E L N    ++      +K+TT+    VE  +  E  +  Y+
Sbjct: 960  K---EGALRLVQ----QSEKLGNQTQRIQAMNEKIDKMTTI----VELHQEVETSQ--YQ 1006

Query: 992  EQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVD 1051
             +L    + S L+ ++E E   Y+T L   K+++ + ++ +  + +K ++EK ++E    
Sbjct: 1007 AKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYE---- 1062

Query: 1052 EFKETIDNLNFQIHIQKGKRSFITS-EGSTTSNDTDETVVNDTSDKNELILALRRERDGL 1110
              +E I N+     ++    + +   +  T  N+ D+  +   S    L  +LR ER+ L
Sbjct: 1063 --RELISNIEQTESLRVENSALVEKIDDGTGENNGDKEYLKLVS----LFSSLRHERNTL 1116

Query: 1111 DIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELN 1170
            + KL   +R++   +++  NL+ S+++ +Q+      +V       ++ ++ +K++ ++N
Sbjct: 1117 ETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVN 1176

Query: 1171 TLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSE 1230
             LKE N  LQ+ L++  ++N  I+ +   L+ E++ L+  + + K  +     ++ +   
Sbjct: 1177 ILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYES 1236

Query: 1231 ENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAH 1290
            E E+WK R   +  ++++   +E  KL  E+S            N DLND+FNRLKKQAH
Sbjct: 1237 EIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAH 1296

Query: 1291 EKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEK 1350
            EKLDA+K Q  +LT E+ +L D K++LE  L  E  ++ E+E++LK             K
Sbjct: 1297 EKLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLELEAKLK-------------K 1343

Query: 1351 ELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAIN 1410
             L  +   SK  EE          + +K L EE+  LK +L+  K           ++ +
Sbjct: 1344 HLVQAEGVSKDQEE----------DTSKPLMEEIELLKRELQVFKE----------TSDS 1383

Query: 1411 SETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTGGS--EPID 1468
            S+TI  +KE  E                                    K TG +     +
Sbjct: 1384 SDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEAT-------------GKNTGATIENGEN 1430

Query: 1469 IEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511
            +E++K +W ++ EE  M+RI +AEENLKKRIRLPSEE+I ++I
Sbjct: 1431 MEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKII 1473

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  256 bits (653), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 354/1366 (25%), Positives = 664/1366 (48%), Gaps = 144/1366 (10%)

Query: 204  LSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFK 263
            LS  +NK    +++ ++ +RN ++ L+  +   E  L  ++   ++N +L+ +V +++ +
Sbjct: 195  LSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILE 254

Query: 264  KKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLKNXXXXXXXX------XXXXXXDR 317
             K+L++     K  F++EMTL +  NDLL   +   +                     + 
Sbjct: 255  IKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKDDDNLCKDPDHNN 314

Query: 318  LLHELVDIKKSLEKSELENVHLNDFIEQYLTENEESTSDN-----------ELVLLKEQL 366
            +  EL++ K   +KS+ E   L + I  ++ E++ +   N           ++ +L++QL
Sbjct: 315  VTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQL 374

Query: 367  IKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRI 426
            IKE+ QK  LQ Q+E F++ELE++ P + S K+R ++LE EL + T LLE          
Sbjct: 375  IKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDE 434

Query: 427  KELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKII 486
            +ELT+  +++     NI++L+ QR+DLA QV+ LLLN    +     L+ D++  LRKI+
Sbjct: 435  RELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKIL 494

Query: 487  KSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKS------V 540
            +S +  N++D+Q IISERLV+F++I+ LQ++N+ELL   R LA++LE  + K       V
Sbjct: 495  ESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEV 554

Query: 541  QKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQ-----NTGEQTPTEELRS 595
            +K T  E+K+ I +L+ +   + S++  L +E+D+YKLL+       N   +  TE    
Sbjct: 555  EKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTE---- 610

Query: 596  QLQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIK-LKKEKYDLNNAII--KETSQ--- 649
                    ++  +++  L++ L+    KV + ++I+ L+KE       +   K  SQ   
Sbjct: 611  --------ISHEKKIKELEAELS--STKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE 660

Query: 650  --RAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKIS 707
              + +A++K  +LE  +  L  K DL  +K     + + D+    ++ S E   ++ K  
Sbjct: 661  NFKMLAKEKESILETRVNNL--KTDLEKQKL-SVPSFVQDN---KVRDSTELLQSRTKTE 714

Query: 708  ILQKEIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNEL-EQKINLMQERE 766
            IL  EI S K+         E+    L    +EK  L  +L   +  L EQK+N   +  
Sbjct: 715  ILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGI 774

Query: 767  TYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVEL 826
             Y      + E  L++ +I+L+ K +E+K  ++ K+SQ+ W Q  +D    T +KL+  L
Sbjct: 775  KYDARIKQLEES-LERLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDD---TEEKLKSVL 830

Query: 827  N----KELTKINIQRLKISDLEKTLSQ---------NTNGSSSL-PRVDQDFXXXXXXXX 872
                 KE T + +   KI +L+  L +         NT+ +S+L P + ++         
Sbjct: 831  TELSRKEKTVVTLSS-KIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELK 889

Query: 873  XXXXXINQYRDLLNLAEETKNRLQKDLNKQRQIVDDA--MEGKEQL--DQQLAELTQECS 928
                 +  Y ++++  E+    L   L   ++  D    +E KE+L  +++L+ L +E  
Sbjct: 890  DAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRRELD 949

Query: 929  SMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKEN 988
             + SL    + K ++    +  ++ +  N    +  ++ KI  + N  V+  K  +EK +
Sbjct: 950  EIRSL----QPKLKEGTVCLVKQSEKLRNQAEKIQEMKAKIDKM-NWNVQVYK--KEKTS 1002

Query: 989  TYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHEL 1048
             ++  +    E S L+ ++E E    +  L  LK+++   +D +  + +K ++EK ++E 
Sbjct: 1003 QFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYE- 1061

Query: 1049 QVDEFKETIDNLNFQIHIQKGKRSFITSEGSTT-SNDTDETVVNDTSDKNELILALRRER 1107
                 +E I N+     ++      I   GS T  +D +E  +   S        LR ER
Sbjct: 1062 -----RELISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYLKLVS----FFSNLRHER 1112

Query: 1108 DGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLN 1167
            + L+ KL   +R++  ++++  +L+ ++++ +      ++E+       ++  +  K++ 
Sbjct: 1113 NSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIA 1172

Query: 1168 ELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTL 1227
            ++N LKE N  LQ+ L+   ++N  I+ +L + + E++ LK  + + K  +     ++ +
Sbjct: 1173 QVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILI 1232

Query: 1228 LSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKK 1287
               E ++ K R  ++  ++++V  +   KL  E+S              +L ++FNRLKK
Sbjct: 1233 YESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKK 1292

Query: 1288 QAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITA 1347
            QAHEKLDA+K Q  +LT E+ +L   + KLE DL+ +  +  +++++    P    V + 
Sbjct: 1293 QAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLDTE----PKEHTVQSG 1348

Query: 1348 LEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGS 1407
                  D + + +K+         +SL     L EE+ SLK +L+  KN N         
Sbjct: 1349 ------DLLRDQEKV---------ASL----PLIEEIESLKRELQVFKNANN-------- 1381

Query: 1408 AINSETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDSKPTG--GSE 1465
              +S+    L+++ E                                   SK TG     
Sbjct: 1382 --SSDAFEKLRDNME-----------EEKNKIINERTKEFEKKLEEIVSKSKSTGKVADN 1428

Query: 1466 PIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511
              +IE +K EW ++ EE  ++RI +AEENLKKRIRLPSEE+I ++I
Sbjct: 1429 SENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKII 1474

