Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F036003.501ON2372379731e-134
NDAI0B059203.501ON2352435852e-75
Smik_16.4063.501ON2122385232e-66
Skud_16.4483.501ON2082415222e-66
KNAG0A079903.501ON2212565233e-66
TDEL0D056903.501ON2012395135e-65
YPR154W (PIN3)3.501ON2152375023e-63
Kwal_47.189053.501ON2362485035e-63
Suva_16.4823.501ON2352414964e-62
TBLA0C045303.501ON2222384885e-61
KAFR0G037403.501ON2342574462e-54
SAKL0F02486g3.501ON2301264313e-52
KLTH0G02332g3.501ON2331254192e-50
Smik_6.2323.501ON2412514183e-50
CAGL0F04829g3.501ON2022414135e-50
YGR136W (LSB1)3.501ON2412524132e-49
TPHA0A057203.501ON2201254093e-49
ZYRO0D09702g3.501ON1581764027e-49
Kpol_480.83.501ON2391254011e-47
Suva_7.4243.501ON2491453636e-42
AFR320W3.501ON2571403561e-40
Skud_7.4473.501ON2381453313e-37
KLLA0E03873g3.501ON2201143086e-34
KNAG0B007503.501ON2171242791e-29
Ecym_12283.501ON2531492704e-28
ZYRO0G20372gsingletonON150722261e-22
TBLA0D029103.501ON2691202192e-20
TBLA0D049501.356ON468701518e-11
Smik_8.811.356ON468511402e-09
KLTH0H12980g1.356ON399821393e-09
Suva_15.1991.356ON457511393e-09
NCAS0A089901.356ON434561384e-09
Skud_8.681.356ON475511385e-09
Ecym_27471.356ON452931376e-09
YHR016C (YSC84)1.356ON468511367e-09
KLLA0A08360g1.356ON423681351e-08
KNAG0C046305.470ON516801351e-08
NCAS0A119205.470ON463581341e-08
TPHA0O012801.356ON454511332e-08
KLTH0D06138g2.502ON489701332e-08
AEL017W1.356ON416501332e-08
NDAI0A043505.470ON459571332e-08
SAKL0D09702g1.356ON428611332e-08
Kwal_0.3711.356ON217511302e-08
TBLA0A025705.470ON493551314e-08
KAFR0E036405.470ON441571314e-08
SAKL0G03454g5.470ON468571314e-08
NDAI0G059601.356ON423551296e-08
TPHA0C040202.502ON485631296e-08
TBLA0F034901.356ON511771297e-08
TBLA0B054702.502ON539711288e-08
KNAG0C020401.356ON464511289e-08
KAFR0C044001.356ON459671289e-08
CAGL0I08965g1.356ON437511271e-07
Skud_4.6615.470ON460551271e-07
Smik_7.3351.356ON460511261e-07
CAGL0M01650g5.470ON466561262e-07
NCAS0B072501.356ON441511262e-07
YDR388W (RVS167)5.470ON482561262e-07
YFR024C-A (LSB3)1.356ON459511252e-07
TDEL0D022401.356ON433511252e-07
Smik_4.6585.470ON472561242e-07
TDEL0A033405.470ON473531243e-07
ABR008C2.502ON443601233e-07
KLLA0B13475g2.502ON508531234e-07
NDAI0K021302.502ON459531224e-07
CAGL0K02761g2.502ON450561224e-07
TPHA0A022101.356ON397511225e-07
AFR140C5.470ON388761217e-07
TPHA0E015005.470ON457581208e-07
Kwal_55.212875.470ON461561209e-07
Skud_6.1081.356ON459511209e-07
Suva_6.961.356ON455511201e-06
Kpol_1008.251.356ON449511201e-06
Kpol_440.105.470ON470551201e-06
KLTH0F15114g5.470ON435551201e-06
KAFR0D033602.502ON455581191e-06
KAFR0A009701.356ON396511191e-06
NDAI0B045801.356ON424511191e-06
Smik_8.472.502ON447631182e-06
SAKL0E02200g2.502ON511911182e-06
Suva_8.512.502ON456521172e-06
Kpol_1056.372.502ON501631172e-06
ZYRO0G00792g1.356ON469721163e-06
ZYRO0B01298g2.502ON411531154e-06
Ecym_24402.502ON459531154e-06
ZYRO0D11110g5.470ON459551145e-06
YHL002W (HSE1)2.502ON452521145e-06
NCAS0A050802.502ON450521146e-06
YHR114W (BZZ1)2.159ON633521146e-06
TDEL0A027802.502ON451521128e-06
CAGL0A02145g1.356ON391521111e-05
Ecym_23165.470ON421541111e-05
TPHA0F031007.365ON381901092e-05
Skud_8.432.502ON454521092e-05
Skud_8.1752.159ON633521075e-05
KNAG0I015801.356ON581511075e-05
KLTH0E09790g2.159ON622621075e-05
Kwal_26.79022.502ON532531057e-05
KNAG0A067102.502ON419521058e-05
Kwal_47.178942.159ON621521041e-04
Smik_8.1922.159ON633521041e-04
KLLA0E03059g5.470ON428601031e-04
Suva_10.2877.365ON392711012e-04
Kpol_1072.562.159ON637521012e-04
ACR266W2.159ON626511003e-04
SAKL0F11748g7.365ON40878993e-04
ZYRO0G10098g4.108ON1392611004e-04
Skud_12.2567.365ON40380985e-04
Smik_12.2517.365ON38860976e-04
KLLA0F23848g2.159ON64949986e-04
TPHA0B028902.159ON63452987e-04
Suva_15.3102.159ON63452978e-04
Kpol_538.255.170ON70764970.001
Ecym_47107.365ON39960960.001
AGR306C5.170ON92358960.001
Ecym_25266.366ON52451940.002
TBLA0C055602.159ON67351940.002
TDEL0B052202.159ON61352940.002
Suva_2.564singletonON4339830.002
Ecym_23082.591ON67856930.003
NCAS0A145707.419ON35564910.004
ABR082W2.591ON68356920.004
Kwal_23.64376.366ON63161920.004
KLLA0C12551g2.591ON60757920.004
Kpol_325.126.366ON57076910.005
SAKL0G17600g4.335ON44159910.005
NDAI0I002206.366ON61561910.005
NDAI0J008508.344ON24580890.005
Ecym_54262.159ON67251890.007
SAKL0A00594g6.366ON63653880.011
CAGL0E01045g8.344ON21372860.012
KAFR0J026506.366ON55350870.015
ADL288C2.319ON92565870.015
SAKL0H15048g8.344ON20781850.017
TDEL0C018207.365ON38974860.019
SAKL0E10780g2.159ON62553860.019
Ecym_71347.419ON33265850.020
KAFR0L018807.413ON93060860.021
