Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0G001805.711ON65465434020.0
NDAI0F002105.711ON65365625440.0
SAKL0E15114g5.711ON64965623260.0
KAFR0D021705.711ON66067123220.0
CAGL0H06699g5.711ON65061223110.0
TPHA0E001505.711ON64665622880.0
TDEL0B020905.711ON64360822740.0
KLLA0A00418g5.711ON64265622690.0
Kwal_55.196495.711ON64165422610.0
KLTH0E00836g5.711ON64165522580.0
Kpol_1043.775.711ON65766522580.0
ZYRO0B16522g5.711ON64365522290.0
Ecym_40105.711ON64459522000.0
AFR295W5.711ON63159621860.0
TBLA0E017505.711ON66560221850.0
YIL155C (GUT2)5.711ON64960021730.0
Skud_9.135.711ON64959921470.0
Smik_9.145.711ON65260021410.0
Suva_9.325.711ON53854220270.0
KNAG0L021905.711ON64559620210.0
Kpol_1050.505.110ON271163751.2
Kwal_27.98675.110ON268174732.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0G00180
         (654 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...  1315   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   984   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   900   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   899   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   894   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   885   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   880   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   878   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   875   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   874   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   874   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   863   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   852   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   846   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   846   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   841   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   831   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   829   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   785   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   783   0.0  
Kpol_1050.50 s1050 complement(114871..115686) [816 bp, 271 aa] {...    33   1.2  
Kwal_27.9867 s27 (92674..93480) [807 bp, 268 aa] {ON} YGR220C (M...    33   2.5  

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score = 1315 bits (3402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/654 (97%), Positives = 639/654 (97%)

Query: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP 60
           MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP
Sbjct: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP 60

Query: 61  TRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKMA 120
           TRSKLLQQLKEKGQFDVLII               RGLQVALVEQNDFASGTSSKSTKMA
Sbjct: 61  TRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKMA 120

Query: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180
           HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA
Sbjct: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180

Query: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240
           GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT
Sbjct: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240

Query: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300
           AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ
Sbjct: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300

Query: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360
           MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV
Sbjct: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360

Query: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420
           RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV
Sbjct: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420

Query: 421 LSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMAE 480
           LSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMAE
Sbjct: 421 LSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMAE 480

Query: 481 ETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGTR 540
           ETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGTR
Sbjct: 481 ETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGTR 540

Query: 541 SPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTALD 600
           SPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTALD
Sbjct: 541 SPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTALD 600

Query: 601 FLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           FLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV
Sbjct: 601 FLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/656 (73%), Positives = 546/656 (83%), Gaps = 5/656 (0%)

Query: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP 60
           MF+R  K+ +       T ++ GT V   +    T F+NFQS   P L+SPV+ ++++LP
Sbjct: 1   MFARRPKTTI---FLAATAITAGTLVVRRKYHSGTKFNNFQSDFNPYLISPVEDVEINLP 57

Query: 61  TRSKLLQQLKEKG-QFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           +RS+L  QL  K  QFD+LII               RGL VALVE++DFASGTSSKSTKM
Sbjct: 58  SRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTKM 117

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKAF Q SKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVY YWQ+PYFY
Sbjct: 118 AHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFY 177

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
           AGCK YD FAG+QNLK+SYL+SR NAIE+APML+A NLKAALVYHDGSFNDSRLN+++AI
Sbjct: 178 AGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAI 237

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           TAIE GATVLNYVEV+KLLKD  +  I GVTV+D ETG+  +V SKV+VNATGP+SD IL
Sbjct: 238 TAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTIL 297

Query: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359
           QMDKN +GLPD  N++PKM +P DISSKIAV NP MVVPSSGVHIILPSYYCPKQMGLLD
Sbjct: 298 QMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLD 357

Query: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419
            RT+DGRVMFFLPWQGKVIAGTTDIPM+QVP+TPVAKE DIQDILKELQHYIKFPV+RED
Sbjct: 358 ARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRED 417

Query: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479
           VLSAWAGIRPLVRDPRL+  D  + LG+TQGLVRSHF+FTSDNGL+TIAGGKWTTYREMA
Sbjct: 418 VLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMA 477

Query: 480 EETIDEVVKNGAFVD-AKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYG 538
           EETIDEVVK G F + AKPC T++LKL GAE WDPN+ ALLSQK+NL SMMA YLS+NYG
Sbjct: 478 EETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYG 537

Query: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598
           TRS IIC+LF  +E+NKLPV LAG E + ILGN DFNTFRYPITI ELKY+M+YEYART 
Sbjct: 538 TRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYARTP 597

Query: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           LDFLMRRTRFA+LDA +AL AV GTVK+MGDEF W S+RR++E +    FI+SFGV
Sbjct: 598 LDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/656 (65%), Positives = 524/656 (79%), Gaps = 9/656 (1%)

Query: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP 60
           MF+  ++ M+         V   T ++  Q+ +K+  +N  +     + +PV   +++LP
Sbjct: 1   MFANATRRMVVPAAFAAATVGGATILWHQQQQQKSVINNDVT-----VTNPVQKSKINLP 55

Query: 61  TRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKMA 120
           TR  LL +L +  QFDVLII               RGL VALVE NDFASGTSSKSTKMA
Sbjct: 56  TRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALVEMNDFASGTSSKSTKMA 115

Query: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180
           HGGVRYLEKAF++LSK+QLDLV+EALNERAH+L TAPHLCKILPI+IPVY YWQ PYFY 
Sbjct: 116 HGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYV 175

Query: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240
           GCK+YDLFAG+QNLK+SY+L+ S A E+APML+A+ LKA LVYHDGSFNDSR+NATLA+T
Sbjct: 176 GCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAVT 235

Query: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300
           A+E+GATVLNY+EV++L+K+ +TG + G   +D ETG+T  + +KVVVNATGPFSD+ILQ
Sbjct: 236 AVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRILQ 295

Query: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360
           MD++  GLPDD  L    IN   ISSK+AV NP MVVPS+GVHI+LPS+YCPK++GLLD 
Sbjct: 296 MDEDSKGLPDDRLLQSSNINAT-ISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDA 354

