Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G002005.709ON43843823780.0
NDAI0F002405.709ON46434013011e-177
ZYRO0B16478g5.709ON39140311321e-153
TDEL0B021105.709ON38938711261e-152
Kpol_2001.775.709ON41340410981e-147
Suva_9.355.709ON39333810731e-144
TPHA0D046505.709ON42134910711e-143
YIL153W (RRD1)5.709ON39333210601e-142
SAKL0E15070g5.709ON38541410541e-141
Smik_9.165.709ON39333210451e-140
KLTH0E00880g5.709ON37138810411e-139
Kwal_55.196615.709ON37135010351e-138
Skud_9.155.709ON40234310341e-138
KAFR0D021905.709ON42640210271e-136
CAGL0H06655g5.709ON4243329891e-131
TBLA0E016905.709ON4884179871e-129
Ecym_40125.709ON3953979701e-128
AFR293C5.709ON3653409321e-123
KLLA0A00462g5.709ON3533399051e-119
KNAG0L021705.709ON3964168941e-117
TPHA0D012408.674ON3593084234e-47
KLTH0D11176g8.674ON3533044155e-46
YPL152W (RRD2)8.674ON3582884121e-45
ACR139C8.674ON3593004112e-45
SAKL0H06622g8.674ON3553074102e-45
NDAI0E024108.674ON3593084102e-45
ZYRO0F07326g8.674ON3523094102e-45
Ecym_23998.674ON3512524069e-45
CAGL0M02255g8.674ON3583064061e-44
NCAS0C016908.674ON3593474042e-44
KAFR0H024408.674ON3533114006e-44
Smik_6.3498.674ON3583074016e-44
Skud_16.1308.674ON3583423991e-43
Kpol_1013.48.674ON3582553954e-43
Suva_16.1588.674ON3582873945e-43
TDEL0A062008.674ON3553163929e-43
Kwal_26.87838.674ON3553043911e-42
KLLA0F11187g8.674ON3602543911e-42
KNAG0J016908.674ON3633113912e-42
TBLA0C018608.674ON3563123727e-40
ADL177C3.32ON90548741.5
TPHA0B004104.344ON94577741.7
NDAI0G021608.401ON91375732.4
Kpol_1006.98.126ON129267713.8
NCAS0D003602.63ON54270687.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G00200
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      920   0.0  
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      505   e-177
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   440   e-153
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   438   e-152
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   427   e-147
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   417   e-144
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   417   e-143
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   412   e-142
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   410   e-141
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   407   e-140
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   405   e-139
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   403   e-138
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   402   e-138
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   400   e-136
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   385   e-131
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   384   e-129
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   378   e-128
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   363   e-123
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   353   e-119
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   348   e-117
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   167   4e-47
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   164   5e-46
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   163   1e-45
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   162   2e-45
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   162   2e-45
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   162   2e-45
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   162   2e-45
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   160   9e-45
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   160   1e-44
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   160   2e-44
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   158   6e-44
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   159   6e-44
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   158   1e-43
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   156   4e-43
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   156   5e-43
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   155   9e-43
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   155   1e-42
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   155   1e-42
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   155   2e-42
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   147   7e-40
ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON} S...    33   1.5  
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    33   1.7  
NDAI0G02160 Chr7 (487168..489909) [2742 bp, 913 aa] {ON} Anc_8.4...    33   2.4  
Kpol_1006.9 s1006 (38965..42843) [3879 bp, 1292 aa] {ON} (38965....    32   3.8  
NCAS0D00360 Chr4 (53637..55265) [1629 bp, 542 aa] {ON} Anc_2.63 ...    31   7.0  

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/438 (100%), Positives = 438/438 (100%)

Query: 1   MDKLLLCCDNNDRGRTIKQSAMTTINDTHMAVLDLKTTQFSLPAKRIFDSQTTQDFQSSI 60
           MDKLLLCCDNNDRGRTIKQSAMTTINDTHMAVLDLKTTQFSLPAKRIFDSQTTQDFQSSI
Sbjct: 1   MDKLLLCCDNNDRGRTIKQSAMTTINDTHMAVLDLKTTQFSLPAKRIFDSQTTQDFQSSI 60

Query: 61  ALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLNHLSTLIDETPPLVGPRRYG 120
           ALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLNHLSTLIDETPPLVGPRRYG
Sbjct: 61  ALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLNHLSTLIDETPPLVGPRRYG 120

Query: 121 NLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHPCIQELNYYISNAFGSSTRLDF 180
           NLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHPCIQELNYYISNAFGSSTRLDF
Sbjct: 121 NLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHPCIQELNYYISNAFGSSTRLDF 180

Query: 181 GTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYALVRKLILTYTLEPAGSHGVWG 240
           GTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYALVRKLILTYTLEPAGSHGVWG
Sbjct: 181 GTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYALVRKLILTYTLEPAGSHGVWG 240

Query: 241 LDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEH 300
           LDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEH
Sbjct: 241 LDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEH 300

Query: 301 SPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIY 360
           SPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIY
Sbjct: 301 SPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIY 360

Query: 361 EHSPEDDETEQEREIQQYAPHWHKENAHVRTAKPGITAMPSVTNTRTNMAPPSSRMMNSH 420
           EHSPEDDETEQEREIQQYAPHWHKENAHVRTAKPGITAMPSVTNTRTNMAPPSSRMMNSH
Sbjct: 361 EHSPEDDETEQEREIQQYAPHWHKENAHVRTAKPGITAMPSVTNTRTNMAPPSSRMMNSH 420

Query: 421 DPTISSLLKRSTRDQARR 438
           DPTISSLLKRSTRDQARR
Sbjct: 421 DPTISSLLKRSTRDQARR 438

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  505 bits (1301), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 278/340 (81%), Gaps = 12/340 (3%)

Query: 28  THMAVLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPP--EG 85
           T + +LDLK T FSLP KRIFDSQTTQDFQSSIAL RLRFFLQ+YI +V NV+ PP  + 
Sbjct: 9   TPIYLLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDS 68

Query: 86  TLSSVTLVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDP 145
            +S + +VNSI+ LLN LST++ +TPPL GPRRYGNLACRDWH+K+E +LP LL + +  
Sbjct: 69  YVSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAI-- 126

Query: 146 YLPKVSGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGM 205
                   S  + P I ELNYYI+N+FGSSTRLD+GTGHELSFMAFIAA+DMLGL+ D +
Sbjct: 127 -------PSPDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD-L 178

Query: 206 QGTDILLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPR 265
            G D+L++FN YY+LVR+LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW+ NAP+ P+
Sbjct: 179 TGKDLLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPK 238

Query: 266 DVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMY 325
           ++ +  LVK Y+  NLYCQCI F+  VKSGPF+EHSPILYDI+TSV+ W KVQRGLIKMY
Sbjct: 239 EITNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMY 298

Query: 326 MDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPE 365
           MDEVL KFPVVQHFWFG GFYPWIN  T + LP+YEHSPE
Sbjct: 299 MDEVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPE 338

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  440 bits (1132), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 221/403 (54%), Positives = 280/403 (69%), Gaps = 23/403 (5%)

Query: 30  MAVLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSS 89
           M +L  + TQF+ P KRIFDSQ T +FQ+S+A+ RL++F+QKY  ++  V  P +G  S 
Sbjct: 1   MRMLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIP-QGP-SR 58

Query: 90  VTLVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPK 149
           +++VN  V +LNH+S L+D+TPPL GPRRYGNLACRDWH K++ Q+P+L  ++L      
Sbjct: 59  ISVVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVL------ 112