Suva_3.1246.366ON60061860.022
KLLA0E06953g7.419ON35752850.023
NCAS0B060202.319ON86455860.024
TBLA0B096202.319ON94154850.027
KAFR0L015807.365ON34479840.027
KLLA0F14575g5.170ON85189850.030
NDAI0A014707.419ON36753830.037
SAKL0H10098g8.539ON55582830.040
Smik_5.2637.419ON36852830.040
SAKL0E06820g2.319ON90552840.042
AGL286C7.419ON33065830.042
Kpol_534.62.319ON88653830.047
NCAS0B069802.159ON63949830.050
TBLA0C041004.108ON130260830.053
Suva_2.1184.108ON116652830.055
KLTH0A07348g6.366ON62651820.063
KAFR0K020007.419ON33252810.064
Ecym_33662.319ON90653820.065
ZYRO0A02662g2.319ON88653820.067
TBLA0F002806.366ON576103810.072
TDEL0E055204.45ON158962820.079
Smik_2.1134.108ON123052810.080
CAGL0C03597g6.366ON58053810.082
TDEL0A078106.366ON55850810.086
Suva_5.2397.419ON36852800.087
YER114C (BOI2)7.413ON104090810.088
YBL007C (SLA1)4.108ON124452810.089
KNAG0C033907.419ON34252800.093
Smik_2.357.413ON98567810.094
TBLA0A076107.365ON41360800.096
KAFR0I010404.108ON120360810.098
CAGL0E02783g4.108ON120368810.10
ZYRO0B16214g2.159ON65948800.10
Suva_2.337.413ON98254800.11
AGL237C6.366ON57851800.11
AGL293C7.413ON98454800.12
Skud_2.1044.108ON121452800.12
TDEL0G024902.319ON85053800.13
KNAG0I027006.366ON57550790.13
NDAI0A033304.108ON122660800.13
ZYRO0D17358g6.366ON66871790.14
NDAI0B033302.319ON91953790.18
Smik_4.1192.319ON88753780.19
TPHA0K016004.108ON113660780.19
KLTH0C06028g7.419ON34265770.19
Suva_4.1292.319ON88753780.20
Ecym_11678.539ON55056780.21
Kwal_27.107077.419ON34365770.21
KLLA0D16874g8.344ON22751760.21
TDEL0F023804.108ON125571780.22
Skud_3.1606.366ON58655770.23
Skud_4.1372.319ON88753770.24
Smik_3.1866.366ON59155770.24
AGR170C4.108ON112163770.27
SAKL0H24222g4.45ON152658770.27
Ecym_42288.344ON26152760.28
TDEL0C027307.413ON101649770.30
NCAS0B033608.344ON233104750.30
KLLA0E09043g2.319ON81452770.30
NDAI0A015007.413ON104749770.31
KNAG0C029104.108ON124458770.31
TBLA0E015604.45ON139478760.35
Ecym_71417.413ON102954760.36
NCAS0D047406.366ON59450760.36
Suva_2.3268.344ON24055750.37
KLLA0E23365g8.539ON57553760.38
NCAS0A145307.413ON102398750.44
TPHA0K006807.419ON35552740.45
CAGL0C01881g7.413ON99955750.47
Kpol_1025.404.108ON120260750.49
ZYRO0B03850g7.413ON108949750.51
CAGL0E03476g4.45ON156449750.54
YDR162C (NBP2)8.344ON23670730.55
TDEL0C028107.419ON33738740.55
TPHA0G009302.319ON82454740.56
YCR088W (ABP1)6.366ON59255740.56
YDL117W (CYK3)2.319ON88553740.57
ADL038W4.45ON1509117740.59
TPHA0F003804.45ON161855740.60
NCAS0A034904.108ON123560740.62
KLTH0C06182g7.413ON102573740.62
TDEL0F046808.344ON26455730.65
Skud_4.4208.344ON23350720.66
TBLA0I010507.419ON37152730.71
KLLA0D09306g4.45ON153787740.74
Suva_5.2357.413ON104349730.76
ZYRO0F13882g8.344ON28858720.79
Skud_2.237.413ON98254730.84
Skud_12.514.45ON125461730.85
Skud_5.2657.413ON104390730.89
KNAG0B022307.413ON90455730.94
Kpol_1045.277.413ON88054730.97
NCAS0D019505.170ON93951720.99
ZYRO0B04004g7.419ON37152721.0
KLLA0A04983g4.108ON125161721.0
KAFR0F007502.159ON60252721.1
YBL085W (BOI1)7.413ON98054721.2
YER118C (SHO1)7.419ON36752711.2
SAKL0F12958g7.413ON102754721.3
Kwal_27.107337.413ON101453721.3
Suva_13.2012.591ON66867711.3
KLTH0E07744g4.108ON124960711.3
Ecym_72314.108ON114660711.4
TBLA0I010807.413ON155549711.5
NCAS0A059704.45ON132359711.6
Smik_4.4068.344ON23550691.6
KNAG0A050208.344ON27050691.8
Kpol_2000.28.344ON22550692.0
KLLA0F10175g6.366ON57650702.1
CAGL0G03597g7.419ON35352692.2
Smik_5.2597.413ON104149692.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03600
         (237 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   379   e-134
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   229   2e-75
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   206   2e-66
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   205   2e-66
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   206   3e-66
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   202   5e-65
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   197   3e-63
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   198   5e-63
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   195   4e-62
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   192   5e-61
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   176   2e-54
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   170   3e-52
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   166   2e-50
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   165   3e-50
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   163   5e-50