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  243 bits (621), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 334/1270 (26%), Positives = 626/1270 (49%), Gaps = 127/1270 (10%)

Query: 204  LSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFK 263
            LS  + K    + + ++ L+N ++ L+  + + E +   NK   ++N +L+  V ++L +
Sbjct: 195  LSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLE 254

Query: 264  KKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLKNXXXXXXXXXXXXXXDRLL---- 319
             K+L++  N  K  F++EMTL +  NDLL+     L +              D+L     
Sbjct: 255  IKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQ---LTSFERGHSLRPKEKGDDKLCKNPE 311

Query: 320  -----HELVDIKKSLEKSELENVHLNDFIEQYLTENEESTSDN-----------ELVLLK 363
                  EL+D K  LEKS+ E   L + +   + EN  + + N            +  LK
Sbjct: 312  HIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLK 371

Query: 364  EQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESD 423
             QL+KE+ QK  +Q Q++ FV+ELE++ P + S K+R + LE EL   T LLE       
Sbjct: 372  RQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKR 431

Query: 424  IRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLR 483
               K+LT+  +++     NI+ L+ QR+DLA QV+ LL N+   +     L+ DE+  LR
Sbjct: 432  KDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLR 491

Query: 484  KIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDT---KSV 540
            K+++S N+ N+ DSQ II+E+LV+F +I  LQ++NMELL   R LA++LE+++    K+V
Sbjct: 492  KLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTV 551

Query: 541  QKI---TRNESKEKIAKLQESING-LTSKLEKLQKEKDAYKLLSLQNTGE-QTPTEEL-R 594
             KI   T  E+KE I ++ ESIN  L  ++  L +E+D+YKLL+  N  +    TE +  
Sbjct: 552  AKIENQTIKEAKEAIIEM-ESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITE 610

Query: 595  SQLQKKEEQLTKLERMSSLDSHLAEEKAKV--LNQSIIKLKKEKYDLNNAIIKETSQRAI 652
            +  +KK  +L      S L S   E  A +  LN  ++  KK + D   A+ +  + + +
Sbjct: 611  ATYEKKIREL-----QSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVL 665

Query: 653  AEKKSKMLEDSLELLHKKYDL------AVKKYEHYETLLNDHNAENIKHSRENETTQAKI 706
              +K  ML++ +   H K  L      A    + Y+      N  ++ HS      + KI
Sbjct: 666  VAEKEAMLQERIN--HLKTQLEKQRLSAAPPVQDYKY----SNLTDLSHS------ENKI 713

Query: 707  SILQKEIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERE 766
              L+ EI + K+         E+    L    +EK  L  +LS  +    ++  +   +E
Sbjct: 714  GSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKE 773

Query: 767  TYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVEL 826
              Y     + E+ LK+  ++LE K +E+K  ++ KNSQ+ W Q  +D        +  EL
Sbjct: 774  LQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAEL 833

Query: 827  -NKELT--KINIQ------RLKISDLEKTLSQNTNGSSSL-PRVDQDFXXXXXXXXXXXX 876
             NKE T  +++++       L+++ L+     NT+ +++L P + ++             
Sbjct: 834  SNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHS 893

Query: 877  XINQYRDLLNLAEETKNRLQKDLNKQRQIVDDA--MEGKEQL--DQQLAELTQECSSMNS 932
             I  Y ++++  E     L  +L K ++  +    +E KE+   +++L+ L +E   +  
Sbjct: 894  QIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRC 953

Query: 933  L---LQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENT 989
            L   L++  +      + + D+A   + +KN +           ++M    ++++++E++
Sbjct: 954  LQPKLREGASYLVLQSEKVGDQAQRIQEMKNKI-----------DKMAAIIEAYQKEESS 1002

Query: 990  -YKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHEL 1048
             Y+ +L    + S  + ++E E   Y+T L   K ++ + ++ +  + +K ++EK ++E 
Sbjct: 1003 QYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYE- 1061

Query: 1049 QVDEFKETIDNLNFQIHIQKGKRSFITS--EGSTTSNDTDETVVNDTSDKNELILALRRE 1106
                 +E I N+  Q    + + S +    +G+T  ++++E  +   S    L   LR E
Sbjct: 1062 -----RELISNIE-QTESLRVENSVLIEKIDGATEGSNSNEKYLELVS----LFSNLRHE 1111

Query: 1107 RDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQL 1166
            R  L+ KL   +R++  LR++  +L+ S+ + +++     ++V       +++++ +K++
Sbjct: 1112 RSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVIIDEYEKIIKEI 1171

Query: 1167 NELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLT 1226
             ++N L+E N  L + L+   ++N  I+ +L  ++ E++ L+  + + K  +     ++ 
Sbjct: 1172 AQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVL 1231

Query: 1227 LLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLK 1286
                E E+ K R +++  +++     E  KL   +             N DL ++FNRLK
Sbjct: 1232 AYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLK 1291

Query: 1287 KQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKP------- 1339
            KQAHEKLDA+K Q  +LT E+ +L + K KLE +L  E  ++ ++E +LK+         
Sbjct: 1292 KQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEVS 1351

Query: 1340 -DNPDV--------ITALEKEL------SDSVENSKKIEENLQETVNSSL-----ELNKK 1379
             D+  +        I +L+KEL      +D+ +  +KI+ N++E  N  +     +  KK
Sbjct: 1352 KDHDSIAFKPFVEEIESLKKELQVFRNANDASDAFEKIKNNMEEEKNKIIDEKTKDFEKK 1411

Query: 1380 LTEEVNSLKS 1389
            L + VN  KS
Sbjct: 1412 LQDAVNKSKS 1421

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%)

Query: 1469 IEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511
            IE +K EW ++ EE  ++RI +AEENLKKRIRLPSEE+I ++I
Sbjct: 1432 IEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKII 1474

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  223 bits (567), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 394/1499 (26%), Positives = 696/1499 (46%), Gaps = 175/1499 (11%)

Query: 133  KLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSK----------YERKVKD 182
            KL+S    L    T   EL +      TQ N  K + +GL  K          ++    +
Sbjct: 89   KLTSLGGKLATVETEKKELIDKVNGYETQFNELKIKNEGLNLKVSNLNIELENWKNNSNN 148

Query: 183  FEELKNAYSSMKTYEETSRKELSEMSNKFYTL---KTSSSNELRNAKDALHSLEKQYELL 239
            FE  K  Y            E+  +  +   L   K+S S +    K+  +    + +LL
Sbjct: 149  FETEKLNYVXXXXXLSIRESEIQRLKQEVTFLNENKSSLSEQWLKEKEEFN----KAKLL 204

Query: 240  LEEN----------------------KAFKERNNELTTTVSDELFKKKSLENDLNELKES 277
            LE+N                          ++NN+LT    + +++ K+L+++L   K+ 
Sbjct: 205  LEKNLNNSTIKLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDD 264

Query: 278  FTREMTLTQHENDLLKEHI----EYLKNXXXXXXXXXX----XXXXDRLLHELVDIKKSL 329
              +E+ +     DLL+  +    E L+                   + L  ++ D+   +
Sbjct: 265  MNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKI 324

Query: 330  EKSELENVHLNDFIEQYLTENEE-----------STSDNELVLLKEQLIKEKRQKDYLQE 378
            E+ + EN +LN  I Q   E               T  +++ LLK+Q+ +EK +K +LQ 
Sbjct: 325  EELQNENFNLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQT 384

Query: 379  QVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKE 438
            Q+E F+IELEN++P ++S +++NQ LE EL  +T LL +T  E +    +L   + +L  
Sbjct: 385  QIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLT 444

Query: 439  QTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSD-- 496
               NI  L+ QR+DLA+QV+ LLL + +K      LT +EI F+ KI  +    N S+  
Sbjct: 445  YQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELT 504