Query: 150 VSGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTD 209
                   H CI EL +Y+ N+FGS+TRLD+GTGHELSF+A + AIDMLGL+TD  QG D
Sbjct: 113 ----PDRFHHCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGED 168

Query: 210 ILLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDV 267
            LL+ N YYA+VRKLILTYTLEPAGSHGVWGLDDHFHLAY+ GS+QW   + AP+RPRD+
Sbjct: 169 FLLIMNAYYAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDI 228

Query: 268 KDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMD 327
            +  LV++YA  NLYCQ I FI+QVK GPF EHS +LYD+AT+V TW+K++ GL+KMY  
Sbjct: 229 LNHHLVQEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAV 288

Query: 328 EVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPED-DETEQEREIQQYAPHWHKEN 386
           EVL KFPVVQHFWFG GFYPW++  TGK L IY+  P D D         +YA      N
Sbjct: 289 EVLNKFPVVQHFWFGTGFYPWVDNQTGKQLLIYD--PADADRRNTSSTGGKYAAFVSSIN 346

Query: 387 AHV-RTAKPGITAMPSVTN--TRTNMAPPSSRMMNS---HDPT 423
           + V     P  TA         RT M PP++R  NS   HD T
Sbjct: 347 SPVPHFPAPSTTAASEARAPPARTRMGPPTARTTNSTAHHDLT 389

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  438 bits (1126), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/387 (56%), Positives = 268/387 (69%), Gaps = 21/387 (5%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
           +D+  T+F  P K IFDSQ   DFQ S+A++RL++ L+KY  M+     P     S + +
Sbjct: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHG--QPIVHEPSGIEV 64

Query: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152
           VN +V LL+ LS L+DETPP  GPRRYGNLACRDWH K++A L  LL ++L         
Sbjct: 65  VNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVL--------- 115

Query: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212
                H CI EL+YY+ N+FGSSTRLD+GTGHELSF+A + A+DMLGLWT    G D+LL
Sbjct: 116 -PQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLL 174

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRN--APMRPRDVKDI 270
           LF+TYY LVRKLILTYTLEPAGSHGVWGLDDHFH+ YILGSSQW  +   PM PRDVK+ 
Sbjct: 175 LFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNK 234

Query: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330
            LV+ YA +NLYCQ I FIF VKSGPFSEHS +LYDIA++V TWSKVQ GL+KMY  EVL
Sbjct: 235 VLVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVL 294

Query: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390
           KKFPVVQHFWFG GFYPWI+   G+ LPIYE++  + E +Q   +   AP       +  
Sbjct: 295 KKFPVVQHFWFGPGFYPWISDRNGQKLPIYENA--ESEKKQPPSMTTMAP--SNTTMYHL 350

Query: 391 TAKP---GITAMPSVTNTRTNMAPPSS 414
           T +P   G  +      TR  M PP+S
Sbjct: 351 TTRPIPHGKLSQVHKLPTRGTMQPPTS 377

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  427 bits (1098), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 276/404 (68%), Gaps = 22/404 (5%)

Query: 32  VLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVT 91
           +L+ +  +F LP KRI+DSQ T  FQSS+A+ RL++F+ KYI +V NV  P E  +S + 
Sbjct: 7   LLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIP 66

Query: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
            VN +V+L++ LS L+DETPP  GPRR+GNL+CR+WH K++  L +LL ++L      +S
Sbjct: 67  TVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNIS 126

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211
              S     + EL+YY+ N+FGSSTRLD+GTGHELSF+A IA IDMLGLWT+ ++G D+L
Sbjct: 127 ---SKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLL 183

Query: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--IRNAPMRPRDVKD 269
           ++FN YY L++KLILTYTLEPAGSHGVWGLDDHFH AYILGS+QW    N P++P D+ +
Sbjct: 184 IIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVN 243

Query: 270 ISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEV 329
             LV +YA +N+YC  I FI  VKSGPFSEHSP+LYDI+ SV  WSKV+ GL+KMYM EV
Sbjct: 244 KDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEV 303

Query: 330 LKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEH-------------SPEDDETEQEREIQ 376
           L KFPVVQHFWFG G +PWI+ +T K LP+YE+             SP        R+  
Sbjct: 304 LNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRRDFS 363

Query: 377 QYAPHWHKENAHVRTAKP-GITAMPSVTNTRTNMAPPSSRMMNS 419
           ++       N   R     GI A P     ++NM PPS+  +NS
Sbjct: 364 KFTSPALNRNPICRNPNHLGIGANPL---RKSNMGPPSTNSVNS 404

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  417 bits (1073), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/338 (58%), Positives = 252/338 (74%), Gaps = 15/338 (4%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91
           +D     FS P KRIFD+QTTQDFQSS+A++R+++ L KY +++++   P P  T SS+ 
Sbjct: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65

Query: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
           +VN ++ +L+  + LID+TPPL GPRRYGNLACR+WH K++A L   L E+L        
Sbjct: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVL-------- 117

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211
              +  H  + EL YY+ N+FGSSTRLD+GTGHELSFMA +AA+D+LGL+   ++GTD+ 
Sbjct: 118 --PAQYHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPH-LRGTDVF 174

Query: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268
           LLF+ YYA++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PRDV 
Sbjct: 175 LLFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVL 234

Query: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
           D SLV++Y  +N YCQ I FI QVK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 235 DKSLVREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294

Query: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPED 366
           VL+KFPVVQHFWFG GF+PWIN   G  LP++E   E+
Sbjct: 295 VLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEE 332

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  417 bits (1071), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/349 (56%), Positives = 254/349 (72%), Gaps = 8/349 (2%)

Query: 30  MAVLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSS 89
           ++ +++K   FSLP KRI+DSQ+T  FQSSIA+ RL+++L KYI+MV NV+ P    +S 
Sbjct: 4   LSTINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSE 63

Query: 90  VTLVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILD-PYLP 148
           +T+VN +  LL  LS  ID  PP  GPRRYGNLACR+WH+ +++++P LL ++L      
Sbjct: 64  ITIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHA 123

Query: 149 KVSGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGT 208
              GE   +  CI ELNYY+ N+ GS+TRLD+GTGHELSF+A IAA+DMLGLWT+  +G 
Sbjct: 124 TEKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGV 183

Query: 209 DILLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIR--NAPMRPRD 266
           D+L +F+ YY LV+KLI+TYTLEPAGSHGVWGLDDHFHL+YILGSSQ     N P  P D
Sbjct: 184 DLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSD 243

Query: 267 VKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYM 326
           + +  +V +Y   N YC  I FI++VKSGPFSEHSPILYDI+T+V +W KV  GL+KMYM
Sbjct: 244 IINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYM 303

Query: 327 DEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREI 375
            EVL KFPVVQHFWFG+GFYPW N  T K L +Y      ++T QE  +
Sbjct: 304 VEVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYM-----NDTNQENNV 347

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  412 bits (1060), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 195/332 (58%), Positives = 248/332 (74%), Gaps = 15/332 (4%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91
           +D     FS P KRIFD+QTT DFQSS+A++R+++ L KY +++++   P P  T SS+ 
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65

Query: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
           +VN ++ +L+ L+ LIDETPPL GPRRYGNLACR+WH K++ +LP  L E+L        
Sbjct: 66  MVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEML-------- 117

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211
              S  H  + EL YY+ N+FGSSTRLD+GTGHELSFMA +AA+DMLG++   M+G D+ 
Sbjct: 118 --PSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPH-MRGADVF 174

Query: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268
           LLFN YY ++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PR++ 
Sbjct: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234

Query: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
           D SLV++Y  +N YCQ I FI +VK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 235 DKSLVREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294

Query: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIY 360
           VLKKFPVVQHFWFG GF+PW+N   G  LP++
Sbjct: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVF 326