Query: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420
           +TSDGRVMFFLPWQGKV+AGTTDIPM Q+PE P A EADIQDILKELQHYIKFPVKREDV
Sbjct: 355 KTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDV 414

Query: 421 LSAWAGIRPLVRDPR-LVSPDEKKVLG-STQGLVRSHFIFTSDNGLVTIAGGKWTTYREM 478
           LSAWAGIRPLV+DPR  +  +  +V   STQ LVRSHF+FTSDN LVTIAGGKWTTYREM
Sbjct: 415 LSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREM 474

Query: 479 AEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYG 538
           +EETI+EVVK G F +AKPCITR+LKLAGAE +DPN+ A+L+Q+Y+L S MA YL++NYG
Sbjct: 475 SEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYG 533

Query: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598
           TR+P+ICELF +D+ NKLP+   G+E   + GN DF++FRYP TIGELKYS+  EY RTA
Sbjct: 534 TRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTA 593

Query: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           LDFLMRRTR+AFLDAK+AL AV GTVK+MGDE +W S RRQEE+EK  +FIK+FGV
Sbjct: 594 LDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/671 (64%), Positives = 528/671 (78%), Gaps = 28/671 (4%)

Query: 1   MFSRGSKSMLSK----GLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQ 56
           MF+  +K++L K    G+A VTV     G+ + ++  +   H    Q    L+SP+D   
Sbjct: 1   MFTAKTKNLLPKVVVAGIATVTV----GGIIYAKKGPR--IHAPSYQEDGKLISPLDKRS 54

Query: 57  VSLPTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKS 116
           V+LPTR+ L+ +L +  QFDVL+I               RGL VALVE+ DFASGTSSKS
Sbjct: 55  VNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKS 114

Query: 117 TKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVP 176
           TKMAHGGVRYLEKAF++LSK+QLDLVIEALNERAHLLNTAPHLCKILPI+IPVY YWQ+P
Sbjct: 115 TKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIP 174

Query: 177 YFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNAT 236
           YFYAGCK+YDLFAG+QNLK+SYLLS+ +A ++APML+ T LKA LVYHDG+FNDSR+N+T
Sbjct: 175 YFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNST 234

Query: 237 LAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSD 296
           LA+TAIE G+TVLNY+EV++LLK+  +G I G  V D+ETG   ++ +KVV+NATGP+SD
Sbjct: 235 LAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSD 294

Query: 297 KILQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMG 356
            ILQMD+NPTGLPD +N+N K  N  DI++K++V NP MVVPS+GVHIILPS+YCPK +G
Sbjct: 295 AILQMDQNPTGLPDPLNVNLKTNN--DIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIG 352

Query: 357 LLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVK 416
           LLD +TSDGRVMFFLPWQGKV+AGTTD+PM Q+PE P A EADIQDILKELQHYI+FPVK
Sbjct: 353 LLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVK 412

Query: 417 REDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYR 476
           REDVLSAWAGIRPLV+DPR +   +K   GSTQGLVRSHFIFTSD+GLVTIAGGKWTTYR
Sbjct: 413 REDVLSAWAGIRPLVKDPRTL---DKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYR 469

Query: 477 EMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDN 536
            MAEET+DE +K G F + KPCITR++KLAG E W+PN+ ALL+Q+Y+L S ++ +L+DN
Sbjct: 470 AMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADN 529

Query: 537 YGTRSPIICELFLNDEINKLPVLLAG---EEKEQILGNTD----------FNTFRYPITI 583
           YGTR+PIICE++  D  NKLP+ LA    E +++I    D          F  FRYP T+
Sbjct: 530 YGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTV 589

Query: 584 GELKYSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKE 643
           GE+KYS+ YEYA TALDFLMRR+RFAFLDAKEA+ AV GTVKIMGDE NW   RR +E E
Sbjct: 590 GEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIE 649

Query: 644 KTIQFIKSFGV 654
            TI++IK+FGV
Sbjct: 650 NTIKYIKTFGV 660

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/612 (69%), Positives = 505/612 (82%), Gaps = 11/612 (1%)

Query: 48  LVSPVDTLQVSLPTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQND 107
           L+SPV+   V LPTR +LL +L    QFDVLII               RGL VALVE+ND
Sbjct: 45  LISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVEKND 104

Query: 108 FASGTSSKSTKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILI 167
           FASGTSSKSTKMAHGGVRYLEKAF+++SK+QLDLVIEALNERAHLLNTAPHLCK+LPI+I
Sbjct: 105 FASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPIII 164

Query: 168 PVYTYWQVPYFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGS 227
           PVY YWQVPYFYAGCK+YDLFAG+QNLK SYL+S++  +E+APML+ +NLKA LVYHDGS
Sbjct: 165 PVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHDGS 224

Query: 228 FNDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVV 287
           FND+R+NATLA+TAIE  ATVLNY+EV++L+KD + G + G  V D ETG T  V +KVV
Sbjct: 225 FNDTRMNATLAVTAIENSATVLNYMEVKQLVKDKD-GKVAGAVVEDRETGKTYSVRAKVV 283

Query: 288 VNATGPFSDKILQMDKNPTGLPDDMNLNPKMI-----NPEDISSKIAVKNPNMVVPSSGV 342
           VNATGP+SD++LQMD NP GLPD++    + I       + I S++AV  PNMVVPS+GV
Sbjct: 284 VNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPSAGV 343

Query: 343 HIILPSYYCPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQD 402
           HIILPS+YCPK+MGLLD +TSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P A EADIQD
Sbjct: 344 HIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEADIQD 403

Query: 403 ILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDN 462
           ILKELQ YIKFPVKREDVLSAWAGIRPLV DPR     + K  GSTQGLVRSHFIFTSD+
Sbjct: 404 ILKELQPYIKFPVKREDVLSAWAGIRPLVTDPR----KKSKADGSTQGLVRSHFIFTSDH 459

