Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G002205.703ON59259230260.0
Suva_9.385.703ON56957716010.0
YIL150C (MCM10)5.703ON57157115870.0
Smik_9.195.703ON57257815800.0
Skud_9.185.703ON57157015590.0
NDAI0F002805.703ON61060115250.0
TDEL0B021705.703ON56758015090.0
KAFR0D022105.703ON58457714180.0
ZYRO0G06578g5.703ON56956614070.0
Kpol_1043.715.703ON58557913650.0
KNAG0L021505.703ON61660113660.0
CAGL0H06589g5.703ON58358212771e-170
TPHA0E002105.703ON54451012671e-169
TBLA0G010205.703ON59459712291e-162
KLTH0E01034g5.703ON58356711631e-152
SAKL0E14938g5.703ON57457611481e-150
Kwal_55.196915.703ON46646810401e-135
AFR287W5.703ON6115339521e-120
KLLA0A00572g5.703ON5775618611e-107
TBLA0I004107.395ON20041686.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G00220
         (592 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...  1170   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   621   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   615   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   613   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   605   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   592   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   585   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   550   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   546   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   530   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   530   0.0  
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   496   e-170
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   492   e-169
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   478   e-162
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   452   e-152
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   446   e-150
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   405   e-135
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   371   e-120
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   336   e-107
TBLA0I00410 Chr9 complement(66413..67015) [603 bp, 200 aa] {ON} ...    31   6.3  

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score = 1170 bits (3026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/592 (96%), Positives = 570/592 (96%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120
           LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120

Query: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180
           KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM
Sbjct: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180

Query: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240
           LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF
Sbjct: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240

Query: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300
           QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL
Sbjct: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300

Query: 301 EIGSSKDLGFCKVTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGAP 360
           EIGSSKDLGFCKVTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGAP
Sbjct: 301 EIGSSKDLGFCKVTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGAP 360

Query: 361 TKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRHFSNNNSAKAFFDE 420
           TKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRHFSNNNSAKAFFDE
Sbjct: 361 TKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRHFSNNNSAKAFFDE 420

Query: 421 KFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRATET 480
           KFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRATET
Sbjct: 421 KFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRATET 480

Query: 481 TLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRKSHVILA 540
           TLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRKSHVILA
Sbjct: 481 TLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRKSHVILA 540

Query: 541 PTXXXXXXXXXXXXXIWQENFGQKRKPISANDLLAIEGXXXXXXXXXELEII 592
           PT             IWQENFGQKRKPISANDLLAIEG         ELEII
Sbjct: 541 PTRNELIERRDRRERIWQENFGQKRKPISANDLLAIEGSSSDSSSDSELEII 592

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/577 (54%), Positives = 418/577 (72%), Gaps = 23/577 (3%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           M+DPRE+L  DPY+NV+SDE+DE+AI ++LE +ERK+Q L+ R+K KQ+ KK  DPNF+ 
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIP----HENPNELRIREKSGQLPSNTTTYFMEK 116
           ++VP SP KK+       +KKS + ++        N NE  + ++S + PSNTTTYFM+K
Sbjct: 61  VEVPQSPAKKS------IVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQK 114

Query: 117 FQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSE 176
           FQ +K+ E+ +I K E MMNARVHTF      +E+KPI  NE+E +SN+W+KKRYIP+ +
Sbjct: 115 FQDAKRNEDKQIAKYEGMMNARVHTFGTDN--KEYKPIITNELESFSNLWVKKRYIPEED 172

Query: 177 LRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFT 236
           L++ LH IKILRL+KLFAK+RPPKF EP Y+NWA +G+IS K D KFT+++KP K+  FT
Sbjct: 173 LKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFT 232

Query: 237 MTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDF 296
           +TDFQH LDVYIFGK GVERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDF
Sbjct: 233 ITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDF 292

Query: 297 KCILEIGSSKDLGFCKVTS-RNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSF 355
           KCILEIGSS+DLG+C + + +    C +PIN +    CDYH+E++FR   +KRIELNG +
Sbjct: 293 KCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGY 352

Query: 356 ALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRH-FSNNNSA 414
           ALGAPTKV++ P+LYR K GE      N+ N   S   G   +++   RN H F+N+NSA
Sbjct: 353 ALGAPTKVDSQPSLYRAK-GE------NQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSA 405

Query: 415 KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474
           KAFFDEKFQNPDML NL+SKRRKI D KK T + +EL K +  + S  L ++S  E ++M
Sbjct: 406 KAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKM 465

Query: 475 KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRK 534
           K+ TE+ LQ+G+IQRLGFDPTHGKI+ VL+++    E  ++  +++GKK  +NDLL ++K
Sbjct: 466 KQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGE--SMPNRINGKKTVINDLLQYKK 523

Query: 535 SHVILAPTXXXXXXXXXXXXXIWQENFGQKRKPISAN 571
             VILAP+             +WQ +FG K   ++++
Sbjct: 524 EKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASD 560

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/571 (54%), Positives = 415/571 (72%), Gaps = 23/571 (4%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           MNDPRE+L  DPY+N++SDE+DE+AI R+LE +ERKRQ L+ R+K KQE KK  DPNF+ 
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNE-MEIPHENPNELRIREKSGQL--PSNTTTYFMEKF 117
           ++VP SP   T+  V V    +T +  +    N NE+R+ +   Q   P++TTTYFMEKF
Sbjct: 61  IEVPQSP---TKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKF 117

Query: 118 QKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSEL 177
           Q +KK E+ +I K E+MMNARVHTF     ++++ PI  NE+E +SN+W+KKRYIP+ +L
Sbjct: 118 QNAKKNEDKQIAKFESMMNARVHTFSTD--EKKYVPIITNELESFSNLWVKKRYIPEDDL 175