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  410 bits (1054), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/414 (51%), Positives = 273/414 (65%), Gaps = 46/414 (11%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
           +D+  T+F+ P K+IFD+Q TQDFQSS+ + RL+ +L KYI++V     P   + S+   
Sbjct: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP---STSNNDA 66

Query: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152
           VN   Q+++ LS  IDETPPL GPRR+GN ACR WH KM   L ALL      ++P+   
Sbjct: 67  VNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQA----FIPE--- 119

Query: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212
                H CI E+ YY+ NAFGS  RLD+GTGHELSF+A ++AIDML LW     G DIL 
Sbjct: 120 ---KYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILF 176

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--IRNAPMRPRDVKDI 270
           LFN YY LV+KLI TYTLEPAGSHGVWGLDDHFHLAYILGSSQ   I + P+RP D+ D 
Sbjct: 177 LFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDR 236

Query: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330
             V+ YAK+NLY Q IAFI +VKSG FSEHSP+LYDIA +V+TWSKVQRGL+KMY  EVL
Sbjct: 237 HTVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVL 296

Query: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390
            KFPVVQHFWFG GF+PW+N  +G  LP YE + E++            PH+        
Sbjct: 297 NKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEEN------------PHF-------- 336

Query: 391 TAKPGITAMPSVTN------TRTNMAPPSSRMMNSHDPTISSLLKRSTRDQARR 438
           ++   I+ MP+ T       + T M PP+  ++ S +   S + K + RD+ +R
Sbjct: 337 SSVTSISNMPTATKSVLPATSSTTMPPPT--ILPSRN---SPMGKFANRDRFKR 385

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  407 bits (1045), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 192/332 (57%), Positives = 248/332 (74%), Gaps = 15/332 (4%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91
           +D     FS P KRIFD+QTT DFQSS+A++R+++ L KY +++++   P P+   SS+ 
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65

Query: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
           + N ++Q+L+ L+ LIDETPPL GPRRYGNLACR+WH K++ +LP  L E+L P      
Sbjct: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPP------ 119

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211
                 H  + EL YY+ N+FGSSTRLD+GTGHELSFMA + A+D+LG++   ++GTD+ 
Sbjct: 120 ----EYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPH-LRGTDVF 174

Query: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268
           LLFN YY ++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PR++ 
Sbjct: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234

Query: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
           D SLV++Y  +N YCQ I FI +VK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 235 DKSLVREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294

Query: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIY 360
           VLKKFPVVQHFWFG GF+PW+N   G  LP++
Sbjct: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVF 326

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  405 bits (1041), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 205/388 (52%), Positives = 259/388 (66%), Gaps = 35/388 (9%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
           +D  +  F+ P KRIFDS+ +  FQSS+A+ RL+ +L KY+S ++ V+ P   T   V  
Sbjct: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEV-- 63

Query: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152
             S  +LL  LS L+D TP L GPRRYGNLACR WH K++  L ALL++    +LP+   
Sbjct: 64  -RSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHK----FLPE--- 115

Query: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212
                H  I EL YY+ NAFGS  RLD+GTGHELSF A I A+DMLG+W    Q +D+L 
Sbjct: 116 ---PCHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLF 172

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVKDI 270
           LF+ YYALVRKL+LTYTLEPAGSHGVWGLDDHFHL YI G+SQW+  + AP+ PR+V+D 
Sbjct: 173 LFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDK 232

Query: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330
            +V +Y K+N YCQ I+FIFQVKSGPFSEHSP+L+DI+ SV TWSKVQRGL+KMY  EVL
Sbjct: 233 LIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVL 292

Query: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390
            KFPVVQHFWFG G +PW +   G  LP YE S      E + ++ Q+            
Sbjct: 293 NKFPVVQHFWFGTGLFPWTSLGDGYALPTYEAS-----QEAQGQVLQH------------ 335

Query: 391 TAKPGITAMPSVTNTRTNMAPPSSRMMN 418
           T  P  T   ++ + R  M PP+ R +N
Sbjct: 336 TTAPAPT---NLNSARRQMNPPNLRGIN 360

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  403 bits (1035), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 244/350 (69%), Gaps = 15/350 (4%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
           +D+ TT F+ P KRIFDS+ T  FQSS+A+ RL+  L KY+ M++  + P E +  +V  
Sbjct: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVI- 64

Query: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152
             S+ ++L+  S L+DETP L GPRRYGNLACRDWH KME Q+     E L  +LP+   
Sbjct: 65  --SLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQI----REQLQEFLPE--- 115

Query: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212
                +P I EL YY+ NAFGS  RLD+GTGHELSF + I A+DMLG+W  G Q  D+L 
Sbjct: 116 ---KYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLY 172

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVKDI 270
           LFN YY+LVRKLI  Y+LEPAGSHGVWGLDDHFHL YI G+SQW   ++A   PR+++  
Sbjct: 173 LFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSK 232

Query: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330
            +V +YA SN YCQ I+FIF+VKSGPFSEHSP+LYDI+ SV TWSKVQRGL+KMY  EVL
Sbjct: 233 MIVDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVL 292

Query: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAP 380
            KFPVVQHFWFG   +PW +   G  LP YE S E D   Q   + Q+ P
Sbjct: 293 NKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQP 342

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  402 bits (1034), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 195/343 (56%), Positives = 248/343 (72%), Gaps = 16/343 (4%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91
           +D     FS P KRIFD+QTT DFQSS+A++R+++ L KY +++++   P      SS+ 
Sbjct: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74

Query: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
           +VN ++ +L+ L+ LIDETPPL GPRRYGNLACR+WH K++  L   L E+L        
Sbjct: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEML-------- 126

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211
              +  H  + EL YY+ N+FGSSTRLD+GTGHELSFMA +AA+D+LG++   ++G D+ 
Sbjct: 127 --PAEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPH-LRGNDVF 183

Query: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268
           LLFN YY ++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PR+V 
Sbjct: 184 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVL 243

Query: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
           D SLV  Y  +N YCQ I FI +VK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 244 DKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 303

Query: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQ 371
           VLKKFPVVQHFWFG GF+PW+N   G  LP++E   ED+  EQ
Sbjct: 304 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEK-EDETIEQ 345

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  400 bits (1027), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 271/402 (67%), Gaps = 24/402 (5%)

Query: 32  VLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVT 91
           V+D   ++FS+PAKRIFDSQTTQ FQ S+A  RL++F  KYI++V  V  P    ++ +T
Sbjct: 9   VVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNIT-MT 67

Query: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
           +   I+ LL+  S  IDETPPL+ PRR+GNL+CR WH K+ + LP  L  I+D +    +
Sbjct: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNF---ST 124

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211
            E+ +M     ELNYY+ N+FGS TRLD+GTGHELSF+AFI+ IDM+ +  D M   D L
Sbjct: 125 IENENM---FNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQD-MTADDFL 180

Query: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRN-APMRPRDVKDI 270
           L++ +YY L RKLILTYTLEPAGSHGVWGLDDHFHLAYI GSSQ I + + + P+D+   
Sbjct: 181 LIWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKK 240

Query: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330
            +V ++ ++NLYCQ I FIF VK GPF+EHSPILYDI+ +V +WSKV +GL+KMY DEVL
Sbjct: 241 DVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL 300

Query: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390
            KFPVVQHFWFGDGF+PW + ++GK LP++EHS  +        I    P   +  A   
Sbjct: 301 NKFPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPA---IMTMMPSSTETMASFN 357

Query: 391 TAKPGITAM------------PSVTNTRTNMAPPSSRMMNSH 420
            A+   + +            PS++     M PPS+ ++NS+
Sbjct: 358 LARSSKSPIMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSY 399