Query: 497  SQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLE----SSDTKSVQKITRNESKEKI 552
            SQ +ISERLV F +I  LQ +NMELL + R+L+E LE    ++  K  Q  T  ++KE I
Sbjct: 505  SQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHKEFQNKTIADAKEAI 564

Query: 553  AKLQESINGLTSKLEKLQKEKDAYKLLSLQNTG--EQTPTEELRSQLQKKEEQLTKLERM 610
              LQ   + L SK++ L+ E+D++KLL   N         ++L S    +  + + +E++
Sbjct: 565  LTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKS-IEKL 623

Query: 611  SSLDSHLAEEKAK---VLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELL 667
             +L   L  E  K    L   I     +K +L  ++ KE S   +  +K  + E + ++L
Sbjct: 624  QTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDML 683

Query: 668  HKKYDLAVKKYEHYETL-------LNDHNAENIKHSRENETTQAKISILQKEIESYKQNL 720
              +     K++E+ + +       L D   + I    E    + ++SI + E     ++ 
Sbjct: 684  KTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSE-----KDF 738

Query: 721  LQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYY--KEHDSISER 778
            L  S+D+ N  S+L   ++EK  L   LS +++   +++ L+ + +  +  K H+  +  
Sbjct: 739  LVKSQDSLN--SELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNN 796

Query: 779  L-LKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQR 837
            L L K+   L  K+ E++       SQ  WYQ  +D L   N  ++ EL  + + I+   
Sbjct: 797  LDLIKN---LGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLN 853

Query: 838  LKISDLEK---TLSQNTNGSSS---LPRVDQDFXXXXXXXXXXXXXINQYRDLLNLAEET 891
             KI  LE    T+  NT  SSS     ++ +D              + +Y+ L    EE+
Sbjct: 854  TKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEES 913

Query: 892  KNRLQKDLNKQRQIVDDAMEG----KEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKI 947
               L+ +    + ++DD +       E L     E  +  S +++ L+ +K K  ++   
Sbjct: 914  LKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQ 973

Query: 948  IQDKATETENLK----NSLSSLENKITTLENEM----------VEKTKSFEEKENT---- 989
            +  + T     K    ++ S  E KI+ L++++           EK +S   K+N     
Sbjct: 974  LNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQS 1033

Query: 990  ---YKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNH 1046
               +KEQ+ KL++   +IE     +   KTSL  L  N + ++    A+   L       
Sbjct: 1034 IEEFKEQIEKLNQRIVIIES----DLEKKTSL--LSENESLWKKKQDAFISDL------- 1080

Query: 1047 ELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRRE 1106
                +E K+ IDNL  Q  +   +   +  + S+  +         +S+   +   LR +
Sbjct: 1081 ----EESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQ------LSSETKHMFNRLRAD 1130

Query: 1107 RDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQL 1166
            RD L+ KL I++R+  +   ++E+L++ L   +      E+++       E H++ V +L
Sbjct: 1131 RDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSEL 1190

Query: 1167 NELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLT 1226
            N++   KE+NE L+ ++ E +++N  + TKL    ++++ L  +++ +K S+ +K+  + 
Sbjct: 1191 NQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIM 1250

Query: 1227 LLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLK 1286
            L+ EE+ +W+LR+ E+ ++  +VDL+  +KL  EL             N +L +RFN LK
Sbjct: 1251 LIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLK 1310

Query: 1287 KQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVIT 1346
            KQAHE+L+A+K   +SL  +I +L  + + +E+ L  E+K+  ++++ L    DN    T
Sbjct: 1311 KQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTL---SDNEVKYT 1367

Query: 1347 ALEKELSDSVENSKKIEENLQ--ETVNSSLELNK-----KLTEEVNSLKSQLETLKNQNG 1399
               ++LS+       IE  L+  +T N+S +L+      +LT+EV+SLK  L   +++  
Sbjct: 1368 ---QKLSN-------IESELKALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLS 1417

Query: 1400 VISVADGSAINSETIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY---- 1455
             I    GS     T+  + ES +                                Y    
Sbjct: 1418 AI----GSDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLKEYEEKI 1473

Query: 1456 YDSKPTGGSEPIDIEKMKS---EWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511
             D +     + I IE+ +S   EWEE+ E+  ++RI +A+E LKKRIRLPSE KINRVI
Sbjct: 1474 EDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVI 1532

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 78/169 (46%), Gaps = 41/169 (24%)

Query: 1553 FDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKT 1612
            F+N+L E KKK+F EGKQQS MKTTLLERK+SKLESQ S +   D +S +          
Sbjct: 1585 FENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIENDKQSDK---------- 1634

Query: 1613 TLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEP--SFGSSNPFTLPTQNKPA 1670
                   N +   ++ T      Q P  +K          P  SFG  N       NK  
Sbjct: 1635 -------NPIISDLAQTSTLASIQPPSAKK----------PAFSFGGFNTTNSLNANKG- 1676

Query: 1671 FLFASNNHSQTKKQDGLPINKSPFQTTL---------FAPFSSKTTTPN 1710
              F+S++++ ++      I ++PF   +         F PFSS  TT N
Sbjct: 1677 --FSSSSNNTSQSSKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTSN 1723

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  220 bits (561), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 227/715 (31%), Positives = 350/715 (48%), Gaps = 68/715 (9%)

Query: 958  LKNSLSSLENK---ITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAY 1014
            L NS+S L+ K   +  L++++VEKT+  +  EN   E   K++ +  L++ M  EN  +
Sbjct: 874  LANSVSQLQGKEKELNELKSKLVEKTEKLQMAEN---ENSEKINNAIVLLQTMVEENTTF 930

Query: 1015 KTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFI 1074
            K +    K +++    AI++ +Q+ L  + N+  ++D   E ++    ++    GK + I
Sbjct: 931  KDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEI 990

Query: 1075 TSEGSTTSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNS 1134
                       D  ++N T+    L+ +L  E+  L + L+ +    YSLR      KN 
Sbjct: 991  LE-------SYDGKILN-TAAIGHLVRSLIHEKKMLALNLNSAN---YSLRRARYRNKNP 1039

Query: 1135 LDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIH 1194
                R+ F     ++  +    E  +E ++   +L  L+E+N +L +++    K N  + 
Sbjct: 1040 ----REKFPSF-VKIDQQSKKEEDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLS 1094

Query: 1195 TKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEH 1254
            ++L  ++ ++ PL+ ++  LK  + EK+Q L +  EE ERWKLRS+ IL + + V+ E H
Sbjct: 1095 SQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAH 1154

Query: 1255 NKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAK 1314
             K +E++             N  L DRF+RLKKQAHEKLDAAK    +LT +I +L + K
Sbjct: 1155 MKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETK 1214

Query: 1315 SKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSL 1374
              LE  L +E   I++         D  + I  L  EL  S   S ++E+ +++      
Sbjct: 1215 VNLEKSLQQE---IEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDA----- 1266

Query: 1375 ELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEVXXXXXXXXXXX 1434
               KK   E+ SLKS+L+++K         + S +NS+ I  LKESF+            
Sbjct: 1267 ---KKFKNEIESLKSELQSVK-------AYENSTVNSKIIKDLKESFKREKDELIEQMKK 1316

Query: 1435 XXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEEN 1494
                                        G E  +IE++K +WEE+QE +I++RI +AEEN
Sbjct: 1317 EFKTKLEKEKETILAQRKNNIL----ANGQESANIEELKKKWEEEQEALILKRITEAEEN 1372

Query: 1495 LKKRIRLPSEEKINRVIXXXXXXXXXXXXXXXXXQGLTTE-TAIXXXXXXXXXXXXXXXF 1553
            LKKR+RLPSEEKIN VI                  GL  +   +               F
Sbjct: 1373 LKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKF 1432