Query: 463 GLVTIAGGKWTTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQK 522
           GLVTIAGGKWTTYR MAEETIDEVVKNG F DAKPCITR+LKLAGAE WDPN+ ALL+QK
Sbjct: 460 GLVTIAGGKWTTYRAMAEETIDEVVKNGKF-DAKPCITRKLKLAGAENWDPNLPALLAQK 518

Query: 523 YNLPSMMANYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPIT 582
           Y+L   M++YL++NYGTR+P+ICE+F  D  N+LP+LLA +E+  +LG+ DF++FRYPIT
Sbjct: 519 YHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDFDSFRYPIT 578

Query: 583 IGELKYSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEK 642
           I ELKY+++YEYARTALDFLMRRTRFAFLDAK+AL AV GTV++MGD   W  +RRQ+E 
Sbjct: 579 IAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQDEI 638

Query: 643 EKTIQFIKSFGV 654
             + +FIK+FGV
Sbjct: 639 RYSTEFIKTFGV 650

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/656 (64%), Positives = 527/656 (80%), Gaps = 12/656 (1%)

Query: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQS--QHTPGLVSPVDTLQVS 58
           MF    K + S+ L   T  ++    ++  + + T+  +  S  Q+   L +PVD+  V+
Sbjct: 1   MFRHAVKQVASRKLVAGTAAAVVGASFYYNQLQSTNNWDNASIIQNEAVLANPVDSPNVN 60

Query: 59  LPTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTK 118
           +PTRS+L+  LK   QFDVLII               RGL VALVE++DFASGTSSKSTK
Sbjct: 61  IPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALVEKDDFASGTSSKSTK 120

Query: 119 MAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYF 178
           MAHGGVRYLEKA FQLSK+QLDLVIEALNERAHLL TAPHLCKILPI+IPVY YWQVPYF
Sbjct: 121 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYF 180

Query: 179 YAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLA 238
           YAG K+YD+FAG+QNLK+SYL+S++NA E+APML+ + LKA LVYHDG+FNDSR+N+TLA
Sbjct: 181 YAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLA 240

Query: 239 ITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKI 298
           ITAIE GATVLNY+EV++LLKD  +  + G  V DIETG+ + + +KV+VNATGP+SDKI
Sbjct: 241 ITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKI 300

Query: 299 LQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLL 358
           LQMD N  G PD+   + +      I++K+AV+NP+MVVPS+GVHIILPS+YCP++MGLL
Sbjct: 301 LQMDNNKNGKPDEFTQSAET----SIATKVAVQNPHMVVPSAGVHIILPSFYCPREMGLL 356

Query: 359 DVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRE 418
           D  TSDGRVMFFLPWQGKV+AGTTDIPM  VPE P A EADIQDILKELQHYIKFPVKRE
Sbjct: 357 DANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKRE 416

Query: 419 DVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREM 478
           DVLSAWAGIRPLV+DPR  +P E    G+TQ LVRSHFIFTSD+GLVTIAGGKWTTYREM
Sbjct: 417 DVLSAWAGIRPLVQDPR-KTPKE----GATQELVRSHFIFTSDHGLVTIAGGKWTTYREM 471

Query: 479 AEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYG 538
           AEETID VVKNG F + KPC TR+LKLAG E +DPN++ALL+QKY+LPS ++ +L++NYG
Sbjct: 472 AEETIDTVVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPSKLSEHLANNYG 530

Query: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598
           TRSP+IC++F+ D+ N+LP+ LAG+E+ ++ G  DF++FRYP +I E+KY + +EYART 
Sbjct: 531 TRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRYPYSIAEVKYCVHHEYARTT 590

Query: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           LDFLMRR+RFAFLDAK+AL++V GTVKIMGDE NW  ERR++E + +I++IK+FGV
Sbjct: 591 LDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/608 (68%), Positives = 491/608 (80%), Gaps = 8/608 (1%)

Query: 47  GLVSPVDTLQVSLPTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQN 106
            L S VDT  V LP+R  LL +L +  QFDVL+I               RGL VALVE +
Sbjct: 44  ALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVEMH 103

Query: 107 DFASGTSSKSTKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 166
           DFASGTSSKSTKMAHGGVRYLEKA FQLSK+QLDLVIEALNER H+LNTAPHLCKILPI+
Sbjct: 104 DFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIM 163

Query: 167 IPVYTYWQVPYFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDG 226
           IPVYTYWQ+PYFY GCK+YDLFAG+QNLKNSYLL++  A ++APML+ T LKA LVYHDG
Sbjct: 164 IPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDG 223

Query: 227 SFNDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKV 286
           SFNDSR+N  LA+TAIE GATVLNY+EV++L+KD ETG + G  V + ETG+   V +KV
Sbjct: 224 SFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKV 283

Query: 287 VVNATGPFSDKILQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIIL 346
            VNATGP+SDK+LQMD+N  G PD     P       IS+K+AV+NP MVVPS+GVHIIL
Sbjct: 284 TVNATGPYSDKLLQMDENKDGKPDPTKPLPNAT----ISTKVAVENPKMVVPSAGVHIIL 339

Query: 347 PSYYCPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKE 406
           PS+YCP++MGLLDV+TSDGRVMFFLPWQGKV+AGTTDIPM QVP+TP A E+DIQDIL+E
Sbjct: 340 PSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQE 399

Query: 407 LQHYIKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVT 466
           LQHYIKFPVKREDVLSAWAGIRPLV DPR     +    GSTQGLVRSH  FT+DNG+VT
Sbjct: 400 LQHYIKFPVKREDVLSAWAGIRPLVIDPR---KSQGNTGGSTQGLVRSHLCFTTDNGMVT 456

Query: 467 IAGGKWTTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLP 526
           IAGGKWTTYREMAEETI+EVVK G F + KPCITR+LKL+GAE W+PN++ALL+QKY+L 
Sbjct: 457 IAGGKWTTYREMAEETINEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAALLAQKYHLS 515

Query: 527 SMMANYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGEL 586
             M+N+LS+NYGTR+P+ICE+F  DE N+LPV   G E   + GN +F++FRYP TIGEL
Sbjct: 516 GAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIGEL 575