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  385 bits (989), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 185/332 (55%), Positives = 241/332 (72%), Gaps = 15/332 (4%)

Query: 40  FSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQL 99
           FS P KRI+DSQ    FQSS A+ RL   + KY  +V +        L    +V  +V++
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDV---ADLELSGVVGGVVKV 58

Query: 100 LNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHP 159
           L+ L  L+ ETPP+ GPRRYGN+ACRDWH K+E ++P LL +++  + P       S   
Sbjct: 59  LDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFP-------SELQ 111

Query: 160 CIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYA 219
           C+ EL YY++N+FGS+TRLDFGTGHELSF+A +AA+DMLG   DG Q   +L +F+ YY+
Sbjct: 112 CVVELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQ---VLYIFDRYYS 168

Query: 220 LVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVKDISLVKQYA 277
           LV +LIL+YTLEPAGSHGVWGLDDHFHLAYILGSSQW   +   M P D+ D  LV+QY+
Sbjct: 169 LVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYS 228

Query: 278 KSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQ 337
           ++N++C+ + F+F VKSG F EHSP+L+DI+ SV TW+KV++GL KMY DEVL KFPV+Q
Sbjct: 229 RTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQ 288

Query: 338 HFWFGDGFYPWINQHTGKPLPIYEHSPEDDET 369
           HFWFG GFYPW++   GKPLP YE+SP+ DET
Sbjct: 289 HFWFGTGFYPWVDYKNGKPLPNYENSPDIDET 320

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  384 bits (987), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 204/417 (48%), Positives = 263/417 (63%), Gaps = 33/417 (7%)

Query: 40  FSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQL 99
           FS P K+IFDSQ TQ F  SIA +R+++F+ KY  ++     PP    SS   ++ + ++
Sbjct: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74

Query: 100 LNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHP 159
           +N L  L++ETPPL GPRRYGNL+CR WH +++  +    NE+ + YL  +S    +   
Sbjct: 75  INDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNI----NELFEKYL-TISNTKFNKDQ 129

Query: 160 CIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYA 219
              EL YY + + GS TRLD+GTGHELSF+AFI A+DML L TD + GTDIL +FN YY 
Sbjct: 130 LFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD-ISGTDILFIFNEYYR 188

Query: 220 LVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIR---------------NAPMRP 264
           L+RKLIL YTLEPAGSHGVWGLDDHFHL YI GSSQW                  AP++P
Sbjct: 189 LIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKP 248

Query: 265 RDVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKM 324
            D+ + +L++++  SN YCQ I FI  VK+GPF EHSPIL+DIA +V  W KV+ GL+KM
Sbjct: 249 VDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKM 308

Query: 325 YMDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDET----EQEREIQQYAP 380
           YM EVL KFPVVQHFWFG GFYPWIN  T   LP YE +P+D+ T     +  ++ +   
Sbjct: 309 YMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKPTDLSKSGS 368

Query: 381 HWHKENAHVRTAKPGITAMPSVTNTRTNMAPPSSRMMNSHDPTISSLLKRSTRDQAR 437
               EN  + T K  I     VT   T +   S+R   +  PT+SS    STR QAR
Sbjct: 369 KKTLENM-LNTDKEKIDPNSCVT---TTINHGSNR---AKQPTLSS-SNISTRKQAR 417

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  378 bits (970), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 198/397 (49%), Positives = 253/397 (63%), Gaps = 25/397 (6%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
           ++L+ T+FS P KRIFDS  T DFQ S+ + RL+  L++Y+ +V N + P   T  SV+ 
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 93  VNSIVQLLNHLSTLIDETPPLVG-PRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
             SI   L+    LIDETPP    PRR+GN+ACRDWH K++ ++ +L    L P     +
Sbjct: 63  FVSI--FLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFL-PIERDAA 119

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTD-----GMQ 206
            E+     CI EL YY+ NAFGS  RLD+GTGHELSF+A + A+DMLGLW       G+ 
Sbjct: 120 YEN-----CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLT 174

Query: 207 GTDILLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMR 263
           GTD+L L+N YY++V KLILTYTLEPAGSHGVWGLDDH HLAYI+G+SQW    +NAP++
Sbjct: 175 GTDLLYLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQ 234

Query: 264 PRDVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIK 323
             D+ D+  + QY  +NLYC  IAF+ +VKSGPFS+HSP+LYDI+ +V TWSK   GLIK
Sbjct: 235 LSDILDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIK 294

Query: 324 MYMDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWH 383
           MY  EVL KFPVVQHFWFG GF+PW++   G  LP YE   +     +ER +   A    
Sbjct: 295 MYQVEVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKG--ACKERAVDGDA---- 348

Query: 384 KENAHVRTAKPGITAMPSVTNTRTNMAPPSSRMMNSH 420
             +    TA P  T       T   M PP      SH
Sbjct: 349 --SEDSTTAVPTATGSSGKLTTSAAMPPPRMTTGYSH 383

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  363 bits (932), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 180/340 (52%), Positives = 232/340 (68%), Gaps = 17/340 (5%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
             ++ TQFS P KRIFD+  T DFQ S+ + RL+  L++Y+ +V   + P     S    
Sbjct: 3   FSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKS---SQNRA 59

Query: 93  VNSIVQLLNHLSTLIDETPPLVG-PRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151
           V   V +L  L  L+DETPP  G  RR+G+LACRDWH +M+ +L  LL  +L    P+ +
Sbjct: 60  VVRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLL----PEAA 115

Query: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWT-DGMQGTDI 210
             S++      EL YY+ +AFGS  RLD+GTGHEL+F+A + A+DMLGLWT D   G D+
Sbjct: 116 RRSAA------ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDM 169

Query: 211 LLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVK 268
           L ++  YYALV +LILTY LEPAGSHGVWGLDDH HLAYILG+SQW   RN PM+P D+ 
Sbjct: 170 LYVWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDIL 229

Query: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
           D   V +Y+++NLYC  IAF+ +VK+G F++HSP+L+DIA +V TWSKV  GLIKMY  E
Sbjct: 230 DPKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVE 289

Query: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDE 368
           VL KFPVVQHFWFG GF+PW++   G  LP YE   E  E
Sbjct: 290 VLNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYEAPSETSE 329

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 234/339 (69%), Gaps = 15/339 (4%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
            D +  +FS+P KRIFDSQ T DFQ+S+A+ R+++ LQKYI++    Q P   T+     
Sbjct: 3   FDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIP--DTIKESFF 60

Query: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152
            N +V+LL  LS LIDETPP     RYGNL+ RDW TK + QL   L+E+L    P+   
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELL----PEKYN 116

Query: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212
            S      I EL+YYISNAFGS  R+D+GTGHELSF+A I  +DML + T  ++G  +L 
Sbjct: 117 NS------IIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET--IKGPALLY 168

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIR-NAPMRPRDVKDIS 271
            FN+YY +++KLILTY LEPAGSHGVWGLDDHFH +YILG++Q +  N  + P+D+ +  
Sbjct: 169 CFNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTR 228

Query: 272 LVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLK 331
           L++Q + SNL+C+ I FI  VKSGPFS HSP+LY+I+ SV TW K+Q+GLIKMY  EVL 
Sbjct: 229 LMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLN 288

Query: 332 KFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETE 370
           KFPVVQHFWFG  F+PW +      LPIY+ +  +D+ +
Sbjct: 289 KFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDAD 327

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  348 bits (894), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 259/416 (62%), Gaps = 45/416 (10%)