Query: 1554 DNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQA-SPSRTPDLESSQKENTEGATKT 1612
            + ELAE+KKKAF EGKQQS MK+TLLERKLSKLESQ  SP++  D   +Q          
Sbjct: 1433 NLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQ---------- 1482

Query: 1613 TLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRS--LEPSFGSSNPFTLPT 1665
               PSKINL     SN + S     P GEKVLQ+N  +  +  +    NPFTL +
Sbjct: 1483 --VPSKINL-----SNINSS---SPPLGEKVLQLNYGANVVAETDNDDNPFTLQS 1527

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  209 bits (532), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 223/727 (30%), Positives = 360/727 (49%), Gaps = 66/727 (9%)

Query: 923  LTQECSSMNSLLQKQKAKCEDDQKIIQDKATE----TENLKNSLSSLENKITTLENEMVE 978
            L  +   +N+ L+ QK   ED++      A E    T+ L+ S    E+K+ +L  ++ E
Sbjct: 983  LKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEE 1042

Query: 979  KTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKT-----SLDGLKANIAAYEDAIS 1033
            + K   + +N Y+++L   +  S  I ++  + + Y+T     ++    A     E+ IS
Sbjct: 1043 QVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQIS 1102

Query: 1034 AYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTD---ETVV 1090
              +Q+  DE   +E Q++ FK+ I+        ++ K  F  S+ +T +ND D    + V
Sbjct: 1103 WQKQR--DE---YEKQIEFFKKRIEE-----ESEQNKMLFEQSKLTTQANDEDNAESSGV 1152

Query: 1091 NDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVS 1150
            N     N+L+L+LR ERD L  +L++++ E   LRE++ +++     T    + ++ E  
Sbjct: 1153 NSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETH 1212

Query: 1151 GEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDK 1210
                  EQHK  + QL +L+ L+E+N  L+ +  E   +N  + T++E L +++ PL+ +
Sbjct: 1213 NYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETE 1272

Query: 1211 VERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXX 1270
            ++ L N I EKD+QL++  EE+ERWK RS++IL K Q++D  EH  L EE +        
Sbjct: 1273 LQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEE 1332

Query: 1271 XXXXNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQE 1330
                NE+L +RF +LKKQAHEKL+A+K    SLT +I DL   K +L   L+ E++    
Sbjct: 1333 KSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLS 1392

Query: 1331 VESQLKQKPDNPDVITALEKELS--------------DSVENSKKIEENLQETVNSSLEL 1376
            +E +L+    N   I +++ +L               +SVE+SK+IEENL    NS +  
Sbjct: 1393 LEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENL----NSEI-- 1446

Query: 1377 NKKLTEEVNSLKSQL--ETLKNQNGVISVADGSAINSETIAHLKESFEVXXXXXXXXXXX 1434
             KKL EE + L+ +L  E L      I   D   ++      + ES +            
Sbjct: 1447 -KKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKFIE 1505

Query: 1435 XXXXXXXXXXXXXXXXXXXXYYDSKPTGGSEPIDIEK--MKSEWEEKQEEIIMQRIADAE 1492
                                Y     T   EP+ I++  ++ + EE+ E+   QRI +AE
Sbjct: 1506 EQTTEFKKKLQAEINKLKAEY----ETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAE 1561

Query: 1493 ENLKKRIRLPSEEKINRVIXXXXXXXXXXXXXXXXXQG---LTTE--TAIXXXXXXXXXX 1547
            ENLK+RIRLP+EEKIN+VI                 +    LT +               
Sbjct: 1562 ENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQE 1621

Query: 1548 XXXXXFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTE 1607
                 ++ EL  VKKKAF EG+QQ  MKT+ LE+K++KLES        DL+++ K NT 
Sbjct: 1622 ELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLES--------DLQNA-KSNT- 1671

Query: 1608 GATKTTL 1614
            GAT  T+
Sbjct: 1672 GATDNTI 1678

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  137 bits (344), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 164/608 (26%), Positives = 275/608 (45%), Gaps = 100/608 (16%)

Query: 1097 NELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTT 1156
            +++ ++LR ERD L  ++   ++++  +   +E++++ L+         E     +    
Sbjct: 758  DDIFVSLRYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFE----NQRAMV 813

Query: 1157 EQHKEA-------VKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKD 1209
            + HK+        +++L EL+ LKE N +L Q++   ++ N  +  +LE     + PL+ 
Sbjct: 814  QDHKKGNVNEETLIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLET 873

Query: 1210 KVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXX 1269
            K+  L   I +KD  + + +E+ E WK R  E+ +  +  D        E+L        
Sbjct: 874  KISELNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNND-------NEDLINLQKQVE 926

Query: 1270 XXXXXNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQ 1329
                 NE+L+DRFNRLKKQA+E+L A+K    +LT +  +L    + LE +L E+ +R +
Sbjct: 927  EKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFK 986

Query: 1330 EVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKS 1389
            E+E+ +  K      I  L+++L+++++ SKK EE L +TV+ S  L   L  E+ SL  
Sbjct: 987  ELENSISLKDQELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLN- 1045

Query: 1390 QLETLKNQNGVISVADGSAINSE--TIAHLKESFEVXXXXXXXXXXXXXXXXXXXXXXXX 1447
              E LK++   + + +    N++   IA L+E                            
Sbjct: 1046 --EKLKSKESSVGLQESEIENAKKILIAELEEKLNKTKSELDLKHKE------------- 1090

Query: 1448 XXXXXXXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKI 1507
                                +++ +K+E+E      I +R+A+AEE LK++IRLPSEEKI
Sbjct: 1091 --------------------ELKVLKTEYEGD----IQKRVAEAEEALKRKIRLPSEEKI 1126

Query: 1508 NRVIXXXXXXXXXXXXXXXXXQGLTTETAIXXXXXXXXXXXXXXXFDNELAEVKKKAFLE 1567
            N +I                 + L T +A                F++ L   KKKAF E
Sbjct: 1127 NTIIESKVADLEEDYK-----KKLETVSA-----ESTDIEKIKQEFEDNLVNAKKKAFEE 1176

Query: 1568 GKQQSQMKTTLLERKLSKLESQA-----------SPSRTPDLESSQKE--NTEGATKTTL 1614
            GKQQ+ MKT  LE K++KLESQ            +  +T D E S  E    E     T 
Sbjct: 1177 GKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSNPELDKQEAKPSFTF 1236

Query: 1615 GPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFG-SSNPFTL-PTQNKPAFL 1672
             P   N  PF+ +   DS             ++   ++P+F   +NPF + P    P+F 
Sbjct: 1237 SPPP-NSNPFTTTQDTDS------------PVSVFGIKPTFSLGANPFKISPVA--PSFQ 1281

Query: 1673 FASNNHSQ 1680
             A  + SQ
Sbjct: 1282 TARADSSQ 1289

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 131/468 (27%), Positives = 227/468 (48%), Gaps = 50/468 (10%)

Query: 371 RQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELT 430
           +Q + L+  ++ ++ ELE QLP + + K   + L+  L +   ++E  + +    +K + 
Sbjct: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268

Query: 431 TENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRN 490
           +  + + E++ +I  L  QR DLAHQ+Q+LL++  ++      L+  EI F++ +I    
Sbjct: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328

Query: 491 SQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDT------KSVQKIT 544
            +  SD Q +IS+RL+KF DI  LQ++NMEL  + RNLA  LES ++      ++    T
Sbjct: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388