Query: 587 KYSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTI 646
            YS+ YEY RTALDFLMRRTRFAFLDA++AL AV GTV +MGD+ NW S RR+ E EK+ 
Sbjct: 576 NYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSK 635

Query: 647 QFIKSFGV 654
           +FI++FGV
Sbjct: 636 EFIRTFGV 643

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/656 (64%), Positives = 519/656 (79%), Gaps = 16/656 (2%)

Query: 1   MFS--RGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVS 58
           MF+  R SK +L   ++   V      V  + +S+ T  +  Q+  +   VS +    V 
Sbjct: 1   MFAAKRASKVLLGSAVSAAAVFG---AVSMVNQSRDT--NTLQNDVS---VSTIKKSNVD 52

Query: 59  LPTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTK 118
           LP+R+ LL +L +  +FDVLII               RGL VALVE NDFASGTSSKSTK
Sbjct: 53  LPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTK 112

Query: 119 MAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYF 178
           MAHGGVRYLEKAF++LSK+QLDLVIEALNERAH+LNTAPHLCKILPI+IPVY YWQVPYF
Sbjct: 113 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYF 172

Query: 179 YAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLA 238
           Y G K+YDLFAG+QNLK+SYLLS S A E+APML+A+ LKA LVYHDGSFNDSR+N++LA
Sbjct: 173 YVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLA 232

Query: 239 ITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKI 298
           ITAIE+GATVLNYV++++L+K+ ETG + G    D ETGD   + +KVVVNATGP+SD++
Sbjct: 233 ITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRL 292

Query: 299 LQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLL 358
           LQMD++PTGLPDD  L  K+     +S+KIAV NP MVVPS+GVHI+LPS+YCPK++GLL
Sbjct: 293 LQMDQSPTGLPDDSVLQ-KINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLL 351

Query: 359 DVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRE 418
           D +TSDGRVMFFLPWQGKV+AGTTDIPM Q+PE P A EADIQDILKELQHYI FPVKRE
Sbjct: 352 DAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKRE 411

Query: 419 DVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREM 478
           DVLSAWAGIRPLV+DPR          GSTQ LVRSHF+FTS + LVTI+GGKWTTYREM
Sbjct: 412 DVLSAWAGIRPLVKDPRKADSGS----GSTQQLVRSHFLFTSPSNLVTISGGKWTTYREM 467

Query: 479 AEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYG 538
           AEETIDEVVK G F ++KPC+T++LKL G E W+PN+SALLSQKY+L S M+ +L++NYG
Sbjct: 468 AEETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYG 526

Query: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598
           TR+P+ICELF  D  NKLPV LAG+E   + G+ D+++FRYP TIGELKYS++YEYAR  
Sbjct: 527 TRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNC 586

Query: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           LDFLMRRTR+AFLDAK+AL AV GTVK+MGDE  W S++RQ+E ++  ++IK+FGV
Sbjct: 587 LDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/654 (64%), Positives = 509/654 (77%), Gaps = 13/654 (1%)

Query: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP 60
           MF+R   ++  + L   T+ + G   Y +Q  K        ++    +  P+     +LP
Sbjct: 1   MFAR---TLSKRVLTTATLAAGGYAAYMVQNDKI-------ARSEVRVTRPLKAEAPALP 50

Query: 61  TRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKMA 120
           TRS+LL+++ +  QFDVLII               RGL VALVE NDFASGTSSKSTKMA
Sbjct: 51  TRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTKMA 110

Query: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180
           HGGVRYLEKAF++LSK+QLDLVIEALNER H+LNTAPHLCK+LPI+IPVY YWQVPYFY 
Sbjct: 111 HGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYV 170

Query: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240
           GCK+YDLFAG+QNLK+SY++S   A E+APML+A+ LKA LVYHDGSFNDSR+NA LA+T
Sbjct: 171 GCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVT 230

Query: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300
           AIERGATVLNY+EV +L+K+ ++G I G  VRD ETG+   + +KVVVN+TGPFSD++LQ
Sbjct: 231 AIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLLQ 290

Query: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360
           MD    G P +  +       + I S+IAV NP MVVPS+GVHI+LP++YCPK++GLLD 
Sbjct: 291 MDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLDA 350

Query: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420
           +TSDGRVMFFLPWQGKV+AGTTDIPM QVPE P A EADIQDILKELQHYIKFPVKR DV
Sbjct: 351 KTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGDV 410

Query: 421 LSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMAE 480
           LSAWAGIRPL+RDPR +   E   + STQGLVR+HF++TSDNGLVTIAGGKWTTYREMAE
Sbjct: 411 LSAWAGIRPLIRDPRTIK--EGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAE 468

Query: 481 ETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGTR 540
           ETIDEVVK G F  AKPCIT+++KLAGAE WDPN  A+L+Q+Y+L S MA +L++NYGTR
Sbjct: 469 ETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTR 527

Query: 541 SPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTALD 600
           SPIICE+F  DE N+LPV   G E   +  N +F++FRYP TIGELKYSM+YEY RTALD
Sbjct: 528 SPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALD 587

Query: 601 FLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           FLMRRTRF FLDA++AL AV GTV +MGDE  WS +RRQ E+++  +FIK+FG+
Sbjct: 588 FLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/655 (64%), Positives = 505/655 (77%), Gaps = 15/655 (2%)

Query: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVS-PVDTLQVSL 59
           MF+R   ++  + LA  T+ + G   + LQR +        S H    VS P+     ++
Sbjct: 1   MFAR---TVSRRVLAGATLAAGGYAAFALQRDR--------SAHNEVHVSIPLKAEAPAI 49

Query: 60  PTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           P+RS+LL ++ +  QFDVL+I               RGL VALVE NDFASGTSSKSTKM
Sbjct: 50  PSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKM 109