Query: 178 RKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTM 237
           ++ LH IKILRL KLFAK+RPPKF EP+Y+NWA +G+IS K D KFT+++KP K+  FT+
Sbjct: 176 KRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 235

Query: 238 TDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFK 297
           TDFQH LDVYIFGK GVERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDFK
Sbjct: 236 TDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFK 295

Query: 298 CILEIGSSKDLGFCKVTS-RNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFA 356
           CILEIGSS+DLG+C + + +    C +PIN+S    CDYH+E++FR  ++KRIELNG +A
Sbjct: 296 CILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYA 355

Query: 357 LGAPTKVENNPTLYRKKNGETRHS--RKNRQNFSVSASFGSINKDQFDLRNRHFSNNNSA 414
           LGAPTKV++ P+LY+ K GE   +  +  R+  S         +++    + +F+N+NSA
Sbjct: 356 LGAPTKVDSQPSLYKAK-GENGFNIIKGTRKRLSEE-------EERLKKSSHNFTNSNSA 407

Query: 415 KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474
           KAFFDEKFQNPDML NL++KRRKI + KK T + +EL K +  R S  L ++S  E ++M
Sbjct: 408 KAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKM 467

Query: 475 KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEE-KDTLSEQMSGKKDKVNDLLHFR 533
           KR TE+ LQ+G+IQRLGFDPTHGKI+ VL+++ S  E K+ L   +  KK  +NDLLH++
Sbjct: 468 KRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNL---LGKKKTVINDLLHYK 524

Query: 534 KSHVILAPTXXXXXXXXXXXXXIWQENFGQK 564
           K  VILAP+             +WQ++FG K
Sbjct: 525 KEKVILAPSKNEWFKKRSHREEVWQKHFGSK 555

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/578 (53%), Positives = 414/578 (71%), Gaps = 15/578 (2%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           M+DPRE+L  DPY++V+SDE+DE+AI ++LE +ERKRQ L+ R+K KQ  KK  DPNF+ 
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120
           ++VP SP K    +      K    +E  + N + L   +K  +LP NTTTYFM+KFQ +
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180
           KK+E+ +I K E+MM+ARVHTF     K  +KPI  NE+E +SN+W+KKRYIP+ +L++ 
Sbjct: 121 KKDEDRQIAKFESMMDARVHTFGTDNKK--YKPIIANELEGFSNLWVKKRYIPEDDLKRS 178

Query: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240
           LH IKILRL KLFAKVRPPKF  P+Y+NWA +G+IS K D KFT+++KP K+  FT+TDF
Sbjct: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238

Query: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300
           QH LDVYIFGK GVERYYNLR+GD+IAILNPEV PWRPSG+G FIKSFNLRI+HDFKCIL
Sbjct: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298

Query: 301 EIGSSKDLGFCK-VTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGA 359
           EIGSS+DLG+C  V ++    C +PIN+S    CDYH+E++FR  ++KRIELNG +ALGA
Sbjct: 299 EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358

Query: 360 PTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRH-FSNNNSAKAFF 418
           PTKV + P+LY+ K GE      NR N    A  G   +++   ++ H F+N+NSAKAFF
Sbjct: 359 PTKVNSQPSLYKAK-GE------NRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFF 411

Query: 419 DEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRAT 478
           DEKFQNPDML NL++KRRKI D KK   +++EL+K +  + S  L ++S  E ++MK+ T
Sbjct: 412 DEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTT 471

Query: 479 ETTLQSGVIQRLGFDPTHGKIANVLRTT-HSKEEKDTLSEQMSGKKDKVNDLLHFRKSHV 537
           E  LQ+G+IQRLGFDPTHG+I+ VL+++    E K+ L   ++GKK  +NDLLH++K  V
Sbjct: 472 ENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNL---LNGKKTVINDLLHYKKEKV 528

Query: 538 ILAPTXXXXXXXXXXXXXIWQENFGQKRKPISANDLLA 575
           ILAP+             +WQ +FG K +   A+D  A
Sbjct: 529 ILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASA 566

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/570 (53%), Positives = 405/570 (71%), Gaps = 21/570 (3%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           M+DPRE L  DPY+NV+SDE DE+ I ++LE +ERK+Q L+ R+K KQE K+  DPNF+ 
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIRE--KSGQLPSNTTTYFMEKFQ 118
           ++VP SP K    N+  +      +M     N N+L++ +  +  +LPSNTT YFM+KFQ
Sbjct: 61  IEVPQSPAK--NRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQ 118

Query: 119 KSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELR 178
            +K+ EE +  K ENMMNARVHTF     K+E++    NE+EE+SNIW+KKRYIP+ +L+
Sbjct: 119 NAKRNEEKQRAKYENMMNARVHTFGTD--KKEYRATIANELEEFSNIWVKKRYIPEDDLK 176

Query: 179 KMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMT 238
           + LH IKILRL KLFAK+RPPKF EP Y+NWA +G+IS K D KFT++DKP K+  FT+T
Sbjct: 177 RALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTIT 236

Query: 239 DFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKC 298
           DFQH LDVYIFGK  VERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDFKC
Sbjct: 237 DFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKC 296

Query: 299 ILEIGSSKDLGFCKVTSRNGTL-CNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFAL 357
           ILEIGSS+DLG+C + +R     C +PIN++    CDYH+E++FR  ++KRIELNG +AL
Sbjct: 297 ILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYAL 356