Query: 545 RNESKEKIAKLQE-------SINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTE-ELRSQ 596
            NE+KE I  LQE        I  L SK+ +LQ         S+ N+ E         S 
Sbjct: 389 INEAKETILSLQEYNNVLKLEIGTLQSKISELQS--------SIPNSKESEKQHFNYHSN 440

Query: 597 LQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKK 656
           L K  E  +KL ++S+      E     LN+ I  L  E+ D+   + KE S   +A +K
Sbjct: 441 LVKDLE--SKLSKLSAYSQSTIEN----LNKDIQNLYNERTDILINLEKEKSSTILANEK 494

Query: 657 SKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQ--KEIE 714
             +L++S +LL  + +    K    E  LN+   E   +S  N+  + K ++L     + 
Sbjct: 495 LTLLQNSYDLLTLENEELSSKNSMLEQQLNEE--EKNLNSVLNDYIKCKTNLLDFTNRLT 552

Query: 715 SYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDS 774
               N L   ++N +   ++ +  ++ + L S+   ++  LE +I+         K  D 
Sbjct: 553 LLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEIS---------KYTDK 603

Query: 775 ISERLLKKSKI---------QLEDKIKEVKDFEAKKNSQINWYQKRLD 813
           + E  L  SK+         +L++K  E+ D  +    QI+WYQK+LD
Sbjct: 604 VKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLD 651

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  117 bits (292), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 175/663 (26%), Positives = 293/663 (44%), Gaps = 112/663 (16%)

Query: 1099 LILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQ 1158
            L++ LR ERD    +   +QR+V  L++ ++ +   L  T        +    + + T  
Sbjct: 999  LVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVT 1058

Query: 1159 HKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLK--- 1215
            H++ +++L  L   KE N  L + ++  +++          L+ E++ L++  E  K   
Sbjct: 1059 HEKIMRELEGLTNTKEENLYLDESIKSLNEDKRT-------LQEEVSRLRESEELAKKNS 1111

Query: 1216 NSIMEKD--QQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXX 1273
            ++I E++  Q++    +E+E+WKL  +++     +    E   L ++L            
Sbjct: 1112 SAISEQEWQQKIETYQQESEKWKLMCQQM----SENTATEIQNLQQQLETFKADIQLKTQ 1167

Query: 1274 XNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVES 1333
             N+DLNDRF RLKKQAHEKL+A+KA + SL  E+++L      L+  L+ +     + ES
Sbjct: 1168 ENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSES 1227

Query: 1334 QLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLET 1393
                         AL  +L +  + +K +E  L+ +V+SS +L   +T+E+ +LK     
Sbjct: 1228 N-----------AALILQLKEENKQAKSLELELRHSVDSSEKLIADMTKELTTLK----- 1271

Query: 1394 LKNQNGVISVADGSAINSETIAH----LKESFEVXXXXXXXXXXXXXXXXXXXXXXXXXX 1449
               +N +     GS +N E   H    LK  FE                           
Sbjct: 1272 ---ENPI----QGS-VNVEDYTHRLEQLKSEFE---------------DEKRVLIEKTTS 1308

Query: 1450 XXXXXYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINR 1509
                 +   K    +   ++E+++   EE+ E   +QRI +A+ENLKK IRLP+EEKI R
Sbjct: 1309 ELTERFEREKKELMNNNANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIER 1368

Query: 1510 VIXXXXXXXXXXXXXXXXXQG-------LTTETAIXXXXXXXXXXXXXXXFDNELAEVKK 1562
            VI                 Q        L+ +TA                 D EL  +KK
Sbjct: 1369 VIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFEL--LKK 1426

Query: 1563 KAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKINL- 1621
            KAF EG+QQ+ MKTTLLERK++KLE++              +   G  K+  G +KIN+ 
Sbjct: 1427 KAFEEGRQQASMKTTLLERKIAKLEARL-------------QGGTGPLKSANGLNKINID 1473

Query: 1622 LPFSMSN--TDDSIEKQVP---QGEKVLQINRRSLEPSFGSSNPFT-----LPTQ----- 1666
             P  ++   T++ +  + P    G     I++ +   +  S+N F+     +P Q     
Sbjct: 1474 SPLMVAGPLTNEPVLDEKPNAFAGATTTTISQPTSTTAKDSANAFSFNAQKVPAQPAFSS 1533

Query: 1667 -NKPAFLFASNNHSQ----TKKQDGLPINKSPFQTTLFAPFSSKTTTP------NGTPTL 1715
              +PAF F S N +     + K      + +PF+   F  F+S   TP      NGT   
Sbjct: 1534 RAQPAFSFGSFNKTSFSDLSHKNSVGAASGTPFR---FG-FASNPPTPFQNTAENGTDAK 1589

Query: 1716 KRS 1718
            ++S
Sbjct: 1590 RKS 1592

 Score =  114 bits (286), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 140/487 (28%), Positives = 257/487 (52%), Gaps = 69/487 (14%)

Query: 362 LKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERE 421
           L++ L+KE+++   L++Q+E FVIELE++LP +  L+ +N+ ++Q+L   T  + E E +
Sbjct: 287 LRKLLLKERKENVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIE-ESK 345

Query: 422 SDIRI-KELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT 480
           + IR  +EL++  +++    +  + L  QR DLAHQ+QFLL           +L P E++
Sbjct: 346 AKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLLT----VNSSDTVLPPSELS 401

Query: 481 FLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSV 540
           F++ II++ N     DSQ+I+S+RL++F +I  LQ+QNM+L++T R+L +++ES +  + 
Sbjct: 402 FIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADND 461

Query: 541 QKITRNESKEKIAKLQESINGLTSKLEK----LQKEKDAYKLLSLQNTG---EQTPTEEL 593
             +T   +K +I+KL++S   L S+++     ++  KD   L S  N     +Q   EEL
Sbjct: 462 SGLTLEAAKLQISKLEQSNAQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEEL 521

Query: 594 RSQLQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIA 653
            S+L    E            SH+  +K  VLN++I +  +   ++ N  IK T +  + 
Sbjct: 522 ESKLTDVGE------------SHV--QKINVLNKTIDR-NQSTINMLNEQIKNTVKSDM- 565

Query: 654 EKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEI 713
             KS+++    E L     ++ K+ E     L++ N+++ +  R+ +   A++S+   + 
Sbjct: 566 NAKSELIACKRENLSLTQQISTKQNE-----LDELNSKSAQKERDYQLKIAELSVAANKC 620

Query: 714 ESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHD 773
           +S+           EN+   L   T+EK  +  +  ++ ++++Q+   + + ET  KE +
Sbjct: 621 KSW-----------ENSFHLL---TEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELE 666

Query: 774 -SISERLL--KKSKIQLEDKI------------------KEVKDFEAKKNSQINWYQKRL 812
             IS + L  K+S+  L  KI                  +EVK F  K   QI WYQ+ +
Sbjct: 667 VKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNI 726

Query: 813 DSLTTTN 819
           D L+  N
Sbjct: 727 DELSEQN 733

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score =  102 bits (255), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 141/502 (28%), Positives = 263/502 (52%), Gaps = 35/502 (6%)

Query: 361 LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER 420
           +L++  +KE++QK  L+EQ+   + ELE  +P+++S K+R+  LE+EL     LLE  ++
Sbjct: 330 ILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKK 389

Query: 421 ESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT 480
           E+  +  EL  +         +IN L  QR  LA QV++LLL +   +     L   ++ 
Sbjct: 390 ENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLE 449

Query: 481 FLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSV 540
            L + + +  ++  SDS+KI+ ERL +F ++  LQ +NM+LL  +R LA + E  +  ++
Sbjct: 450 LLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNL 509

Query: 541 QKI------TRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELR 594
           ++I      T N++KE I  LQE    L S++++L  E      L++Q   E+T  E + 
Sbjct: 510 KQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDE------LAVQK-KEKTEKESI- 561