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKAF++LSK+QLDLVIEALNER H+LNTAPHLCK+LPI+IPVY YWQVPYFY
Sbjct: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
            GCK+YDLFAG+QNLK+SY+++   A E+APML+A+ LKA LVYHDGSFNDSR+NA LA+
Sbjct: 170 VGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           TAIERGATVLNY+EV +LLK+ +TG + G   RD ETG    + +KVVVN+TGPFSD+IL
Sbjct: 230 TAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRIL 289

Query: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359
           QMD    GLP +  +       + I S++AV NP MVVPS+GVHI+LP++YCPKQ+GLLD
Sbjct: 290 QMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLD 349

Query: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419
            +TSDGRVMFFLPWQGKV+AGTTDIPM QVPE P A EADIQDILKELQHYIKFPVKRED
Sbjct: 350 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRED 409

Query: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479
           VLSAWAGIRPLVRDPR +   E   + STQGLVR+HF+FTSDNGLVTIAGGKWTTYREMA
Sbjct: 410 VLSAWAGIRPLVRDPRTLK--EGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMA 467

Query: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539
           EETIDEVVK G F  AKPCIT+++KLAGAE WDPN  A+L+Q+Y+L S MA +L++NYGT
Sbjct: 468 EETIDEVVKQGHF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGT 526

Query: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTAL 599
           RSPIICE+F  DE N+LPV   G E   +  N +F++FRYP TI ELKYS++YEY RTAL
Sbjct: 527 RSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTAL 586

Query: 600 DFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           DFLMRRTRF FLDAK+AL AV GTV IMGDE  W   +R  E ++   FIK+FGV
Sbjct: 587 DFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/665 (66%), Positives = 523/665 (78%), Gaps = 19/665 (2%)

Query: 1   MFSRGSKSMLSKGLAVV-TVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSL 59
           MF++G+ S L+    ++ + +++GTG+         S +N    + P   SPVDT  V L
Sbjct: 1   MFAKGTLSKLTTSKKLLYSALAVGTGLTASTLLTNNSSNN-AVYNDPSKPSPVDTTDVRL 59

Query: 60  PTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           P+R+ LL +LK+  QFDVLII               RGL VALVE+ND+ASGTSSKSTKM
Sbjct: 60  PSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVALVEKNDYASGTSSKSTKM 119

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKA FQLSK+QLDLVIEALNERAHLL TAPHLCKILPI+IPVY YWQVPYFY
Sbjct: 120 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYFY 179

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
            G K+YDLFAG+QNLK+SYLLS+S+A E+APML+++ LKA LVYHDGSFNDSR+NATLAI
Sbjct: 180 VGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLAI 239

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           +AIE+GATVLNY+EV++L+KD +T  + G  V D ETG+T  + +KV+VNATGP+SD IL
Sbjct: 240 SAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTIL 299

Query: 300 QMDKNPTGLPD---------DMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYY 350
           QMD N  GLPD         ++     +I PE IS ++AV+NPNMVVPS+GVHIILPSYY
Sbjct: 300 QMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILPSYY 359

Query: 351 CPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHY 410
           CP +MGLLD  T+DGRVMFFLPWQGKV+AGTTDIPM  VPE P A EADIQDILKELQHY
Sbjct: 360 CPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHY 419

Query: 411 IKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGG 470
           IKFPVKREDVLSAWAGIRPLV+DPR+      +  G+TQ +VRSHFIFTSDNGLVTIAGG
Sbjct: 420 IKFPVKREDVLSAWAGIRPLVQDPRV------QKGGATQEVVRSHFIFTSDNGLVTIAGG 473

Query: 471 KWTTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMA 530
           KWTTYREMAEETIDEVVK G F +AKPCITR+LKLAGAE WD N++ALLSQKYN+ + MA
Sbjct: 474 KWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMA 532

Query: 531 NYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQIL-GNTDFNTFRYPITIGELKYS 589
            +L++NYGTRSPIICE+    + NKLPV LAG E E I   +  +++FRYP TI ELKYS
Sbjct: 533 EHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYS 592

Query: 590 MRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFI 649
           M YEY RTALDFLMRRTR+AFLDAKEAL AV+GTVKIMGD  NW ++RR+ EK     +I
Sbjct: 593 MDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYI 652

Query: 650 KSFGV 654
           K+FGV
Sbjct: 653 KTFGV 657

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/655 (64%), Positives = 500/655 (76%), Gaps = 13/655 (1%)

Query: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTL-QVSL 59
           MF+RG K +  K LA+   V     V+    S++ S  +  S   P +VSP+D    V+L
Sbjct: 1   MFARGGK-LFPKALALTGTVGGALAVHQYMDSRRQS--SALSNEVP-VVSPIDPRPSVNL 56

Query: 60  PTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           P+R  LL  L++  +FDVLII               RGL VA VE NDFASGTSSKSTKM
Sbjct: 57  PSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVEANDFASGTSSKSTKM 116

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKA F+LS++QLDLVIEALNER H+L TAPHLCKILPI+IPVY+YWQVPYF+
Sbjct: 117 AHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFF 176

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
           AGCKLYD FAG QNL++SYLLS++ A ELAPML+ + LKA LVYHDGSFNDSR+N+TLAI
Sbjct: 177 AGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAI 236

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           +AIE GATVLNYV+V +LLKDS T  + G  V D ETG    V +KV VNATGP+SD IL
Sbjct: 237 SAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLIL 296

Query: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359
           QMDKN  GLPD     P  ++   I++++AV  PNMVVPS+GVHIILPSYYCPK +GLLD
Sbjct: 297 QMDKNKNGLPDPQPPQPANVS---IATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLD 353

Query: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419
           V+T+DGRVMFFLPWQGKV+AGTTDIPM  VP+ P A EADIQDIL+ELQHYIKFPV+RED
Sbjct: 354 VKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRRED 413

Query: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479
           VLSAWAGIRPLV DPR      K   GST+GLVR+H IFTS+ GL+T+AGGKWTTYREMA
Sbjct: 414 VLSAWAGIRPLVMDPR----KRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMA 469

Query: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539
           E+TIDEVVK G F   KPCITR++KLAG E W PN+SALL+Q Y L   M+ +LS+NYGT
Sbjct: 470 EQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGT 528