Query: 358 GAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFG---SINKDQFDLRNRHFSNNNSA 414
           GAPTKV+  PTLYR K GE         NF++  S     S  +++    + +F N+NSA
Sbjct: 357 GAPTKVDAQPTLYRAK-GEN--------NFNLVRSIRKTLSEEEERMKKNSHNFRNSNSA 407

Query: 415 KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474
           KAFFDEKFQNPDML NL+SKRRKI D KK T + +EL K +  + S  L ++   E +++
Sbjct: 408 KAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKI 467

Query: 475 KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRK 534
           K+ TE+ LQ+G++QRLGFDPTHGKI+ VL+++    E    ++ M GKK  ++DLL+++K
Sbjct: 468 KQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGE--PRNKVMGGKKTVIDDLLNYKK 525

Query: 535 SHVILAPTXXXXXXXXXXXXXIWQENFGQK 564
             VILAP+             +WQ++FG K
Sbjct: 526 EKVILAPSKNEWFKKRSHREEVWQKHFGSK 555

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/601 (52%), Positives = 415/601 (69%), Gaps = 46/601 (7%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           MNDPRE    DP+ ++S  E++E+A+L +LE+++R++ DLL R+KE +E +K  DPNF +
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEME---------------IPHENPNELRIREKSG-- 103
           +Q+P +P +K  TN+  + +      +               +P  NPNEL++RE+    
Sbjct: 61  VQIPGTPEEKN-TNIFTSEQTILQNRDRKEEEVEEEEFSGERLP--NPNELKVREREENL 117

Query: 104 -QLPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQ-----DQGGKQEFKPIQVN 157
            +LPSNTT+YFMEKFQ  KK+EE +  + E M+ ARVH FQ      +  K E++P   N
Sbjct: 118 EKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAAN 177

Query: 158 EIEEYSNIWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISA 217
           E+EEYS + ++KRYIP+ EL  +  NIKILRL+KLFAKVRPPKF EPQYSNW  LGII+ 
Sbjct: 178 EVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQ 237

Query: 218 KGDAKFTTTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWR 277
           KG  KFT++DKPKKY KFT++DF++ +D++IF K  VERYYNLR+GD+IAILNPEV PWR
Sbjct: 238 KGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWR 297

Query: 278 PSG--KGQFIKSFNLRINHDFKCILEIGSSKDLGFCKVTSR---NGTLCNTPINMSKEDR 332
           PS    G  IKSFNLRINH++ CI+E+G SKDLGFC + ++   +GT C+TPI++SKEDR
Sbjct: 298 PSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGT-CHTPIDISKEDR 356

Query: 333 CDYHQEIRFRDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSAS 392
           C YHQEIRFR+N SKRIELNGSFALGAP KV   P LYR  N   R      +   V  S
Sbjct: 357 CSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGS 416

Query: 393 FGSINKDQFDL----RNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRID 448
              I K++  L    R R+FS+NNSAKAFFDEKFQNPDML NL++KRRKI DDK+   +D
Sbjct: 417 --EIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLD 474

Query: 449 KELSKAIGNRASDDL-GERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTH 507
           +ELSKAI N++S+ L G ++  E  +MK ATETTLQ+GVIQRLGFDPTHGKIA VL+T  
Sbjct: 475 QELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTG- 533

Query: 508 SKEEKDTLSEQM--SGKKDKVNDLLHFRKSHVILAPTXXXXXXXXXXXXXIWQENFGQKR 565
               KD+  + +  + K +KV DLL F+K  V+LAP              +WQ++FG  +
Sbjct: 534 ----KDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGK 589

Query: 566 K 566
           +
Sbjct: 590 R 590

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/580 (51%), Positives = 411/580 (70%), Gaps = 18/580 (3%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           MNDPREV+ TDP+  ++SDE+D+  +   +  +ER+++DL+ R+K K++ K   DPNF  
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSK-DPNFDA 59

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120
           +QV  SPVKK   ++ V   ++   ++I  EN NE ++  +S Q+P+NTT+YF++ F+ S
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVLDI--ENLNEKKVESRS-QIPANTTSYFIDNFRNS 116

Query: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180
           KKEE+   Q+ + +++ RVHTF+   G  +FK + V E+EEYS++W+K+RYI Q +LRK+
Sbjct: 117 KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240
           LH +KILRLSKLFAK++PPKF+EPQYSNWA +GIISAKG  KF+++ KP KY KFT+TDF
Sbjct: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300
           Q+ LDVY+FGK GVERYYNLRVGD++AILNPEV PWRPS KG FIKSFNLRI+HDF CIL
Sbjct: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 301 EIGSSKDLGFCKVTSRN-GTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGA 359
           EIG S+D+ +CK  +++    C TPIN +KE  CD+H+EI+FR N++KRIELNGSFALGA
Sbjct: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 360 PTKVENNPTLYRKKNGETRHSRKNRQNFSVSASF--GSINKDQFDLRNRHFSNNNSAKAF 417
           PTKV++ P LYR+K+          +NF V  +    S+ K+  DLR  HFSN N+AKAF
Sbjct: 357 PTKVDSGPALYREKSAGA------HRNFKVLPNHYQKSVGKNS-DLRGIHFSNGNAAKAF 409

Query: 418 FDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRA 477
           F+++FQNPD+LNNL+SKRRK QDDKK   + ++L +     A+ ++ E+ + + +++   
Sbjct: 410 FNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEI-EKGSKKYEEICET 468

Query: 478 TETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRKSHV 537
           TE TLQSG+IQ LGFDPTHG+I NVL+     +  +    Q++ K+ +V+ LL F+K HV
Sbjct: 469 TEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNG---QLNKKQKEVSSLLKFKKEHV 525