Query: 595 SQLQKKEEQLTK--LERMSSLDSHLAEEKAKV--LNQSIIKLKKEKYDLNNAIIKETSQR 650
           S + K E+  +   ++    L ++L   K  +  LN  I  L +   D+N ++ KE S R
Sbjct: 562 SAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSAR 621

Query: 651 AIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQ 710
            +AE +  +LE ++ LL  + +   ++    +  + D   +    SR+  + ++K+S  +
Sbjct: 622 KLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQFSYSSRDYISCKSKLSTAE 681

Query: 711 KEIESYK-QNLLQYSKDNENTL-SKLAAATQEKETLG---SRLSTVKNELEQKINLMQER 765
            EI S + +N L  S + + TL +K  A   E+  L    ++++++ NEL+    L++E 
Sbjct: 682 AEITSLRAENEL--SIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQ---TLLKET 736

Query: 766 ETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVE 825
           ++ Y +   IS     ++  QL+   + + + +++ +S+I WY+  +D L         E
Sbjct: 737 KSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYKATIDDLKAN----VFE 792

Query: 826 LNKELTKINIQRLKISDLEKTL 847
           LN+EL +   +  KI +  KTL
Sbjct: 793 LNEELKQ---KEEKIEEFSKTL 811

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 58/117 (49%), Gaps = 8/117 (6%)

Query: 1481 EEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXXXXXXXXXXXXXXQG----LTTE-- 1534
            EE I ++++ AEENLKKRIRLP+EEKIN +I                 +     L ++  
Sbjct: 1225 EEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDD 1284

Query: 1535 --TAIXXXXXXXXXXXXXXXFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQ 1589
                I               FD +L  V+KKAF EGKQ   MK+  LERK+S LE Q
Sbjct: 1285 KIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 166/696 (23%), Positives = 329/696 (47%), Gaps = 125/696 (17%)

Query: 164 NFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELR 223
           N K++   L++KY++ +K + + K+                                   
Sbjct: 153 NLKNDILILETKYDKLLKGYNDTKD----------------------------------- 177

Query: 224 NAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKS--LENDLNELKESFTRE 281
                  +L+++   LL  + +FK       T + DE+ ++K   + N  NE++    RE
Sbjct: 178 -------NLKEKISELLALDTSFKSE-----TKLKDEIIEEKDYLIANLTNEIESLKNRE 225

Query: 282 MTLTQHENDLLKEHIEYLKNXXXXXXXXXXXXXXDRLLHELVDIKKSLEKSELENVHLND 341
             + +H +D+   +IEY KN               RLL+E +   + +++ +L+   L  
Sbjct: 226 --INEHSSDI---NIEYGKNSSIIVDKQEYQ----RLLNEALINNEKIDEYDLKVARLTA 276

Query: 342 FIEQYLTE---NEESTSD-NELVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSL 397
            + ++ ++   N  ST D  + ++LK+++ K + Q+D LQE++E  + ELEN  P +N+ 
Sbjct: 277 TVNEFQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQ 336

Query: 398 KDRNQTLEQELMQITGLLEETERESDIRIKELTTENR----RLKEQTENINVLMSQRVDL 453
            D+   LE  L +     + T       IKE+  E +    RLK   + I  L  +  DL
Sbjct: 337 YDKINELELLLSK----EKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDL 392

Query: 454 AHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQND----SDSQKIISERLVKFH 509
            +Q+QF+L++  ++  +   LT +EI F+ K ++ + ++       +SQ IIS+RL++F 
Sbjct: 393 TNQIQFMLISNSIQNDKYGELTENEIKFI-KALREKGTETSFNELYNSQDIISDRLIRFE 451

Query: 510 DISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI------TRNESKEKIAKLQESINGLT 563
            +  LQ++NMEL+ T R + ++L++ + +   K         NE+KE+I K+    + L 
Sbjct: 452 SVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLK 511

Query: 564 SKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKKEEQLTKLERMSSLDSHLAEEKAK 623
            K+ +LQ++ +A + +S +  G ++   E  ++L  + ++L  L+ + +      ++ + 
Sbjct: 512 EKISELQQQLNANRPVSHEKNGHESVLAE--NKLYTEGDRLI-LDELKNNIPEFTKQASN 568

Query: 624 VLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYD-LAV---KKYE 679
           +++ +  +L      L N  ++ T+ R  A +   + +  L+LL  KYD L++   K  E
Sbjct: 569 IISMNFDQLTS----LYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKE 624

Query: 680 HYETLLNDHNAENIKHSRENETTQAKISILQKEIESYKQNLLQYSKDNENTLSKLAAATQ 739
           H E +      + I+  R++ET  + I+     ++  K +LL  + D    ++ L     
Sbjct: 625 HMEVI-----KDTIR--RKDETLNSTIA---NHVDC-KASLLSVTND----MNSLMTKYD 669

Query: 740 EKETLGSRLSTVKNELEQ-----KINLMQERETYYK-EHDSISERLLKKSKIQ------- 786
           E + L  + S + NEL+      K+ L+  +    + + +S   +    SKI        
Sbjct: 670 ELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNS 729

Query: 787 -----LEDKIKEVKDFEAKKNSQINWYQKRLDSLTT 817
                L  K +E++DF + KN +++WYQK+ D  +T
Sbjct: 730 NLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFST 765

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 91/173 (52%), Gaps = 31/173 (17%)

Query: 1168 ELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTL 1227
            E ++L ++N QLQ+KL  ND E +I    +E            +++L +SI+E  +    
Sbjct: 900  EHSSLMKSNRQLQEKL--NDSEKHIEQMDME------------IKKLNDSILEYQKNTLN 945

Query: 1228 LSEENERWKLRSREILMKRQQVDLEEHNKLMEELSXXXXXXXXXXXXNEDLNDRFNRLKK 1287
            ++ E    + R +E+  K ++  L+   K   E+             N++  DRFNRLKK
Sbjct: 946  ITSEITLLRNRCKELENKLKEASLQSDFKEKYEM---------KSKENDENIDRFNRLKK 996

Query: 1288 QAHEKLDAAKAQNASLTAEIT----DLIDAKSKLEIDLDEERKRIQEVESQLK 1336
            QA+ +L ++K +  +L  +I+    DL + +SKLE+    + K +QE+E+Q+K
Sbjct: 997  QANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEV----QSKTVQELETQIK 1045

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 126/496 (25%), Positives = 229/496 (46%), Gaps = 91/496 (18%)

Query: 362 LKEQLIKEKRQKDYLQEQVELFVIELENQLPTV------NSLKDRNQTLEQELMQITGLL 415
           +K +LIKEK +K  L+++   F+ ++E++LP +      N   + N+  EQ+++      
Sbjct: 286 IKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIH----- 340

Query: 416 EETERESDIRIKELTTENRRLKEQTEN----INVLMSQRVDLAHQVQFLLLNLD-LKKHQ 470
              E +S      L  EN+ LK +  +    +  L+ QR DL HQ+ +LL+    L +  
Sbjct: 341 ---EHDS------LKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDN 391

Query: 471 QHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAE 530
             +LT +E+ F+R ++    +   +++Q IISERL+KF ++S L  +N++L++  R L  
Sbjct: 392 NKILTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTN 451

Query: 531 QLESSDTKSVQKI--------TRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQ 582
           ++ES + ++ QK         + +E+K+++  L+E        + ++  EK   KLL  +
Sbjct: 452 KMESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEK---KLLEDK 508

Query: 583 NTGEQTPTEELRSQLQ-KKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNN 641
             G  +   EL   ++ K+E  L  LE   +             NQS++       + NN
Sbjct: 509 IHGLNSTVTELNKSMEIKREPTLKNLELQKT-------------NQSLL-------EKNN 548