Query: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92
           LD++   F  P KRIFDSQTT  FQ S+AL R+RF ++KY+ M+    +   G +S+   
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTS---GGISAS-- 70

Query: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152
           V  ++Q+L+ L  L+DETPPLVGPRRYGNLACRDWH K+++ LP L +++       ++G
Sbjct: 71  VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV-----DCLAG 125

Query: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212
             +    CI E  YY+ N+FGS  RLD+GTGHELSF+AF+AA+DM+     G+   ++  
Sbjct: 126 GGA----CI-EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQ-PRGITPVELSR 179

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRN-APMRPRDV-KDI 270
           L++ YY LVR+LI+ Y LEPAGSHGVWGLDDHFHLAY+ G+SQ+  N   ++PRDV   +
Sbjct: 180 LWDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGV 239

Query: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330
              +  A +N   + I F+  VK GPF E+SP+L DI + V++W K+QRGL +MY  EVL
Sbjct: 240 IPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVL 299

Query: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390
            KFPVVQHFWFG  F+PW +   G PLP+YE S    +TEQE      AP          
Sbjct: 300 NKFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSA---DTEQE-TFDSGAP---------- 345

Query: 391 TAKPGITAMP--------SVTNTRTNMAPPSSRMMNSHDPTISSLLKRSTRDQARR 438
              PG T +P        SV + R  M PP+ R +N      ++    S RD+ RR
Sbjct: 346 -PGPGTTTLPALDTSTMASVPSRRPAMGPPAGRQVNKFIQHTTA----SHRDRLRR 396

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  167 bits (423), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 167/308 (54%), Gaps = 16/308 (5%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLN 101
           LP KR+  +   + +  S     L  FL++    V   +   + TL     V S+++LL+
Sbjct: 2   LPQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENT-DYTLPISQPVESMMKLLH 60

Query: 102 HLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHP 159
            + +++ + P +      R+G +  RD++  + +Q   LL E      P ++        
Sbjct: 61  KVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECF----PSLTDSQ----- 111

Query: 160 CIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFNTYY 218
            I++L  Y+  ++G+  R+D+G+GHEL+FM FI  +    ++      T+++L +F  Y 
Sbjct: 112 -IEQLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYL 170

Query: 219 ALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAK 278
            L+R L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +  L++ +A 
Sbjct: 171 KLMRVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQLSTHKHLKPSSIHNDDLIEMFAD 230

Query: 279 SNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQ 337
             LY  CI FI  VK +     HSP+L DI + V  WSKV  G+ KMY  EV+KK P++Q
Sbjct: 231 KYLYFGCIEFINSVKTTTTLRWHSPMLDDI-SGVKKWSKVAEGMFKMYEAEVIKKLPIMQ 289

Query: 338 HFWFGDGF 345
           HF+F D F
Sbjct: 290 HFYFNDMF 297

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  164 bits (415), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/304 (31%), Positives = 162/304 (53%), Gaps = 16/304 (5%)

Query: 43  PAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLNH 102
           P KR+        +  S   N L  FL      V  ++   E    + + + S  QLL  
Sbjct: 3   PQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENN-EYQKPTGSSIESCCQLLEE 61

Query: 103 LSTLIDETPPLVGPR--RYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHPC 160
           +++L ++ P        R+G +  R ++  ++++   L+    D     + G        
Sbjct: 62  VASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDA----LDGTQ------ 111

Query: 161 IQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFNTYYA 219
            +EL+ Y + ++G  +R+D+G+GHEL+F+ F+  +   G++ +     +++L LF  Y  
Sbjct: 112 CEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLG 171

Query: 220 LVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAKS 279
           ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P+ + +  +V+ + K 
Sbjct: 172 VMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHNSEVVEMFGKR 231

Query: 280 NLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQH 338
            LY  CI FI +VK +     HSP+L DI + V TW+KV  G+IKMY  EVL K P++QH
Sbjct: 232 YLYFGCIDFINKVKTTASLRWHSPMLDDI-SGVKTWAKVAEGMIKMYKAEVLNKLPIMQH 290

Query: 339 FWFG 342
           F+FG
Sbjct: 291 FFFG 294

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  163 bits (412), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 162/288 (56%), Gaps = 16/288 (5%)

Query: 93  VNSIVQLLNHLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKV 150
           +NS++ LL+ +  +  + P +      R+G +  RD++ ++         +IL    P +
Sbjct: 52  INSMMNLLSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNS----RKILRSEFPSL 107

Query: 151 SGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDI 210
           + E       +++L+ Y+  ++G+  R+D+G+GHEL+FM  +  +   G++      T++
Sbjct: 108 TDEQ------LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNL 161

Query: 211 LL-LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKD 269
           +L +F  Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +
Sbjct: 162 VLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHN 221

Query: 270 ISLVKQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
             LV+ +A   LY  CIAFI +VK S     HSP+L DI + V TWSKV  G+IKMY  E
Sbjct: 222 NELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYKAE 280

Query: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQ 376
           VL K P++QHF+F + F P  +  +     I++ + +DDE   E  + 
Sbjct: 281 VLSKLPIMQHFYFSE-FLPCPDGVSPPRGHIHDGTDKDDECNFEGHVH 327

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  162 bits (411), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 157/300 (52%), Gaps = 15/300 (5%)

Query: 45  KRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLNHLS 104
           KR+        +++S     L  F+      V   +        S   + ++  LL  + 
Sbjct: 13  KRLLTGSDLDKWKASKTFEELLRFVSSLAQSVRGRENSEHAEPVSPA-IEALEALLEEMQ 71

Query: 105 TLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHPCIQ 162
            +    P L      R+G +  RD+H +++A+  AL+ ++ DP L              Q
Sbjct: 72  GIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQV-DPSLTDEQA---------Q 121

Query: 163 ELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYALVR 222
           EL  Y+ NA+G   R+D+G+GHEL+F+ F+  +   G+ ++      +L +F  Y  ++R
Sbjct: 122 ELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYMDVMR 181

Query: 223 KLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAKSNLY 282
            L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P+ + +  +V+ +    LY
Sbjct: 182 VLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPKSIHNPEVVELFENRYLY 241

Query: 283 CQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQHFWF 341
             CIAFI +VK +     HSP+L DI + V +W+KV  G++KMY  EVL K P++QHF+F
Sbjct: 242 FGCIAFINRVKTTASLRWHSPMLDDI-SGVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF 300

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 164/307 (53%), Gaps = 20/307 (6%)

Query: 43  PAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPP--EGTLSSVTLVNSIVQLL 100
           P KR+      + +  S   N L  F+ K    V   +     E   SS+   + +  LL
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSI---DELCSLL 59

Query: 101 NHLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMH 158
           + ++ ++   P +      R+G +  RD++  + ++   +++ + D    K+S       
Sbjct: 60  DKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSD----KLST------ 109

Query: 159 PCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFNTY 217
           P + EL  Y   ++G+ TR+D+G+GHEL+F+ F+  ++    +      T+++L +F  Y
Sbjct: 110 PQVDELAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKY 169

Query: 218 YALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYA 277
             ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P+ + +   V+ + 
Sbjct: 170 LDVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPKSIHNKEFVEMFE 229

Query: 278 KSNLYCQCIAFIFQVKSG-PFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVV 336
           K  LY  CI FI  VK+      HSP+L DI + V TWSKV  G++KMY  EVL K P++
Sbjct: 230 KRYLYFGCIGFINSVKTSISLRWHSPMLDDI-SGVKTWSKVAEGMVKMYKAEVLGKLPIM 288