Query: 538 ILAPTXXXXXXXXXXXXXIWQENFGQKRKPISANDLLAIE 577
            L P               WQENFG K   +S++    IE
Sbjct: 526 ELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSDSDSDIE 565

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/577 (49%), Positives = 400/577 (69%), Gaps = 23/577 (3%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           M+DPRE+   D Y N++ D++D   I  +LE +E  ++DLL R+  K+   +  DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  LQVPCSPVKKTETNVPVAMK----KSTNEMEIPHENPNEL----RIREKSGQL-PSNTTT 111
           +QVP SPVKK E  + V  K    K+ N  E  +ENPNEL    R ++++ +L  SN +T
Sbjct: 61  VQVPASPVKKHELQL-VEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNAST 119

Query: 112 -YFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKR 170
            YFMEKF+ +K++E+  I+K E+MM +RVHTF     K E++ + V+E+E+YSN+W+ KR
Sbjct: 120 EYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKR 179

Query: 171 YIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPK 230
           Y P S L+ MLH +KILRL+KLFAKVRPPKF EPQYSNW  +GI+S K D KFT ++KP+
Sbjct: 180 YTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQ 239

Query: 231 KYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNL 290
           KYLKFT+TDF+HK+D YIFGK GVERYYNLR+GD+IA+LNPE+ PWRPSGK  +IKSFNL
Sbjct: 240 KYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNL 299

Query: 291 RINHDFKCILEIGSSKDLGFCKVTSRNGTL-CNTPINMSKEDRCDYHQEIRFRDNNSKRI 349
           RI+H +KCILEIG S+DL  C +  R+ +  C  PIN   +  C+YH+E+  R   SKR+
Sbjct: 300 RISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRL 359

Query: 350 ELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINK---DQFDLRNR 406
           +L+G +ALGAPTK+E+ P LYR   G T  + K  QNF ++ S+   N    D++  +++
Sbjct: 360 DLSGQYALGAPTKLESQPALYR---GHTAQNVK-IQNFKLTPSYSQNNPHLIDKYGEKSK 415

Query: 407 HFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGER 466
            FSN N+AKAFFD++FQNPDM++NL++KRRKI + +K   +++EL + +  R   DL  +
Sbjct: 416 FFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLL--RKDQDLEGK 473

Query: 467 SAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKV 526
           +  EV++MK+ T+ TLQSG+ Q++GFDPT GKI+ +L+  + +  KD   + +S K   V
Sbjct: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILK--NKERSKDGEPKFLSQKDRTV 531

Query: 527 NDLLHFRKSHVILAPTXXXXXXXXXXXXXIWQENFGQ 563
           +DL+ F+K ++ILAP+             +WQENFGQ
Sbjct: 532 DDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQ 568

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/566 (48%), Positives = 395/566 (69%), Gaps = 18/566 (3%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           M DPREVL  D YD ++S+ ++E  I   +  +ER+++DLL R+  K+ + K LDPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120
           +QV  SP K T + +P  +++     E+ +EN NEL+ + +  Q+P+NTT++F+EK+  S
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQE-QIPANTTSFFIEKYSTS 119

Query: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180
           K++++ +++  E++++ RVHTFQ    + E+KPI  NE+EE+SN+W+ KRYIP+ E R +
Sbjct: 120 KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179

Query: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240
             NIKILRLSKLFAKV+PPKF+EP YSNWA +G+IS KG+ KFT+   PKKY KFT+T+F
Sbjct: 180 FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239

Query: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300
           Q+ +D YIFGK GVERYYNLRVGD+IAILNP+V PWRPSG    IKSFNLRI+H F+CIL
Sbjct: 240 QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299

Query: 301 EIGSSKDLGFCKVTSRN-GTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGA 359
           EIG+S+DLG+C + +++   +C  PIN  KED C+YH+E++FR  N+KR+EL+G++ALGA
Sbjct: 300 EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359

Query: 360 PTKVENNPTLYRKKNGETRHSRKN-RQNFSVSASFGSINKD--QFDLRNRHFSNNNSAKA 416
           PT+++  P LYR  +     S+KN   N   + + G  NK+    D+  RHFSN N+AKA
Sbjct: 360 PTRIDAQPALYRGGS-----SQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKA 414

Query: 417 FFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKR 476
           FFDE+FQNP+ L NL +KRRK++D++K   +++EL K     +  D+  +SA E+ ++KR
Sbjct: 415 FFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKK----NSELDIKHKSAEEIDEIKR 470

Query: 477 ATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRKSH 536
            TE+T+ SG+++ LGFDPT GKIA+V +   S  +K  L+E+ S     V  LL F+K +
Sbjct: 471 TTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSS----VASLLSFKKDN 526

Query: 537 VILAPTXXXXXXXXXXXXXIWQENFG 562
           V L P+             +W+E+FG
Sbjct: 527 VKLKPSKEILIKQKRRRERVWKEHFG 552

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/579 (51%), Positives = 392/579 (67%), Gaps = 22/579 (3%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           MNDPRE    D Y N+SSDE +++ I   L+ +ER++QDLL R+K+K+E K  LDPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120
           +QVP SP K     +    K   N  E   ENPNE+ +  K       TT+YFMEKF  S
Sbjct: 59  VQVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDS-NYGTTSYFMEKFYNS 117

Query: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180
           KK+ E K+    +MM++RVHTF   G K+EFKP  V+E+++YSN+WL+ RYIP  EL  M
Sbjct: 118 KKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLM 177

Query: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240
           L +IKILRL KLFAKVRPPKF+EPQYSNW   GII++K D K+T++ KP KY KFT++DF
Sbjct: 178 LLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDF 237