Query: 642 AIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETL---LNDHNAENIKHSRE 698
            +  E S  +   K          +L +K+DL +K Y   + L   ++ +   ++     
Sbjct: 549 QLSIEISNASNENK----------ILKEKFDLLIKSYTELKELKSEISTYTKSSVISKDG 598

Query: 699 NETT--------QAKISILQKEIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLST 750
           NET         +AK   L+K  +  +    +   +N N   +L     E  T  S   T
Sbjct: 599 NETAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGT 658

Query: 751 V----KNELEQKINLMQERETYYKEHDSISERLLKKSKIQLEDKIK----EVKDFEAKKN 802
           +    +N+    IN    ++   +E +++  + L KS   LE KIK    ++K    K  
Sbjct: 659 IDSFNQNKNSIGINENTNKQLLKEELNTV--KSLNKS---LEAKIKLQENDIKILIEKYK 713

Query: 803 SQINWYQKRLDSLTTT 818
           SQI WYQ ++D + TT
Sbjct: 714 SQIKWYQDKIDEMNTT 729

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score = 76.6 bits (187), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 159/326 (48%), Gaps = 5/326 (1%)

Query: 1098 ELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTE 1157
            +L+  L  E+  L+ KL  SQ E   LREQ+   ++ +     +++  + EV+ E+    
Sbjct: 1016 DLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNN-- 1073

Query: 1158 QHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNS 1217
            +   A + + +L +LKE+N  L  +++     N  I  +L  LK +   ++ +++  +N 
Sbjct: 1074 ESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNV 1133

Query: 1218 IMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEE-HNKLMEELSXXXXXXXXXXXXNE 1276
            +  KD +L  L  E  R K  S ++     +    E    L   ++            N 
Sbjct: 1134 LSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANT 1193

Query: 1277 DLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLK 1336
            +L DRF RLK+QA E+LDA+K    SL   +  L   K+ L+  ++  +  + E+ ++++
Sbjct: 1194 ELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQ 1253

Query: 1337 QKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKN 1396
            +  +   V+  L+ EL+  +  +K IE  L ET  SS +L   L EE+ SLK +++ LK 
Sbjct: 1254 EHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKE 1313

Query: 1397 QNGVISVADGSAINSETIAHLKESFE 1422
             +   +   G+   S  +  ++++FE
Sbjct: 1314 ASS--AEPQGNEEMSGVVESMRKAFE 1337

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 64/145 (44%), Gaps = 39/145 (26%)

Query: 1557 LAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGP 1616
            L  VKK+AF EGKQQ+ MK ++LERK++KLE+++  +++                     
Sbjct: 1468 LIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGS------------------- 1508

Query: 1617 SKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGS--------SNPFTLPTQNK 1668
                     MS ++D+     P   KV Q N+  L  + GS        SNPFT P    
Sbjct: 1509 --------DMSVSEDAPRFVTPNNNKVQQANQPFL-ATAGSGFSVQSSESNPFTTPVSRG 1559

Query: 1669 PAFLFASNNHSQTKKQDGLPINKSP 1693
             A    +N  SQ+K      +N  P
Sbjct: 1560 AAH---TNASSQSKFAPTFLLNSQP 1581

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 55/182 (30%)

Query: 1457 DSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIXXXXX 1516
            +SK +  SE +D+E +K +WE++   II +RI  AE  L+KR++   E ++         
Sbjct: 812  NSKSSNNSELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEMEREM--------- 862

Query: 1517 XXXXXXXXXXXXQGLTTETAIXXXXXXXXXXXXXXXFDNELAEVKKKAFLEGKQQSQMKT 1576
                                                 D+++  V+ K F  GK  S+   
Sbjct: 863  -------------------------------------DDKMKVVEMKGFESGKASSEKTL 885

Query: 1577 TLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSMSNTDDSIEKQ 1636
             LLE KLS LE Q +       E S K NT   ++      KIN  PF+ S+ +  I   
Sbjct: 886  NLLEHKLSLLEKQNN-------EKSNKINTLIESENNNKTQKIN--PFTFSSVEPKISNL 936

Query: 1637 VP 1638
            V 
Sbjct: 937  VS 938

 Score = 40.0 bits (92), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 7/67 (10%)

Query: 1276 EDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAK-------SKLEIDLDEERKRI 1328
            E+ ND+F+RLK+QA+E+L+A+K     L+  +  L D +       SKLE+D++     +
Sbjct: 665  EEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNAL 724

Query: 1329 QEVESQL 1335
             E E +L
Sbjct: 725  VEAEKKL 731

 Score = 36.2 bits (82), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 52/93 (55%)

Query: 361 LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER 420
           +LK+ L+ EK     LQE++   ++EL  +LP++ SLK++N  L+     I    EE  +
Sbjct: 211 VLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQ 270

Query: 421 ESDIRIKELTTENRRLKEQTENINVLMSQRVDL 453
           +      ++ + N ++ +  +++  L+SQR +L
Sbjct: 271 QFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNL 303

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 43.9 bits (102), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 12/126 (9%)

Query: 1040 LDEKFNHE-LQVDEFKETIDNLNFQIHIQKGKRSFITSEGS----TTSND-TDETVVNDT 1093
            +DE+F+ E + V   K  I  + +Q+HI+ G     T + +    T +ND T + +V   
Sbjct: 1375 VDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMV--- 1431

Query: 1094 SDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEV-SGE 1152
            S K ELI        GL   LD +Q+   S++++ ENLK+S+ +T    +G+ESE   G+
Sbjct: 1432 SQKKELISKFLDCAVGLRNNLDEAQK--LSMQKKWENLKDSIAKTSAGNQGIESETEKGK 1489

Query: 1153 MTTTEQ 1158
            +T  EQ
Sbjct: 1490 ITKQEQ 1495

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 54/95 (56%), Gaps = 6/95 (6%)

Query: 123 LTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYERKVKD 182
           L +D++++ KK+      L +   AY E +N +I ++  +  F  + + LK +YE K + 
Sbjct: 788 LLADMVSMLKKVDIDQKELIRLDIAYFEAKNKDITMKDVVGFFDDKERELKDEYESKRRS 847

Query: 183 FEELK--NAYSS----MKTYEETSRKELSEMSNKF 211
           F ELK  + Y +    +K+Y+E +R +L+E + K+
Sbjct: 848 FTELKETSEYHTWLRQIKSYDEPTRDKLNEYAEKY 882

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 37.0 bits (84), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 123 LTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYE----- 177
           L   ++ L   ++SC   L K    YLE +N+++ +   +  F      LK ++E     
Sbjct: 764 LLKQMVGLMGNVNSCQKELFKADLEYLEAKNNDVSMNDVIGFFNDREDELKKEFETKRET 823

Query: 178 -RKVKDFEELKNAYSSMKTYEETSRKELSEMSNKF 211
            R+++D EE +     +++Y++++R++L++ +  +
Sbjct: 824 VRRLRDTEEYQQWIRQIRSYDDSTREKLNDYAEGY 858

>Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 36.2 bits (82), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 117/243 (48%), Gaps = 22/243 (9%)

Query: 576  YKLLSLQNTGEQTPTEELRSQLQKKEEQLTKLERMSSL-DSHLAEEKAKVLNQSIIKLKK 634
            Y L  L+N      T  L +QL K++       R+  L  S     + K  N  IIKLK 
Sbjct: 816  YHLQKLKNARVLGNTFRLYNQLVKEDPWFNLFIRIKPLLISSNDMSRTKKFNDLIIKLKN 875

Query: 635  EKYDLNNA--IIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAEN 692
            +  ++ +    ++E +Q+ I E     L+D+ ELL     L  +  +  E+LLN      
Sbjct: 876  DLQEMESKKKFLEEKNQKTINE-----LKDTQELL----SLEKENLKKNESLLN-----R 921