Query: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTAL 599
           R+PIICELF  DE N+LPV   G E   +L + +F++FRYP TIGE  YS+R+EY+R A 
Sbjct: 529 RAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKAT 588

Query: 600 DFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           DFLMRRTR+AFLDA  AL AV GTVK+MGDE NW S RRQ E E+  +FIK+FGV
Sbjct: 589 DFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/595 (67%), Positives = 487/595 (81%), Gaps = 11/595 (1%)

Query: 60  PTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           P+R++LL++L++  QFDVL+I               RGL VAL+E ND+ASGTSSKSTKM
Sbjct: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKAF++LSK+QLDLVIEALNERAH+L+TAPHLCKILPI+IPVY +WQVPYFY
Sbjct: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
            G K+YD FAG QNLK+SYLLS + A ++APML+A+ LKA LVYHDGSFNDSR+N+TLA+
Sbjct: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           TAIE GAT+LNY+EV++LLK+ ETG + G    D ETG    V +KVVV+ATGPFSD+IL
Sbjct: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300

Query: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359
           QM+ +P GLPDD++L+ K      I++K+AV +P MVVPSSGVHIILPS+YCPK MGLLD
Sbjct: 301 QMENHPKGLPDDLSLS-KANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLD 359

Query: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419
             TSDGRVMFFLPWQGKV+AGTTDIPM QVPE P A EADIQDILKELQHYIKFPVKRED
Sbjct: 360 AETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRED 419

Query: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479
           V SAWAGIRPLV+DPR  + D       TQ LVRSHF+FTSD+GLVTI+GGKWTTYREMA
Sbjct: 420 VQSAWAGIRPLVKDPRKDNSD-------TQDLVRSHFLFTSDSGLVTISGGKWTTYREMA 472

Query: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539
           +ETIDEVVK G FV+AKPCITR++KL G+E WDPN+ A+LSQ+YNLP +++ YLS+NYGT
Sbjct: 473 QETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGT 532

Query: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTAL 599
           ++  ICE+F +D+ N+LPV LA E+      N D++ FRYP T+GELKY++R EYAR  L
Sbjct: 533 KAAAICEIFQSDKRNQLPVSLAAEKAA---ANVDYDAFRYPFTVGELKYNIRNEYARKPL 589

Query: 600 DFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           DFLMRRTR+AFLDAK+A+ AV GTVKIMGDE  W S +R+ E +  I+FIK+FGV
Sbjct: 590 DFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/596 (67%), Positives = 479/596 (80%), Gaps = 14/596 (2%)

Query: 60  PTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           P+RS+LL++L++  QFDVL+I               RGL VAL+E NDFASGTSSKSTKM
Sbjct: 49  PSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTKM 108

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKA ++LSK+QLDLVIEALNERAHLL TAPHLCK+LPI+IPVY +WQVPYFY
Sbjct: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
            G K+YD FAG+QNLK+SYLLS S A E+APML+A+ LKA LVYHDGSFNDSR+NAT+A+
Sbjct: 169 VGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           TAIE GATVLNY+EV++L+K+ E G + G    D ETG    V +KVVVNATGPFSD++L
Sbjct: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288

Query: 300 QMDKNPTGLPDDMNLNPKMINPED-ISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLL 358
           QMD +P GLPDD  L+   IN +  I++++AV NP MVVPSSGVHIILPSYYCPK MGLL
Sbjct: 289 QMDNHPEGLPDDKILD--AINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLL 346

Query: 359 DVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRE 418
           D  TSDGRVMFFLPWQGKV+AGTTDIPM QVP  P A EADIQDILKELQHYIKFPVKRE
Sbjct: 347 DAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKRE 406

Query: 419 DVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREM 478
           DV SAWAGIRPLV+DPR       K L  TQGLVRSH +FTS NG+VTI+GGKWTTYREM
Sbjct: 407 DVQSAWAGIRPLVKDPR-------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREM 459

Query: 479 AEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYG 538
           AEET++EVVK G FV+AKPCITR+LKL+GAE WD N+ ALLS +YN+P ++A +LS NYG
Sbjct: 460 AEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYG 519

Query: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598
           T++  +CELF +D  N LPV LA ++   I    D+N FRYP TIGELK++M +EYART 
Sbjct: 520 TKAAQVCELFEDDRANMLPVSLAADKPTSI----DYNAFRYPYTIGELKFTMTHEYARTP 575

Query: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           LDFLMRRTR+AFLDAK+AL+AV GTVK+MGD   W S +R  E +  I++IK+FGV
Sbjct: 576 LDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/602 (67%), Positives = 482/602 (80%), Gaps = 11/602 (1%)

Query: 60  PTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           P+RS+LL  L++  +FDVLII               RGL VAL+E NDFAS TSSKSTKM
Sbjct: 68  PSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTKM 127

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKA FQLSK+QLDLVIEALNER H+L TAPHLCKILPI+IPVY YW+VPYFY
Sbjct: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
           AGCK+YD FAG+QNLK++YLLS+++A ++APML+   LKAALVYHDGSFND+R+N +LA+
Sbjct: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           TAIE GATVLNY+EV+KL+KD +TG I G TVRD ET    DV++KVVVN+TGPFSD IL
Sbjct: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307

Query: 300 QMDKNPTGLPD-------DMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCP 352
           QMD+N +G PD       D +  P +    D  S+IAV NP MVVPS+GVHIILPSYYCP
Sbjct: 308 QMDRNKSGYPDIFDKANIDTSKLPSI--DHDNLSRIAVDNPKMVVPSAGVHIILPSYYCP 365

Query: 353 KQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIK 412
           K MG+LDV+T+DGRVMFFLPWQ KV+AGTTDIPM +VPE PVA EADI+DIL ELQHY K
Sbjct: 366 KDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCK 425

Query: 413 FPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKW 472
           FPVKREDVLSAWAGIRPLVRDPR +SP+ K    STQGLVRSHFIFTS+N LVTIAGGKW
Sbjct: 426 FPVKREDVLSAWAGIRPLVRDPRKLSPNSKGD-DSTQGLVRSHFIFTSENNLVTIAGGKW 484