Query: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPS----GKGQFIKSFNLRINHDF 296
           QH LDV+IFG  GVE+YYNLRVGDV+AILNPE+ PWRPS    G G  IKSFNLRI+H F
Sbjct: 238 QHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKF 297

Query: 297 KCILEIGSSKDLGFCKV-TSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSF 355
            CILEIG+S+DLG+C +  +   TLC TPIN SKED+C YH+EI+FR   S R+EL+G++
Sbjct: 298 DCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTY 357

Query: 356 ALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKD--QFDLRNRHFSNNNS 413
           ALGAPTKV+  P LY+ + G + +SR  +    VS S     KD  + + R  HFS  NS
Sbjct: 358 ALGAPTKVDARPALYQNR-GTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNS 416

Query: 414 AKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQ 473
           AKAFFDE FQNPD+LNNL+SKRRKI+D K    +++ L KA+ N       ++ +   K 
Sbjct: 417 AKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALKNTV-----DKESKNFKN 467

Query: 474 MKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFR 533
           +K AT+ TLQ+G++QRLGFDPT GK+++V+R ++S+ E  T   QM  KK+ ++DL+ FR
Sbjct: 468 LKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEV-TNKYQME-KKEALDDLMTFR 525

Query: 534 KSHVILAPTXXXXXXXXXXXXXIWQENFGQKRKPISAND 572
           K  V L P+              W++ FG+++  I  ND
Sbjct: 526 KDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNND 564

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/601 (44%), Positives = 398/601 (66%), Gaps = 35/601 (5%)

Query: 3   DPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQ-QL 61
           DPR+V+T DPYDN++SDE +E  I R+LE +ER+++DL  R+K K+   K  D N Q  +
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 62  QVPCSPVKKTETNVPVAMKKSTNEMEIPHENP------------NELRIREKSG----QL 105
           QVP SP K++ + + VA K+      I   N             NE R  +  G    Q 
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 106 PSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNI 165
            + TT+YF+EKFQ+SKK E+ +I+  E M++ARVHTFQ  G  +EF+   VNE+E++S++
Sbjct: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQ--GVDKEFQLEAVNELEQFSDL 181

Query: 166 WLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTT 225
           W+ KRYIP+  L + L ++K+LRL+KLFAKVRPPKF EPQYSNWA L IIS K + KFTT
Sbjct: 182 WISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTT 241

Query: 226 TDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQ-- 283
           +  P+K+++FT+T+FQ +LD+++FG  GV+RYYNLR GD++A+LNPE+ PWRPSG  Q  
Sbjct: 242 SKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQT 301

Query: 284 -FIKSFNLRINHDFKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRF 341
             IKSFNL+I H FKCILEIG S+DLG+C VT + +   C + IN++++  C+YH+E++ 
Sbjct: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361

Query: 342 RDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHS-----RKNRQNFSVSASF--- 393
           R N+SKR++LNG FALGAPTKV   P L+R+ +G  + S     R   + F    S+   
Sbjct: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSR 421

Query: 394 ---GSINKDQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKE 450
              G  +++ + L+ + F+++N+AKAFFD++FQNPDML+NL++KRRK+QD KK  ++D++
Sbjct: 422 HGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDRK 481

Query: 451 LSKAIGNRASDDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKE 510
           L + +         +++  E+  +KR TET L +G+IQRLGFDPTHG+ A+V++   S+ 
Sbjct: 482 LKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSER 541

Query: 511 EKDTLSE-QMSGKKDKVNDLLHFRKSHVILAPTXXXXXXXXXXXXXIWQENFGQKRKPIS 569
                 +  +S K++ VN+LL +++    L P+             +W+E FG+K  P+ 
Sbjct: 542 GSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPVD 601

Query: 570 A 570
           +
Sbjct: 602 S 602

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  496 bits (1277), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 273/582 (46%), Positives = 380/582 (65%), Gaps = 40/582 (6%)

Query: 2   NDPREVLTTDPYDNVSSDEQDEEA-ILRDLENVERKRQDLLNRIKEKQES--KKLLDPNF 58
           NDPREV   DPY ++S D++++E+ I R+LE +ERK+QDL++R+KE +     K LDPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  Q------QLQVPCSPVKKT-------ETNVP-VAMKKSTNEMEIPHENPNELRIREKSGQ 104
           +      +++VP SP +++       + NVP V   ++ N  +    NPNE  I  K   
Sbjct: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKK---ANPNEEDIVRKELD 123

Query: 105 LPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSN 164
           + + TT+YF  KF+ SK +E   +   + MM+AR HTF       + K IQ +E+E YSN
Sbjct: 124 VVA-TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSN 182

Query: 165 IWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFT 224
             +KKRYIP+ E+ K+LH IKILRL+KLFAKVRPP FSEPQYSNW A+G IS+K D K T
Sbjct: 183 FHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLT 242

Query: 225 TTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQF 284
              KP KY KFT+TDF+H LDVY+FGK  VERYYNLRVGD+IA+LNPE+ PWRPSG    
Sbjct: 243 NAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNG 302

Query: 285 IKSFNLRINHDFKCILEIGSSKDLGFCKVTSRNGT-LCNTPINMSKEDRCDYHQEIRFRD 343
           IKSFNLRI HDF CILEIG+S+DLG+C++ +   + +CN+PIN   +  C++H+E++ R 
Sbjct: 303 IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRS 362

Query: 344 NNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVS--ASFGSINKDQF 401
             SKRIEL+GS+ALGAPTKV   P++Y+  N     +    + FS++   S     K++ 
Sbjct: 363 TASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEKH 422