Query: 337 QHFWFGD 343
           QHF+FGD
Sbjct: 289 QHFYFGD 295

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 161/308 (52%), Gaps = 20/308 (6%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLN 101
           LP KR+      + +++S     L  F+      V   +        S   +N++ Q+L 
Sbjct: 2   LPEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPA-INTLEQILV 60

Query: 102 HLSTLIDETPPLVGPR--RYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHP 159
            +  +ID+ P L      R+G    R ++ ++      L++E             S  H 
Sbjct: 61  SIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENF----------PSLTHE 110

Query: 160 CIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAI---DMLGLWTDGMQGTDILLLFNT 216
            +++L  Y+  ++G+  R+D+G+GHEL+FM F+  +   D+L L  D      +L++F  
Sbjct: 111 QLEQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNM--VLIIFIK 168

Query: 217 YYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQY 276
           Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +  LV+ +
Sbjct: 169 YLDIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKHLKPLSIHNEELVEMF 228

Query: 277 AKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPV 335
           AK  LY  CIAFI  VK +     HSP+L DI + V  WSKV  G++KMY  EVL K P+
Sbjct: 229 AKKYLYFGCIAFINSVKTTASLRWHSPMLDDI-SGVKRWSKVAEGMVKMYNAEVLSKLPI 287

Query: 336 VQHFWFGD 343
           +QHF+F +
Sbjct: 288 MQHFYFSE 295

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 170/309 (55%), Gaps = 22/309 (7%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSI---VQ 98
           +P KR+  ++  + +  S  ++ L     ++++++ +     E T     +   +   +Q
Sbjct: 2   IPEKRLTTNKDMKIWMDSTTMDSL----VEFVTILADSVRGRENTAYKEPISKDMEPTMQ 57

Query: 99  LLNHLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSS 156
           LL  ++ LID+ P +      R+G +  RD++  ++        E++    P ++ +   
Sbjct: 58  LLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHA----EELVATTYPSLNKDQ-- 111

Query: 157 MHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFN 215
               ++EL  Y+  ++G+  R+D+G+GHEL+F+ FI  + +  ++       D++L +F 
Sbjct: 112 ----VEELAVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFV 167

Query: 216 TYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQ 275
            Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  +RP+ + +  +V+ 
Sbjct: 168 EYLRIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATHPHLRPKSIHNEEVVEM 227

Query: 276 YAKSNLYCQCIAFIFQVKS-GPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFP 334
           +    +Y  CIAFI  VKS      HSP+L DI + V TW+KV  G+IKMY  EVL K P
Sbjct: 228 FMDKYIYFGCIAFINSVKSTASLRWHSPMLDDI-SGVKTWAKVAEGMIKMYKAEVLSKLP 286

Query: 335 VVQHFWFGD 343
           ++QHF+FG+
Sbjct: 287 IMQHFYFGN 295

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  160 bits (406), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 146/252 (57%), Gaps = 14/252 (5%)

Query: 93  VNSIVQLLNHLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKV 150
           + ++  LL+ ++ ++D+ P +   G  R+G +  RD++ ++      L++ +        
Sbjct: 52  IENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSL-------- 103

Query: 151 SGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDI 210
              S      ++EL  Y + ++G   R+D+G+GHEL+F+ F+  +    + +D  +   +
Sbjct: 104 --SSELTDEQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLV 161

Query: 211 LLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDI 270
           L +F  Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P+ + + 
Sbjct: 162 LKVFIKYLDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPKSIHNP 221

Query: 271 SLVKQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEV 329
            +V+ + K  +Y +C+AFI +VK +     HSP+L DI + V TWSKV  G++KMY  EV
Sbjct: 222 EIVEVFEKRYMYFECVAFINKVKTTASLRWHSPMLDDI-SGVRTWSKVAEGMVKMYKAEV 280

Query: 330 LKKFPVVQHFWF 341
           L K P++QHF+F
Sbjct: 281 LGKLPIMQHFFF 292

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  160 bits (406), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/306 (31%), Positives = 165/306 (53%), Gaps = 16/306 (5%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLN 101
           +P+KRI   +  + ++ S     +  F++     V   +        S + V S + +L 
Sbjct: 2   IPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDS-VQSTIAVLT 60

Query: 102 HLSTLIDETPPLVGPR--RYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHP 159
            +  LI   P +      R+G +  RD++  +  +     +++L  + P ++ E      
Sbjct: 61  EIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKA----DDLLSSHFPALTSEQ----- 111

Query: 160 CIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTD-ILLLFNTYY 218
            I++L+ Y+  ++G+  R+D+G+GHEL+F+ F+  +    ++       + +L+LF  Y 
Sbjct: 112 -IEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYL 170

Query: 219 ALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAK 278
            ++R++   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P+ + +  LV+ +A 
Sbjct: 171 KIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHNEELVEMFAD 230

Query: 279 SNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQ 337
             LY  CIAFI  VK S     HSP+L DI + V  WSKV  G+IKMY  EVL K P++Q
Sbjct: 231 KYLYFGCIAFINSVKTSTSLRWHSPMLDDI-SGVKKWSKVAEGMIKMYKAEVLGKLPIMQ 289

Query: 338 HFWFGD 343
           HF+F +
Sbjct: 290 HFYFSE 295

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  160 bits (404), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 182/347 (52%), Gaps = 40/347 (11%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL------VNS 95
           +P KRI      + +++S     L       ++ ++ +    EG  +S  +      + S
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDL-------LNFISTLAESVEGHENSQIVEPISPSIAS 54

Query: 96  IVQLLNHLSTLIDETPPLVGPR--RYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGE 153
           +  LL+ ++ L+D+ P +   +  R+G +  RD++ ++  +  +L+          +S E
Sbjct: 55  LSSLLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIK----TRFSTLSDE 110

Query: 154 SSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTD-ILL 212
                  +++L+ Y+  ++G+  R+D+G+GHEL+F+ F+  +   GL+       + +L+
Sbjct: 111 Q------LEQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLV 164

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISL 272
           +F  Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q + +  ++P  + +  L
Sbjct: 165 VFLKYLNIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHKHLKPMSIHNEEL 224

Query: 273 VKQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLK 331
           V+ +    LY  CI+FI  VK +     HSP+L DI + V  WSKV  G+IKMY  EVL 
Sbjct: 225 VELFKDKFLYFGCISFINSVKTTTSLRWHSPMLDDI-SGVKKWSKVAEGMIKMYTAEVLG 283

Query: 332 KFPVVQHFWFG------DGFYPWINQHTGKPLPIYEHSPEDDETEQE 372
           K P++QHF+F       +G  P  + H      I+  + EDDE  QE
Sbjct: 284 KLPIMQHFYFSEFLKCPEGISPARSNH------IHNGTDEDDECLQE 324

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  158 bits (400), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 161/311 (51%), Gaps = 25/311 (8%)

Query: 41  SLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMV-----TNVQTPPEGTLSSVTLVNS 95
           S P KR+      + + SS     L  F+      V     T  + P    +SS      
Sbjct: 3   SCPQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKEPISAEVSST----- 57

Query: 96  IVQLLNHLSTLIDETPPLVGP-RRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGES 154
            + LL+ + +++DE P L     R+G    R ++  +++    LL++  D          
Sbjct: 58  -LALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQ---- 112

Query: 155 SSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILLL- 213
                 I++L+ Y   ++G+  R+D+G+GHEL+F+ F+  +    ++      T+I++L 
Sbjct: 113 ------IEQLSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILV 166

Query: 214 FNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLV 273
           F  Y  ++R+L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P+ + +  +V
Sbjct: 167 FVKYLKIMRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSNHKHLKPKSIHNDEIV 226

Query: 274 KQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKK 332
             +    LY  CIAFI  VK +     HSP+L DI + V  WSKV  G+IKMY+ EVL K
Sbjct: 227 DMFKDKYLYFGCIAFINSVKTTASLRWHSPMLDDI-SGVKKWSKVSEGMIKMYVAEVLSK 285

Query: 333 FPVVQHFWFGD 343
            PV+QHF+F +
Sbjct: 286 LPVMQHFYFSE 296

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  159 bits (401), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 168/307 (54%), Gaps = 18/307 (5%)

Query: 42  LPAKRIFDSQTTQDFQSS-IALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLL 100
           LP KR+  S   + ++ S    N  +F +    S+  +  +  E  +S    ++ ++ LL
Sbjct: 2   LPEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEP--ISRMMNLL 59

Query: 101 NHLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMH 158
           +++  +I + P +      R+G +  RD++ ++         + L    P ++ E     
Sbjct: 60  SYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSS----RKFLRSEFPSLTDEQ---- 111

Query: 159 PCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFNTY 217
             +++L+ Y+  ++G+  R+D+G+GHEL+FM  +  +   G++      T+++L +F  Y
Sbjct: 112 --LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEY 169

Query: 218 YALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYA 277
             ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +  LV+ +A
Sbjct: 170 LKIMRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTSHKHLKPISIHNNELVEMFA 229

Query: 278 KSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVV 336
              LY  CI FI +VK S     HSP+L DI + V TWSKV  G+IKMY  EVL K P++
Sbjct: 230 NRYLYFGCIDFINKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYEAEVLSKLPIM 288

Query: 337 QHFWFGD 343
           QHF+F D
Sbjct: 289 QHFYFSD 295

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  158 bits (399), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/342 (31%), Positives = 176/342 (51%), Gaps = 23/342 (6%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLN 101
           LP KR+  +   + ++ S    + R    K+I  +       E       +   I+ ++N
Sbjct: 2   LPEKRLLTAGDMKLWEES----QTRADFTKFIIELAESVKGHENYQFKEPISEQIISMMN 57

Query: 102 HLSTLID--ETPPLV---GPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSS 156
            LS + D  +  P+V      R+G +  RD++ ++      LL        P ++ E   
Sbjct: 58  LLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLR----SEFPHLTDEQ-- 111

Query: 157 MHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFN 215
               +++L+ Y+  ++G+  R+D+G+GHEL+FM  +  +   G++      T+++L +F 
Sbjct: 112 ----LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFI 167

Query: 216 TYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQ 275
            Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +  LV+ 
Sbjct: 168 EYLQIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEM 227

Query: 276 YAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFP 334
           +A   LY  CIAFI +VK S     HSP+L DI + V TWSKV  G+IKMY  EVL K P
Sbjct: 228 FAHRYLYFGCIAFINKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYKVEVLSKLP 286

Query: 335 VVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQ 376
           ++QHF+F + F P     +     I+  +  DDE   E  + 
Sbjct: 287 IMQHFYFCE-FLPCPEGVSRSRGHIHNGTYADDECNFEDHVH 327

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  156 bits (395), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 147/255 (57%), Gaps = 15/255 (5%)

Query: 93  VNSIVQLLNHLSTLIDETPPLVGPR--RYGNLACRDWHTKMEAQLPALLNEILDPYLPKV 150
           + S + LL  ++ +ID+ P +   +  R+G +  RD++ ++ +Q   L++       P +
Sbjct: 52  IESFMGLLKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAY----PSL 107

Query: 151 SGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDI 210
           + +       + +L  Y+  ++G+  R+D+G+GHEL+F+  +  +    ++ +    T++
Sbjct: 108 TEDQ------LDQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNM 161

Query: 211 LL-LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKD 269
           +L +F  Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +
Sbjct: 162 VLKIFIEYLRVMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPLSIHN 221

Query: 270 ISLVKQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
             LV+ +    LY  C+AFI  VK S     HSP+L DI + V  WSKV  G+IKMY  E
Sbjct: 222 EELVEMFQDKYLYFSCVAFINSVKTSTSLRFHSPMLDDI-SGVKKWSKVAEGMIKMYRAE 280

Query: 329 VLKKFPVVQHFWFGD 343
           VL K P++QHF+FG+
Sbjct: 281 VLSKLPIMQHFYFGE 295

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  156 bits (394), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 160/287 (55%), Gaps = 22/287 (7%)

Query: 93  VNSIVQLLNHLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKV 150
           +  ++ LL+ +  +I++ P +  V   R+G +  RD++ ++      LL           
Sbjct: 52  ITRMLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLK---------- 101

Query: 151 SGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDI 210
           S  S      +++L+ Y+  ++G+  R+D+G+GHEL+FM  +  +   G++      T++
Sbjct: 102 SEFSLLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNL 161

Query: 211 LL-LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKD 269
           +L +F  Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +
Sbjct: 162 ILKVFIEYLDIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHN 221

Query: 270 ISLVKQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
             LV+ ++   LY  CIAFI +VK S     HSP+L DI + V TWSKV  G+IKMY  E
Sbjct: 222 SELVEMFSDRYLYFGCIAFINKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYEAE 280

Query: 329 VLKKFPVVQHFWFGDGFYPW---INQHTGKPLPIYEHSPEDDETEQE 372
           VL K P++QHF+F + F P    ++Q  G    I++ +  DDE   E
Sbjct: 281 VLSKLPIMQHFYFSE-FLPCPEGVSQPRGH---IHDGTDADDECNIE 323

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  155 bits (392), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 164/316 (51%), Gaps = 30/316 (9%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQT-----PPEGTLSSV-TLVNS 95
           LP KR+      Q +Q+    + L  FL +    V  ++      P  G++ SV  L+  
Sbjct: 3   LPEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQSVEALIEC 62

Query: 96  IVQLLNHLSTLIDETPPL--VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGE 153
           + Q +        E  P+   GP R+G    RD +  +  +   L+ E            
Sbjct: 63  VDQCI--------ENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKF---------- 104

Query: 154 SSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTD-ILL 212
            S     + +L+ Y + ++G  +R+D+G+GHEL+F+ F+  +   G++       + +L+
Sbjct: 105 GSLTDEQVAQLSVYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLI 164

Query: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISL 272
           +F  Y   +R +   Y LEPAGSHGVWGLDD+  L ++ G+SQ   +  ++P+ + +  +
Sbjct: 165 VFMKYLKTMRVIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQLSTHRHLKPKSIHNPEV 224

Query: 273 VKQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLK 331
           V+ +++  LY  CI FI  VK +     HSP+L DI + V  W+KV +G++KMY  EVL 
Sbjct: 225 VEMFSEKYLYFGCIDFINSVKTTASLRWHSPMLDDI-SGVKEWAKVYQGMVKMYDAEVLC 283

Query: 332 KFPVVQHFWFGDGFYP 347
           K P++QHF+F + F P
Sbjct: 284 KLPIMQHFYFSE-FLP 298

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  155 bits (391), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 160/304 (52%), Gaps = 16/304 (5%)

Query: 43  PAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLNH 102
           P KR+  SQ  + +      ++L  F+ +    V  ++          + ++    LL+ 
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGAS-IDKCCSLLDE 61

Query: 103 LSTLIDETPPLVGPR--RYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHPC 160
           + ++  + P        R+G +  R ++  +  +   L+++  D    ++S + +     
Sbjct: 62  VFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFD----QLSQDQA----- 112

Query: 161 IQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFNTYYA 219
            +EL  Y   ++G   R+D+G+GHEL+F+ F+  +   GL+       +++L +F  Y  
Sbjct: 113 -EELVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLE 171

