Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G002105.707ON28828814070.0
NDAI0F002705.707ON2982601774e-14
TBLA0I016905.707ON3201091474e-10
TPHA0E001805.707ON165851257e-08
KNAG0L021605.707ON2091121214e-07
Kpol_1043.745.707ON1771041108e-06
SAKL0E15026g5.707ON2901071112e-05
ZYRO0B16434g5.707ON2371121022e-04
Smik_9.175.707ON2511101022e-04
Suva_9.365.707ON2241201003e-04
TDEL0B021305.707ON20885920.002
Skud_9.165.707ON226111920.003
YIL152W5.707ON235110900.006
KAFR0D022005.707ON182116750.34
NOTE: 4 genes in the same pillar as NCAS0G00210 were not hit in these BLAST results
LIST: KLTH0E00946g Kwal_55.19675 KLLA0A00506g Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G00210
         (288 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...   546   0.0  
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    73   4e-14
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    61   4e-10
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    53   7e-08
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    51   4e-07
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    47   8e-06
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    47   2e-05
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    44   2e-04
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     44   2e-04
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     43   3e-04
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    40   0.002
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)     40   0.003
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    39   0.006
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    33   0.34 

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/288 (94%), Positives = 273/288 (94%)

Query: 1   MDFNSRPANRVLKGKDGGNWKRGFDIFVDPNKGKPKRRLEHVDGQHVKTSNNISLSRLPV 60
           MDFNSRPANRVLKGKDGGNWKRGFDIFVDPNKGKPKRRLEHVDGQHVKTSNNISLSRLPV
Sbjct: 1   MDFNSRPANRVLKGKDGGNWKRGFDIFVDPNKGKPKRRLEHVDGQHVKTSNNISLSRLPV 60

Query: 61  VPVKERKVLTEKTNNFSTLLSQSRHTSHKSSKMNEISILKPVQFTSISKKQVEIAKPLKS 120
           VPVKERKVLTEKTNNFSTLLSQSRHTSHKSSKMNEISILKPVQFTSISKKQVEIAKPLKS
Sbjct: 61  VPVKERKVLTEKTNNFSTLLSQSRHTSHKSSKMNEISILKPVQFTSISKKQVEIAKPLKS 120

Query: 121 INNIMDNVTIRQSDTLNVEPPRSKRPYLNYPLPKKLXXXXXXXXXXXXXXXNEPKIFVTS 180
           INNIMDNVTIRQSDTLNVEPPRSKRPYLNYPLPKKL               NEPKIFVTS
Sbjct: 121 INNIMDNVTIRQSDTLNVEPPRSKRPYLNYPLPKKLSRTSTSDVSSRDNSNNEPKIFVTS 180

Query: 181 LQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIP 240
           LQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIP
Sbjct: 181 LQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIP 240

Query: 241 ILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFIPSQ 288
           ILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFIPSQ
Sbjct: 241 ILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFIPSQ 288

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 72.8 bits (177), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 119/260 (45%), Gaps = 47/260 (18%)

Query: 61  VPVKERKVLTEKTNNFSTLLSQSRHTSHKSSKMNE----ISILKPVQFTSISKKQVEIAK 116
           + V+  K    KTNN ++L + +  +  K +K       IS     +F SI+ K  + A 
Sbjct: 51  IDVENAKERYHKTNNINSLFTLAHKSIKKVAKEPRNNLPISSFTSGKFKSITLKDTKRAG 110

Query: 117 PLKSINNIMDNV-----TIRQSDTLNVEPPRSKRPYLNYPLPK----------------- 154
           PL+SI NI+ N      ++  +  L  + P + R  +     K                 
Sbjct: 111 PLQSIQNIIYNCKGYPHSVFMAKQLERKEPTTIRDGIAILDSKNGIGSKIIKAKFRKSHF 170

Query: 155 KLXXXXXXXXX--XXXXXXNEPKIFVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKL 212
           KL                 N+P   + SLQK LCDLDT +KT    SYD++ T+ S   L
Sbjct: 171 KLGSVTRKYELFPLQDLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEML 230

Query: 213 SDFELQV------TTQMSPQL-IILHNKTSINNIPILKFIHDVSINTKIQVTESLKLAIN 265
           SD E+++      T   +  + ++LH+K S+ N+P+   +H           +  KLA++
Sbjct: 231 SDHEIKINSVKNYTAGFTTDVTMLLHSKISL-NVPLPNNLH-----------KDYKLALD 278

Query: 266 SKSFIKVSDDINWYIDWKFI 285
           SK +++++ ++ WY+ WKFI
Sbjct: 279 SKVYLELAPNVKWYLVWKFI 298

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 177 FVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSI 236
            V  L   L +L+T + +S+   +D ++ I+ +TKLSD EL V T  +  L+ LH+ ++I
Sbjct: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLL-LHSDSTI 283

Query: 237 NNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285
                  +            T   K+A NS S +K+++D+NWY+ WKFI
Sbjct: 284 GQSEFNNY------------TLKEKVATNSISILKITEDLNWYLKWKFI 320

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 13/85 (15%)

Query: 200 YDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIPILKFIHDVSINTKIQVTES 259
           YD +  INSI KLS  E  VTT  S  LI+  N+ ++             +N+     + 
Sbjct: 80  YDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNV-------------VNSNNYTLKY 126