Query: 402 DLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAI-GNRAS 460
           ++   HFSN  +AKAFFD+ FQ+P +L NL SKRRKI    K +++D+ L KA+ G  AS
Sbjct: 423 EIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDAS 478

Query: 461 DDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVL-RTTHSKEEKDTLSEQM 519
                  +   +Q+K  TE TLQ+GVIQRLGFDP+ G+IA VL ++  +K +  T+S++M
Sbjct: 479 ------QSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKM 532

Query: 520 SGKKDKVNDLLHFRKSHVILAPTXXXXXXXXXXXXXIWQENF 561
                 +NDL+HF+K  + L P+             IW+++F
Sbjct: 533 G----LINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF 570

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  492 bits (1267), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 249/510 (48%), Positives = 351/510 (68%), Gaps = 21/510 (4%)

Query: 41  LNRIKEKQESKKLLDPNFQQLQVPCSPVKKTE----TNVPVAMKKSTNEMEIPHENPNEL 96
           + R+K K+E +K LDPNF  +Q+  SP KK      T  P+ +K+   ++     NPNE 
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV-----NPNEA 55

Query: 97  RIREKSGQLPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQV 156
           ++   +  LP+NTT+YFM+ F K+KKEE  ++++ +  M++RVH+F      ++++ I V
Sbjct: 56  KVVS-NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIV 114

Query: 157 NEIEEYSNIWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIIS 216
            E+EEYS   + KRY+P+ E+ K LHNIKILRL+KLFAK+RPPKFSEP Y+NWA  GII 
Sbjct: 115 EELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIIC 174

Query: 217 AKGDAKFTTTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPW 276
           +K D K T++  P K+ KFT+T+FQH LD++IFG  GVE+YYNLRVGD+I ILNPEV PW
Sbjct: 175 SKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPW 234

Query: 277 RPSGKGQFIKSFNLRINHDFKCILEIGSSKDLGFC-KVTSRNGTLCNTPINMSKEDRCDY 335
           RP  KG  IKSFNLRI+H F CILEI  SKD+ +C ++  + G  CNTPIN SK+D CDY
Sbjct: 235 RPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDY 294

Query: 336 HQEIRFRDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGS 395
           H+E++FR  N+KR+EL+G++ALGAPT++++ P LYR KN     + K   NF++ A    
Sbjct: 295 HKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS---NLKPGNNFNIVADRRY 351

Query: 396 INK---DQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELS 452
           + K   D  + +  HFS++NSAKAFFDE FQNPDML NL +KRRKI+DDK+   + + L 
Sbjct: 352 MKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALR 411

Query: 453 KAIGNRASDDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEK 512
           +++GN +   L ++S  E++ M+  T+ TLQ+G IQ+LGFDPT G+I  VL  +  K  +
Sbjct: 412 ESVGN-SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADKSTQ 470

Query: 513 DTLSEQMSGKKDKVNDLLHFRKSHVILAPT 542
             L +Q   K + + +L+ F+KS V L P+
Sbjct: 471 SKLQKQ---KSNAMENLVTFKKSSVNLKPS 497

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  478 bits (1229), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 248/597 (41%), Positives = 374/597 (62%), Gaps = 30/597 (5%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNF-- 58
           MNDPREV   D +DN+S DE +E  + + +E +ER+++DL  R++ K++  + +DPNF  
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 59  ----------QQLQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREK--SGQLP 106
                      ++QVP SP K    +  +A    T +     +NPNEL+++ +     +P
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 107 SNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQ-EFKPIQVNEIEEYSNI 165
           + +T YFM  F  SKK E  KIQ  E +M+ARVH+F +    Q E + I V E E+YS +
Sbjct: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 166 WLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTT 225
           W+ +RY+ +  + ++L +IKILRL+KLFAK+RPPKF  PQYSNW A+G+I+ K   K T+
Sbjct: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 226 TDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFI 285
           ++ P+KY KFT+ DFQ  + +++F +  + +YYNLRVGD+I ILNP + PWRPS +  +I
Sbjct: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300

Query: 286 KSFNLRINHDFKCILEIGSSKDLGFCK--VTSRNGTLCNTPINMSKEDRCDYHQEIRFRD 343
           KSFNL I   + CI+EIG S+DLG+C   V S+ G  C TPIN +K+  C++H+E  FR+
Sbjct: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360

Query: 344 NNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDL 403
             +KRIELNGSFALGAPTK + NP+LY+KK         ++  F+V     +  +    L
Sbjct: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIY----SKNQFNVVRRRNARKEGDSKL 416

Query: 404 RNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIG--NRASD 461
            N +F + N AKAFF+++FQNPD+++NL+SKRRK++D K+ + + KEL+K +   +  S 
Sbjct: 417 HNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 476

Query: 462 DLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSG 521
           +L  +S  +VK+M+  TE  +Q G+++ +G+DPTHGK+  +++ ++ K+   T     S 
Sbjct: 477 NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYT-----SN 531

Query: 522 KKDKVNDLLHFRKSHVILAPTXXXXXXXXXXXXXIWQENFGQKRKPISANDLLAIEG 578
           + + VNDLLHF+K  V L P              IW E FG + K  S  D++   G
Sbjct: 532 RSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSK--SNRDIILSSG 586

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  452 bits (1163), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 239/567 (42%), Positives = 352/567 (62%), Gaps = 23/567 (4%)

Query: 3   DPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQLQ 62
           DPREVL  D +D V+SDE ++  I + L+ +ER+++DL +R+++K   KK    + ++++
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 63  VPCSPVKKTETNV-PVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKSK 121
           VP SP ++ ++   P + K S       + N + + +  K+G  PSNTT+YF+E F  ++
Sbjct: 66  VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNG--PSNTTSYFVENFVNAR 123