Query: 693  IKHSRENETTQAKISILQK-EIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTV 751
            +K S E    Q   ++L+K EI   K  ++Q  +  E  +  L  + +E+ET    L + 
Sbjct: 922  VKSSSETLQKQFDDTVLEKNEISKQKLQIMQNLEKAEQIIQDLQESIKERETALGNLRSK 981

Query: 752  KNELEQKINLMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKR 811
             +EL ++I+ +     Y    +  S+ L+K+SK++LE +IK +K     K ++IN + K+
Sbjct: 982  NDELIKQISNL----NYDISKEQNSQSLIKESKLKLESEIKRLKGVINLKENEINSFDKK 1037

Query: 812  LDS 814
            L S
Sbjct: 1038 LSS 1040

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 35.8 bits (81), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 86/345 (24%), Positives = 164/345 (47%), Gaps = 66/345 (19%)

Query: 878  INQYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQ 937
            I +Y + ++  EE    ++ + +K+  I++D    KE L+ +L++  QE    N  +++Q
Sbjct: 1459 IKEYSEKISSLEEKVETIKSEYDKEINILED---KKEVLESELSDKKQEIIDYNQKIKEQ 1515

Query: 938  KAKCEDDQKIIQDKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKL 997
            + K  + +K IQ         KN+L + E K   +EN++   T +  EKENT        
Sbjct: 1516 ETKATEKEKEIQVA-------KNALKNAEKKKKDIENDL-RTTIATVEKENT-------- 1559

Query: 998  SESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQV--DEFKE 1055
                     ++ EN+    S+D  + NI   ++ +S  +QK L +K + E++    E  +
Sbjct: 1560 --------TLKRENQLKSESIDKHQNNIHLLQEELS--KQKELADKKHDEIRKLEKENSK 1609

Query: 1056 TIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRRERDGLDIKLD 1115
             ID ++ ++  QK               DT+E + N   + + LI     ER  L  K++
Sbjct: 1610 MIDRID-KLEKQKA--------------DTNEKIANIEKENSSLI----SERKTLVEKVE 1650

Query: 1116 ISQREVYSLREQVE---NLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTL 1172
              Q E+ +L+  +E   +L +S DE +  F  LE+E+              + L ELN L
Sbjct: 1651 NFQDEITNLKSSLEKNDSLSSSHDELKDKFNELETELK-------------RNLTELNKL 1697

Query: 1173 KETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNS 1217
            +  N+QL  K+ E++++ +++  +L   +  +   +D + +LK+S
Sbjct: 1698 ESENKQLSDKVIEHEEKVSMVEKELSTAQKTLKEREDVINKLKDS 1742

>CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} similar
           to uniprot|P34216 Saccharomyces cerevisiae YBL047c
          Length = 1311

 Score = 35.0 bits (79), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (46%), Gaps = 27/184 (14%)

Query: 105 ASDDVIKENETFKRDHQLLTSDLMNLSKKLSS----CDAALEKKSTAYLELQNDNIDIRT 160
           A+ D+  + E+  R     T+DL NLS + +S       A EKKS    ELQ  N +++ 
Sbjct: 579 ANRDIFADGES-SRQLSTATTDLANLSNQANSLSNQAGIASEKKSKVSQELQRVN-EMKA 636

Query: 161 QLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSN 220
              N +S+   L++KY++ VK  EE++   +      ET  ++L  +   ++  ++    
Sbjct: 637 ---NIESKLATLRAKYDQDVKATEEMETQLTQTNREVETLNQQLGVVEANYHATESK--- 690

Query: 221 ELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTR 280
                   L+ L+ QYE   ++N   KE      T ++       S+E  LNE K+   +
Sbjct: 691 --------LNELKTQYEEAQQKNSKLKEDIANFNTMIA-------SMEAQLNEKKQVAKQ 735

Query: 281 EMTL 284
           E+++
Sbjct: 736 ELSV 739

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 34.7 bits (78), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 127 LMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYE------RKV 180
           +MNLS+ L     ++ +    ++EL+N    +   +  F ++ + L+ KY+       +V
Sbjct: 771 VMNLSR-LQEAQESVVRMGIKHIELRNRERSLNEVIGFFNAKEEELRGKYDEAKKAYAEV 829

Query: 181 KDFEELKNAYSSMKTYEETSRKELSEMSNKF 211
           KD  E +     +++Y +T R ELS  +NK+
Sbjct: 830 KDTAEFQAWMKEIRSYTDTERDELSVWANKY 860

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar to
            uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 3/101 (2%)

Query: 957  NLKNSLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKT 1016
            NL++  + LE K  +++NE+ EK + FE       E++H L    + I+  +A    +K 
Sbjct: 241  NLRDRYNDLEIKFLSIQNELDEKKQEFESSTARLNEEIHTL---KSTIDDKDATISEFKR 297

Query: 1017 SLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETI 1057
             L   +  +A+ +D      QKLL +    E  +D  KE I
Sbjct: 298  KLGNAEDQLASIDDQNGNQNQKLLHDLKEREDAIDGLKEDI 338

>NDAI0A00740 Chr1 complement(139425..143852) [4428 bp, 1475 aa] {ON} 
          Length = 1475

 Score = 33.9 bits (76), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 8/57 (14%)

Query: 1661 FT-LPTQNKPAFLFASNNH---SQTKKQDGLPINKSPFQTTLFA-PFSSKTTTPNGT 1712
            FT +P Q +PA  F +N     SQ K++ G P N  PF + ++  PFS K TTP  T
Sbjct: 1169 FTSIPPQQRPALAFFTNQPDSISQDKQEVGTPTN--PFSSEIYKEPFS-KVTTPKST 1222

>Suva_2.135 Chr2 (236118..237611) [1494 bp, 497 aa] {ON} YBR006W
           (REAL)
          Length = 497

 Score = 32.7 bits (73), Expect = 8.6,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 12/75 (16%)

Query: 184 EELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEEN 243
           E +  AY++ KTY+ TS +E S++  K Y L   + ++L               + LE  
Sbjct: 59  EAIDVAYAAFKTYKNTSPRERSKLLRKLYNLMLENLDDLATI------------ITLENG 106

Query: 244 KAFKERNNELTTTVS 258
           KA +E   E+    S
Sbjct: 107 KALEEAKGEIKYAAS 121

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score = 33.1 bits (74), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 669 KKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYK 717
           K Y    K+Y++  TLLND+ A NI+   EN      IS + + I+ Y+
Sbjct: 374 KDYHSIAKRYDYIRTLLNDYAAGNIE---ENAVLTTIISKIFRHIDMYR 419

>Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {ON}
            complement(51521..57427) [5907 nt, 1969 aa]
          Length = 1968

 Score = 33.1 bits (74), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 9/74 (12%)

Query: 760  NLMQERETYYKEHDSISERL------LKKSKIQLEDKIKEVKDFEAKKN---SQINWYQK 810
            N  Q+R+ + +E    SER+      + K K+ L   ++E   FE K N   S++++++K
Sbjct: 1888 NANQDRQQFEEEMHQFSERITTYEKQITKQKLDLNQMVRENSYFENKVNELESEVDYWKK 1947

Query: 811  RLDSLTTTNDKLQV 824
            R ++L T  +K+Q+
Sbjct: 1948 RFENLATGKEKVQM 1961

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.313 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 172,482,140
Number of extensions: 8161700
Number of successful extensions: 76651
Number of sequences better than 10.0: 3743
Number of HSP's gapped: 65188
Number of HSP's successfully gapped: 9226
Length of query: 1735
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1611
Effective length of database: 39,262,815
Effective search space: 63252394965
Effective search space used: 63252394965
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 73 (32.7 bits)