Query: 473 TTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANY 532
           TTYR MAEETIDE +K G   + KP +T++L L+G E W PN +ALLSQKY++PS ++ Y
Sbjct: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543

Query: 533 LSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRY 592
           LS+NYGTR+PIICEL   D+ N+LPV LAG+E  +ILGN DF   RYP T+ E+KY +  
Sbjct: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDN 603

Query: 593 EYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSF 652
           EY+RTALDFL+RRTRF FLDAKEA+ AV GTV IMGDE NW SE+R  E +K+ ++IK+ 
Sbjct: 604 EYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTL 663

Query: 653 GV 654
           GV
Sbjct: 664 GV 665

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/600 (68%), Positives = 477/600 (79%), Gaps = 10/600 (1%)

Query: 61  TRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKMA 120
           +R  LL +L +  QFDVLII               RGL VALVE+ DFASGTSSKSTKM 
Sbjct: 54  SRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 113

Query: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180
           HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+ WQVPY Y 
Sbjct: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYM 173

Query: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240
           GCK YD FAG+QNLK SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLAIT
Sbjct: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233

Query: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300
           A+E GATVLNYVEVQKL+KD  +G + G   RD+ET + + + +K VVNATGP+SD ILQ
Sbjct: 234 AVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQ 293

Query: 301 MDKNPTGLPDD-MNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359
           MD+NP+GLPD  +N N K+   +   ++IAV +P MV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 294 MDRNPSGLPDSPLNDNSKI---KSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLD 350

Query: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419
           VRTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKRED
Sbjct: 351 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 410

Query: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479
           VLSAWAG+RPLVRDPR +  D KK   +TQG+VRSHF+FTSDNGL+TIAGGKWTTYR+MA
Sbjct: 411 VLSAWAGVRPLVRDPRTIPADGKKG-SATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469

Query: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539
           EET+D+VV+ G F + KPC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL  NYGT
Sbjct: 470 EETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 529

Query: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRYEY 594
           RS IICE F     NKLP+ LA +E   I  +      +F+TFRYP TIGELKYSM+YEY
Sbjct: 530 RSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 589

Query: 595 ARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
            RT LDFL+RRTRFAFLDAKEAL AV  TVK+MGDEFNWS ++RQ E EKT+ FIK+FGV
Sbjct: 590 CRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/599 (67%), Positives = 472/599 (78%), Gaps = 8/599 (1%)

Query: 61  TRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKMA 120
           +R  LL +L +  QFDVLII               RGL VALVE+ DFASGTSSKSTKM 
Sbjct: 54  SRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 113

Query: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180
           HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y  WQVPY Y 
Sbjct: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYM 173

Query: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240
           GCK YD FAG+QNLK SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLAIT
Sbjct: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233

Query: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300
           A+E GATVLNYVEVQ+L+KD  +G + G   RD+ET + + + +K VVNATGP+SD ILQ
Sbjct: 234 AVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQ 293

Query: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360
           MD+NP+G P+    +  +I  +   ++IAV +P MV+PS GVHI+LPS+YCPK MGLLDV
Sbjct: 294 MDRNPSGQPNSPLNDNSLI--KSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 351

Query: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420
           RTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKREDV
Sbjct: 352 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 411

Query: 421 LSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMAE 480
           LSAWAG+RPLVRDPR +  D KK   +TQG+VRSHF+FTSDNGL+TIAGGKWTTYR+MAE
Sbjct: 412 LSAWAGVRPLVRDPRTIPADGKKG-SATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAE 470

Query: 481 ETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGTR 540
           ET+D+VV+ G F + KPC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL  NYGTR
Sbjct: 471 ETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTR 530

Query: 541 SPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRYEYA 595
           S IICE F     NKLP+ LA +E   I  +      +F+TFRYP TIGELKYSM+YEY 
Sbjct: 531 SSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYC 590

Query: 596 RTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           RT LDFL+RRTRFAFLDAKEAL +   TVK+MGDEFNWS ++RQ E EKTI FIK+FGV
Sbjct: 591 RTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/600 (67%), Positives = 473/600 (78%), Gaps = 10/600 (1%)

Query: 61  TRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKMA 120
           +R  LL++L +  QFDVLII               RGL VALVE+ DFASGTSSKSTKM 
Sbjct: 57  SRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 116

Query: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180
           HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+  QVPY Y 
Sbjct: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176

Query: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240
           GCK YD FAG+QNLK SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLAIT
Sbjct: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236

Query: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300
           A+E GATVLNYVEVQKL+KD  +G + G   RD+ET + + + +K VVNATGP+SD ILQ
Sbjct: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296

Query: 301 MDKNPTGLPDD-MNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359
           MD+NP+G PD  +N N K    +   ++IAV +P MV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 297 MDRNPSGQPDSPLNDNSKA---KSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLD 353

Query: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419
           VRTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKRED
Sbjct: 354 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 413

Query: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479
           VLSAWAG+RPLVRDPR +  D KK   +TQG+VRSHF+FTSDN L+TIAGGKWTTYR+MA
Sbjct: 414 VLSAWAGVRPLVRDPRTIPADGKKG-SATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMA 472

Query: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539
           EETID+VV+ G F +  PC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL  NYGT
Sbjct: 473 EETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 532

Query: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRYEY 594
           RS IICE F     NKLP+ LA +E   I  +      +F+TFRYP TIGELKYSM+YEY
Sbjct: 533 RSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 592

Query: 595 ARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
            RT LDFL+RRTRFAFLDAKEAL +V  TVK+MGDEFNWS ++RQ E EKT+ FIK+FGV
Sbjct: 593 CRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/542 (69%), Positives = 441/542 (81%), Gaps = 10/542 (1%)