Query: 122 KEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKML 181
           K EE KIQ   ++++ RVHTF+     +  +P+ V+E E YS   + +RY+  SEL +++
Sbjct: 124 KVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIM 183

Query: 182 HNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDFQ 241
             IK+LRL KLF+KVRPPKF+EP Y+NW A+GIIS K + K T++ KP KY K T+TDF 
Sbjct: 184 REIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFT 243

Query: 242 HKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSG------KGQFIKSFNLRINHD 295
           H LD+YIF    VE+YYNLRVGD+IAILNP++ PWRPS        G  +KSFNL I H+
Sbjct: 244 HNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHN 303

Query: 296 FKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGS 354
           F C+LEIG+SKDLGFC++ ++     C  PIN +  DRC+YHQ++RFR  N++R+ELNGS
Sbjct: 304 FDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGS 363

Query: 355 FALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRHFSNNNSA 414
            +L +P K      LY   +G  R  +      +  A  G      F      FSN N A
Sbjct: 364 TSLRSPVKNGKKQALY-GTSGVKRKLQLLPDKHAPQAQDGESQNTLF------FSNPNYA 416

Query: 415 KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474
           KAFFD+ +QNPDMLNNL +KRRK++D +K   +  +L+ AIG         +S  E KQM
Sbjct: 417 KAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQM 476

Query: 475 KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRK 534
           K ATE  L SG+++ +GFDP  GK+  VL+   +      ++  ++ K  +V +++ F+K
Sbjct: 477 KDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKN------VNSGLNSKSSQVKEIMSFKK 530

Query: 535 SHVILAPTXXXXXXXXXXXXXIWQENF 561
           S+V LAP+             +W+E+F
Sbjct: 531 SNVSLAPSKAEQKKRLLRREQVWREHF 557

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  446 bits (1148), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 244/576 (42%), Positives = 350/576 (60%), Gaps = 27/576 (4%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           M DPRE    D +D +S DE D+  + + L+ +ER+++DL  R+++  + KK +DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 61  LQVPCSPVKKTETNV-PVAMKKSTNEMEIP-HENPNELRIREKSGQLPSNTTTYFMEKFQ 118
           ++VP SP K     V   +  K   E   P HEN NEL++++K+  L S +T YF + F 
Sbjct: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKAS-LSSISTPYFAQNFS 117

Query: 119 KSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELR 178
            SKK +E + ++   M+N RVHTF      +E+ PI VNE EE+S  W+ KRYI   + R
Sbjct: 118 SSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQAR 177

Query: 179 KMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMT 238
           K+L   K+LRL KLFAKVRPP F+EPQYSNW  +GIISAK   K TT  KP +Y   T+T
Sbjct: 178 KILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLT 237

Query: 239 DFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPS------GKGQFIKSFNLRI 292
           DF+H +++Y+FG   VE+YYNL+VGD+IA+LNPE++PWRPS           IKSFNL I
Sbjct: 238 DFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCI 297

Query: 293 NHDFKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIEL 351
            H+F  ILEIG+S+D GFC + ++  G  C TPIN S EDRC YHQE++FR  N+KR+EL
Sbjct: 298 KHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLEL 357

Query: 352 NGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRHFSNN 411
           NG+ +L +PTK      LY K          +R      +      KD  ++   +FSN 
Sbjct: 358 NGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQS------KDSQNV--LYFSNP 409

Query: 412 NSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEV 471
           N+A+AFFD+ +QNPD LNNL+SKRRK++  KK   + K+L + IG   S+     ++ + 
Sbjct: 410 NAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQ 469

Query: 472 KQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLH 531
            +++RAT+  L+SG+I+++GFDPT G++++VL     K     L EQ   K   V ++L 
Sbjct: 470 DEIRRATKNALESGLIKKIGFDPTSGRMSSVL-----KNNSKGLKEQ--AKNSAVEEILQ 522

Query: 532 FRKSHVILAPTXXXXXXXXXXXXXIWQENFGQKRKP 567
            +K  + L P+             +W  +F ++  P
Sbjct: 523 IKKEKIELKPSKEALRQKFKKREEVWNHHFKKEENP 558

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  405 bits (1040), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/468 (44%), Positives = 295/468 (63%), Gaps = 22/468 (4%)

Query: 114 MEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIP 173
           ME F  S+K EE +I+    M+++RVHTF+     +  KPI V E E  S +W+ +RYI 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 174 QSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYL 233
             EL ++L +IKILRL KLF+KVRPPKF+EP Y+NW A+GI+  K   K T++ KP KY 
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 234 KFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPS--GKGQF----IKS 287
           K T+TDF H LDVY+F    VE+YYNLRVGD+IAILN ++ PWRPS  G  +F    +KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 288 FNLRINHDFKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRFRDNNS 346
           FNL I  ++ C+LEIG+S+DLGFC++ ++  G +C  PIN +  DRCDYHQEIRFR  N+
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 347 KRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNR 406
           +R+ELNGS +L +P K      LY    G +   RK   N  +        +D+      
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALY----GSSGVKRK--LNL-LPDKHAPQQQDRESQNTL 293

Query: 407 HFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGER 466
           +FSN N AKAFFD+ +QNPD+L NL+SKRRK++D +   ++  +LS+A+G        E+
Sbjct: 294 YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEK 353

Query: 467 SAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRT-THSKEEKDTLSEQMSGKKDK 525
           +  E KQMK+ATE T+ SG+++ +GFDPT GK+ +VL+   +SK   DT S Q       
Sbjct: 354 TKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQ------- 406