Query: 260 LKLAINSKSFIKVSDDINWYIDWKF 284
            ++AINSK ++ + +D+NWY+DWKF
Sbjct: 127 QQVAINSKYYLSLYNDLNWYLDWKF 151

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 177 FVTSLQKYLCDLDTM-MKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTS 235
            V  LQ+ L  L+ + + T     YD++  +    KLS  EL + T  S +  +LH+   
Sbjct: 107 LVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHS--- 163

Query: 236 INNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFIPS 287
             N P+  F+ D   +    V      A+ SK  ++V+ D+ W + WK +P+
Sbjct: 164 --NGPVHGFLLDQIASGGYTV------ALYSKLAVRVTPDLYWCLQWKLVPA 207

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 180 SLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNI 239
           SL   L   +T++++     +D VW I     LS F++         L++ HN+ +  NI
Sbjct: 80  SLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYC-------LVVDHNEMT-KNI 131

Query: 240 PILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWK 283
            + K  ++ +       T   K+AINS SF+ +  ++NWY+ W+
Sbjct: 132 ILYKNNNNNNNANITLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 16/107 (14%)

Query: 181 LQKYLCDLDTMMKTSKKFS---YDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSIN 237
           LQK LCD +T+ K S   S   YD V T++   +LS  EL V +      I+LH      
Sbjct: 192 LQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAHAIVLH------ 245

Query: 238 NIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKF 284
                +F +     T+      LKL ++S+S I++   + WY +W F
Sbjct: 246 -----RFKNKAFPRTEKHRV--LKLHLDSRSEIELYPGLYWYSNWYF 285

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 59/112 (52%), Gaps = 20/112 (17%)

Query: 177 FVTSLQKYLCDLDTMMKTSKK-FSYDSVWTINSITKLSDFELQVTTQMSPQL--IILHNK 233
            VT L   L D + M+KTS++  +YD +  I     LS FE+ V +   P++   ILH+ 
Sbjct: 143 LVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISD-DPRVKRAILHSH 201

Query: 234 TSINNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285
            +I   P  KF++  S           +LAI SK  + + +D+NWY+ WKF+
Sbjct: 202 KAI---P--KFVNSPS-----------RLAICSKCCLTLYNDMNWYLKWKFL 237

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 12/110 (10%)

Query: 177 FVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKT-S 235
            V+ L   + DLD +++T K      +  ++  T LS  EL +   M  + IILH++T +
Sbjct: 153 LVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLPME-ETIILHSRTPT 211

Query: 236 INNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285
           IN     +++H+   N          L I+S+SF+ + ++I WY+ WKFI
Sbjct: 212 INE----EWLHNKVSNP------GASLVIDSRSFLILCNNIKWYLHWKFI 251

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 17/120 (14%)

Query: 173 EPKIF-------VTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSP 225
           +PK F       V+ L   + DLDT+++T K      +  ++  T LS  EL +    + 
Sbjct: 115 QPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLH-TE 173

Query: 226 QLIILHNKTSINNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285
             IILH++T I N   L+  + VS            L I+S+SF+ +  +I WY+ WKFI
Sbjct: 174 DTIILHSRTPIINAEWLR--NKVS-------NAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 15/85 (17%)

Query: 201 DSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIPILKFIHDVSINTKIQVTESL 260
           D +     +  LS  EL V TQ   ++ +LH+   +    + +F              +L
Sbjct: 139 DQLMAFERLVLLSQHELLVVTQR--KIFVLHSVIPLTREGVSRF-------------GAL 183

Query: 261 KLAINSKSFIKVSDDINWYIDWKFI 285
           KLA+NS+ +  + +D+ W++ WKF 
Sbjct: 184 KLAVNSQCYYVLYNDVVWFMRWKFF 208

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 14/111 (12%)

Query: 177 FVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSI 236
            V+ L   + DLDT+++T K      +  ++    LS  EL +   M+   IILH++   
Sbjct: 128 LVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMN-DTIILHSR--- 183

Query: 237 NNIPIL--KFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285
             IP +  +++H+ + +       S  L I+S+SF+ + ++I WY+ WKFI
Sbjct: 184 --IPKINAEWLHNKTSD------PSASLVIDSRSFLILCNNIKWYLHWKFI 226

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 12/110 (10%)

Query: 177 FVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKT-S 235
            V+ L   + DLD +++T K      +   +  T LS  EL +      Q IILH++   
Sbjct: 137 LVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIKLPKD-QTIILHSRAPK 195

Query: 236 INNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285
           IN   +   ++D S +          L I+S+SF+ + ++I WY+ WKFI
Sbjct: 196 INAEWLQNKVNDPSAS----------LVIDSRSFLTLCNNIKWYLHWKFI 235

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 15/116 (12%)

Query: 172 NEPKIFVTSLQKYLCDLDTMMKTSKKFS-YDSVWTINSITKLSDFELQVTTQMSPQL-II 229
           N+P     SLQK L DL+ ++  SK    YD +  + S  +LS  E+ +       +  I
Sbjct: 79  NKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYI 138

Query: 230 LHNKTSINNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285
           LH   +     +  F                 LA+NSK   ++ D + W ++WK +
Sbjct: 139 LHKPLTFRTNSVDNFT-------------GAHLALNSKISFRLDDTLIWCLNWKLL 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,035,777
Number of extensions: 1234952
Number of successful extensions: 5379
Number of sequences better than 10.0: 72
Number of HSP's gapped: 5607
Number of HSP's successfully gapped: 73
Length of query: 288
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 180
Effective length of database: 41,097,471
Effective search space: 7397544780
Effective search space used: 7397544780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)