Query: 119 MAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYF 178
           M HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y  WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 179 YAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLA 238
           YAGCK YD FAG QNLK+SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 239 ITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKI 298
           ITA+E GATVLNYVEVQKL+KD  +G + G   RD+ET + + + +K VVNATGP+SD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 299 LQMDKNPTGLPDD-MNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGL 357
           LQMD+N +G P+  +N N K+   +   +++AV +P MV+PS GVHI+LPS+YCPK +GL
Sbjct: 181 LQMDRNASGQPNSPLNDNSKI---KSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGL 237

Query: 358 LDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKR 417
           LDVRTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKR
Sbjct: 238 LDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKR 297

Query: 418 EDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYRE 477
           EDVLSAWAG+RPLVRDPR +    KK   +TQG+VRSHF+FTSDNGL+TIAGGKWTTYR+
Sbjct: 298 EDVLSAWAGVRPLVRDPRSIPAGGKKG-SATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356

Query: 478 MAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNY 537
           MAEETID+VV+ G F + KPC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL +NY
Sbjct: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416

Query: 538 GTRSPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRY 592
           GTRS IICE F +   NKLP+ LA +E   I  N      +F+TFRYP TIGELKYSM+Y
Sbjct: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476

Query: 593 EYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSF 652
           EY RT LDFL+RRTRFAFLDAKEAL +V  TVK+MGDEFNWS ++RQ E EKT+ FIK+F
Sbjct: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536

Query: 653 GV 654
           GV
Sbjct: 537 GV 538

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/596 (64%), Positives = 455/596 (76%), Gaps = 10/596 (1%)

Query: 60  PTRSKLLQQLKEKGQFDVLIIXXXXXXXXXXXXXXXRGLQVALVEQNDFASGTSSKSTKM 119
           P R+K+LQ+L++  +FDVL++               RGL+VALVE+ DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179
           AHGGVRYLEKA F+LSK QLDLV+EALNERAHLL  APHL KILPI+IPVY YW+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239
           AGCK+YD FAG QNLK+SYLLSR N   +APML+   LK  LVYHDG FNDSRL ATLAI
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299
           +A+ERGATV NYV V++L+KD  TG I G  V D ETG T  V +K+VVNATGP+SDKIL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359
           QMD NP GLP+     P+   PE+  + IAV+NP MVVPS GVHI LPS+YCP +MGLLD
Sbjct: 298 QMDANPQGLPEK---EPEKATPEN--ALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352

Query: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419
             TSDGRVMFFLPWQGKVIAGTTDIP+ QVP  P   EADIQDIL+ELQHYI+FPV+RED
Sbjct: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412

Query: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479
           VLSAWAGIRPLVRDPR+         G T+GLVRSHFIFTS   LVTIAGGKWTTYREMA
Sbjct: 413 VLSAWAGIRPLVRDPRVAEGSAGS--GQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMA 470

Query: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYN-LPSMMANYLSDNYG 538
           EET+DEV+K G F   KPC TR+ KL GA+ W+ N  A L Q+Y  L   +A +L++NYG
Sbjct: 471 EETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYG 530

Query: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598
            R+PIICE+F  D+ +KLPV L G+  +++  N D N F YP TI ELKY +R+EY RTA
Sbjct: 531 DRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTA 589

Query: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654
           LDFL+RR+RFAFLDA+EAL AV  TV ++GDE  W +E+R  E  KT  +IK+FGV
Sbjct: 590 LDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Kpol_1050.50 s1050 complement(114871..115686) [816 bp, 271 aa] {ON}
           complement(114871..115686) [816 nt, 272 aa]
          Length = 271

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 76/163 (46%), Gaps = 18/163 (11%)

Query: 208 LAP-MLEATNLKAALVYHDGSFNDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTI 266
           +AP ++E   L   ++ H      SR  + L    I +   ++ Y        D  TG  
Sbjct: 24  IAPSVVETIKLDPPIIKHSPEQAQSRRWSPLRCGVIAQKKGMMPYF-------DENTGER 76

Query: 267 NGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQMDKNPTGLPDDM--NLNPKMINPEDI 324
              TV  +   + ++VL    +   G ++ ++   DK+P+ +   M  +   K++NP++ 
Sbjct: 77  TAATVLQL---NNVEVLMHRTLKDNGYYACQVGFGDKDPSHVSRQMLGHFASKIVNPKET 133

Query: 325 SSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDVR-TSDGR 366
            ++  VKN + ++P     ++ PS++ P Q   +D++ TS G+
Sbjct: 134 VAEFRVKNESGLLPLG--TLLKPSFFKPGQ--FVDLKSTSKGK 172

>Kwal_27.9867 s27 (92674..93480) [807 bp, 268 aa] {ON} YGR220C
           (MRPL9) - Mitochondrial ribosomal protein MRPL9 (YmL9)
           (E. coli L3) (human MRL3) [contig 43] FULL
          Length = 268

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 84/174 (48%), Gaps = 21/174 (12%)

Query: 194 LKNSYLLSRSNAIELAPMLEAT-NLKAALVYH--DGSFNDSRLNATLAITAIERGATVLN 250
           LK     S S A  +AP + +T  L+A ++ H  + + +  RL       +I+RG  ++ 
Sbjct: 9   LKVPVRFSSSRASLVAPSVVSTIPLRAPVINHCPEQAQSRKRLPQRCGALSIKRG--MIP 66

Query: 251 YVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQMDKNPTGLPD 310
           Y        D  TG     TV ++   + ++V+    ++  G F+ ++   +K+P  +  
Sbjct: 67  YF-------DDATGKRVAATVLEL---NNVEVIMHRTLSENGYFACQVGYGNKHPEKVSR 116

Query: 311 DM--NLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDVRT 362
            +  +   K++NP++  ++  VKN   ++P     +I PS++ P Q   +D+R+
Sbjct: 117 QLLGHFASKIVNPKEKVTEFRVKNKTGLLPLG--TLIKPSFFQPGQ--YVDLRS 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,856,421
Number of extensions: 2940153
Number of successful extensions: 8113
Number of sequences better than 10.0: 24
Number of HSP's gapped: 8296
Number of HSP's successfully gapped: 24
Length of query: 654
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 538
Effective length of database: 40,180,143
Effective search space: 21616916934
Effective search space used: 21616916934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)