Query: 220 LVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQYAKS 279
           L+R L  TY LEPAGSHGVWGLDD+  L ++ G+SQ   +  ++P+ + +  LV  +A  
Sbjct: 172 LMRVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHKHLKPKSIHNNELVDMFASR 231

Query: 280 NLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQH 338
            LY  CI FI +VK +     HSP+L DI +   +WSKV  G+IKMY  EVL K P++QH
Sbjct: 232 YLYFGCIDFINRVKTTASLRWHSPMLDDI-SGAKSWSKVAEGMIKMYRKEVLAKLPIMQH 290

Query: 339 FWFG 342
           F FG
Sbjct: 291 FLFG 294

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  155 bits (391), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/254 (33%), Positives = 145/254 (57%), Gaps = 12/254 (4%)

Query: 93  VNSIVQLLNHLSTLID--ETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKV 150
           V  +  LL+ ++ +I   E        R+G +  RD++  +      L+++I +      
Sbjct: 51  VQRVSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPD 110

Query: 151 SGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDI 210
           +G+       + ++  Y  N++G  +R+D+G+GHEL+F+ F+  +    ++      ++I
Sbjct: 111 TGK-------LDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNI 163

Query: 211 -LLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKD 269
            L+LF  Y  ++R L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P+ + +
Sbjct: 164 VLMLFIKYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHN 223

Query: 270 ISLVKQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328
             +V+ +    LY  CIAFI +VK +     HSP+L DI + V  WSKV  G++KMY  E
Sbjct: 224 PEVVEMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDI-SGVKRWSKVAEGMVKMYKAE 282

Query: 329 VLKKFPVVQHFWFG 342
           VL+K P++QHF+FG
Sbjct: 283 VLQKLPIMQHFYFG 296

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  155 bits (391), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 163/311 (52%), Gaps = 22/311 (7%)

Query: 41  SLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLL 100
           ++P KR+   +    ++SS     L  F+++    V   +   +  L     V +++ LL
Sbjct: 4   AMPCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENE-QYDLPISASVEALMGLL 62

Query: 101 NHLSTLIDETPPL---VGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSM 157
             +  +I+  P         R+G +  RD++ ++ A+  +L+        P+++      
Sbjct: 63  QQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAF----PQLTQNQ--- 115

Query: 158 HPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTD----ILLL 213
              +++L  Y+  ++G   R+D+G+GHEL+FM F+  +    ++  G  GTD    +L  
Sbjct: 116 ---VRQLQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLG--GTDRANLVLKP 170

Query: 214 FNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLV 273
           F  Y  ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  ++P  + +  +V
Sbjct: 171 FIEYLKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPLSIHNEEVV 230

Query: 274 KQYAKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKK 332
           + +A   LY  CI FI  VK +     HSP+L DI + V  WSKV  G++KMY  EVL K
Sbjct: 231 ELFADKYLYFGCIHFINSVKTTATLRWHSPMLDDI-SGVKKWSKVAEGMVKMYQAEVLSK 289

Query: 333 FPVVQHFWFGD 343
            P++QHF+F D
Sbjct: 290 LPIMQHFYFSD 300

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  147 bits (372), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/312 (29%), Positives = 160/312 (51%), Gaps = 19/312 (6%)

Query: 42  LPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLN 101
           +P KR+  SQ    + +S     L  F++   + + + Q   + +L     +N+   LL 
Sbjct: 1   MPEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNS-QLSLPLSDSINNAFSLLQ 59

Query: 102 HLSTLIDETPPLVG----PRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSM 157
            +  +I+  P          R+G +  + ++  +      L+    +   P         
Sbjct: 60  DIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQ------- 112

Query: 158 HPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL-LFNT 216
              IQEL+ Y+  ++G+  R+D+G+GHEL+F+ F+  +    ++      T+++L +F  
Sbjct: 113 ---IQELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFME 169

Query: 217 YYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPRDVKDISLVKQY 276
           Y  ++R +   Y LEPAGSHGVWGLDD+  L ++ G+ Q  ++  ++P  + +  +V+ +
Sbjct: 170 YINIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKHLKPISIHNEEMVEMF 229

Query: 277 AKSNLYCQCIAFIFQVK-SGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPV 335
               +Y  CI FI  +K +     HSP+L DI + V  WSKV  G+IKMY  EVL K P+
Sbjct: 230 KDKYMYFGCIDFINSIKTTATLRWHSPMLDDI-SGVKKWSKVSEGMIKMYSAEVLGKLPI 288

Query: 336 VQHFWFGDGFYP 347
           +QHF+F D F P
Sbjct: 289 MQHFYFSD-FLP 299

>ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL313C
          Length = 905

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 94  NSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNE 141
           NS V     L    +   P+ G    G+L C+DW  K  + + +LLN+
Sbjct: 837 NSTVDTCEELVAAYESLGPMEGKHGAGDLVCKDWKYKARSTIKSLLNK 884

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
           Anc_4.344 YML076C
          Length = 945

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 351 QHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVRTAKPGITAMPSVTNTRTNMA 410
            +TGKPL +   +P    T+     QQY+P+    N ++++ +   +  P+   TR  M 
Sbjct: 154 NNTGKPLKLGHFTPSSLPTQANNLNQQYSPNETIPNNNIQSYQAS-SQNPNSEGTR--ML 210

Query: 411 PPSSRMMNSHDPTISSL 427
           P +S +++S  P +SSL
Sbjct: 211 PDTSTILSSVTPPVSSL 227

>NDAI0G02160 Chr7 (487168..489909) [2742 bp, 913 aa] {ON} Anc_8.401
           YLR240W
          Length = 913

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 14/75 (18%)

Query: 95  SIVQLLNHLSTLIDETPPLVGP------------RRYGNLACRDWHTKMEAQLPALLNEI 142
           S+++ +    T ++ETP ++ P            RR GN     W+ K E+Q    LN+I
Sbjct: 496 SLMKPIKENGTSLEETPIVISPLAEFLIRRALKNRRLGNFFY--WYLKAESQDNPYLNQI 553

Query: 143 LDPYLPKVSGESSSM 157
           LD Y  ++S E   +
Sbjct: 554 LDSYWGRLSKEHKKI 568

>Kpol_1006.9 s1006 (38965..42843) [3879 bp, 1292 aa] {ON}
            (38965..42843) [3879 nt, 1293 aa]
          Length = 1292

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 56   FQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQLLNHLSTLIDETPPLVG 115
            ++SSI L    F L   +  +      PEG++ +V  + ++ +LL ++  L D+    +G
Sbjct: 1157 YESSILLETQNFLLGDKVRYILKSGLVPEGSIGTVISLRTVAKLL-YIDVLFDDE--FLG 1213

Query: 116  PRRYGNL 122
             R YG++
Sbjct: 1214 GRTYGDV 1220

>NCAS0D00360 Chr4 (53637..55265) [1629 bp, 542 aa] {ON} Anc_2.63
           YNL189W
          Length = 542

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 36/70 (51%), Gaps = 10/70 (14%)

Query: 82  PPEG--TLSSVTLVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRD---WHTKMEA-QL 135
           PPE    +  V +   +V+LLNHLST++ + P L   R  GNL   D     T + A  L
Sbjct: 288 PPEAIQAVIDVRIPKKLVELLNHLSTMV-QVPAL---RAVGNLVTGDDLQTQTIINAGAL 343

Query: 136 PALLNEILDP 145
           PAL N +  P
Sbjct: 344 PALRNLLNSP 353

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,853,438
Number of extensions: 2033057
Number of successful extensions: 6226
Number of sequences better than 10.0: 50
Number of HSP's gapped: 6322
Number of HSP's successfully gapped: 50
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)