Query: 526 VNDLLHFRKSHVILAPTXXXXXXXXXXXXXIWQENFGQKRKPISANDL 573
           V +++  RK++V LAP+             +W+E+F  K  P + N +
Sbjct: 407 VREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQI 454

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  371 bits (952), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/533 (39%), Positives = 306/533 (57%), Gaps = 39/533 (7%)

Query: 1   MNDPREVLTTDPYDNVSSDEQD--EEAI------LRD---------------LENVERKR 37
           +NDPRE++ T  YD + SDE+D  EE +      LR+               L+ +E +R
Sbjct: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 38  QDLLNRIKEKQESKKLLDPNFQQLQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELR 97
            DLL R++E +   K        ++VP SP K        A   S +   +     NE  
Sbjct: 65  SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 98  IREKSGQLPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVN 157
               S   P  TT+YF EKF +++      +++ + ++  RV+TF D+    E+    V+
Sbjct: 125 RYLLSANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVD 182

Query: 158 EIEEYSNIWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISA 217
           E+E YSN+ + KRY+P+ +L+++LH+IK+LRL KLFAKVRPPKFSEP Y+NW  LG IS 
Sbjct: 183 EVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISY 242

Query: 218 KGDAKFTTTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWR 277
           K D K T+ +KP KY    +TDF + + + +FG+  VE+YY LRVGDVIAILNPE++PW+
Sbjct: 243 KSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWK 302

Query: 278 PSGK--GQFI----KSFNLRINHDFKCILEIGSSKDLGFCKVTSRN-GTLCNTPINMSKE 330
            S K  G+      +SF L I H+  CILEIG SK+LGFC   ++  G  C  PIN  KE
Sbjct: 303 ESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKE 362

Query: 331 DRCDYHQEIRFRDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVS 390
             C YHQE   R  N+KR+ELNG+ +L APT+       Y  +N    H  K      V 
Sbjct: 363 QVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNS---HGTKIGLLPDVY 419

Query: 391 ASFGSINKDQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKE 450
           A      + +F     HF++ N+ +A+FD  + NPD+L NL SKRRKIQ  KK  +I+K+
Sbjct: 420 APRAPGAEQKF---REHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQ 476

Query: 451 LSKAIGNRASDDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVL 503
           LS  +G   +      S   ++Q ++AT+  +++G+++ +GFDPT G++A VL
Sbjct: 477 LSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVL 529

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 204/561 (36%), Positives = 320/561 (57%), Gaps = 46/561 (8%)

Query: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60
           + DPRE+   DPY+ +S DE + E + R +  ++ +++DL NR+ E ++ + L DPNF  
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 61  LQVPCSPVKKTETN---------VPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTT 111
           + VP SP K               PVA      ++E    N NE  +REK  +L   TT+
Sbjct: 65  IDVPESPKKSDNATKGIEDIKHIAPVA------DIEEATFNVNEDYVREKVKKL--GTTS 116

Query: 112 YFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRY 171
           YF EK +     E   I++ + ++  RV+TF       E++PI V+E ++ S + + +RY
Sbjct: 117 YFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMF-DEYEPITVDEKDDLSGLVIDRRY 175

Query: 172 IPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKK 231
           +P + LRK   NIK+LRL KLF+KVR PKFSEP Y NW  LGIIS K + + T + KP K
Sbjct: 176 VPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVK 235

Query: 232 YLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWR--PSGKGQFIKSFN 289
           +   T++DFQ +L+V  FGK  VE+YY LR+GD+IAILNPE+ P +   +G      +F+
Sbjct: 236 FFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFS 295

Query: 290 LRINHDFKCILEIGSSKDLGFCKVTSRN-GTLCNTPINMSKEDRCDYHQEIRFRDNNSKR 348
           L+++ D   ILE+G SK+ G C+   +N G LC  PIN   ++ C YH+E + R N+S+R
Sbjct: 296 LKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRR 355

Query: 349 IELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQN----FSVSASFGSINKDQFDLR 404
           +E++ S A+ AP       T+ + ++   + S + +QN    F    +    N+      
Sbjct: 356 VEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNR------ 409

Query: 405 NRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLG 464
              FS+ N++ AFFD+ ++NPD+L NL++KRRKIQ+ +    ++K+L K + ++      
Sbjct: 410 -FLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKL-KGLSDKLLSKKE 467

Query: 465 ERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKD 524
           +R   E K  K AT +  Q G+  ++G+DPT GK A++    +S E K       + K D
Sbjct: 468 DRVNQEAK--KTATLSMFQHGLANQIGYDPTKGK-ASLEMLEYSTENK-------APKND 517

Query: 525 K---VNDLLHFRKSHVILAPT 542
           K   + D+ + +K +V L P+
Sbjct: 518 KQLAITDICNIKKDNVSLKPS 538

>TBLA0I00410 Chr9 complement(66413..67015) [603 bp, 200 aa] {ON}
           Anc_7.395 YBL072C
          Length = 200

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 26/41 (63%)

Query: 116 KFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQV 156
           +F+K +K E G+   M  +   R+H+ + +GG Q+F+ +++
Sbjct: 20  QFRKKRKFELGRQPAMTKIGGKRIHSVRTRGGNQKFRALRI 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,079,182
Number of extensions: 3237853
Number of successful extensions: 13088
Number of sequences better than 10.0: 277
Number of HSP's gapped: 13683
Number of HSP's successfully gapped: 297
Length of query: 592
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 477
Effective length of database: 40,294,809
Effective search space: 19220623893
Effective search space used: 19220623893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)