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   163   2e-49
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   162   3e-49
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   159   7e-49
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   159   1e-47
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   144   6e-42
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   141   1e-40
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   132   3e-37
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   123   6e-34
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   112   1e-29
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   108   4e-28
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    92   1e-22
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    89   2e-20
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    63   8e-11
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    59   2e-09
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    58   3e-09
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    58   3e-09
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    58   4e-09
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    58   5e-09
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    57   6e-09
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    57   7e-09
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    57   1e-08
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    57   1e-08
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    56   1e-08
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    56   2e-08
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    56   2e-08
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    56   2e-08
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    56   2e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    56   2e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    55   2e-08
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    55   4e-08
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    55   4e-08
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    55   4e-08
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    54   6e-08
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    54   6e-08
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    54   7e-08
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    54   8e-08
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    54   9e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    54   9e-08
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    54   1e-07
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    54   1e-07
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    53   1e-07
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    53   2e-07
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    53   2e-07
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    53   2e-07
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    53   2e-07
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    53   2e-07
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    52   2e-07
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    52   3e-07
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    52   3e-07
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    52   4e-07
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    52   4e-07
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    52   4e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    52   5e-07
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    51   7e-07
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    51   8e-07
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    51   9e-07
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    51   9e-07
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    51   1e-06
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    51   1e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    51   1e-06
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    51   1e-06
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    50   1e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    50   1e-06
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    50   1e-06
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    50   2e-06
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    50   2e-06
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    50   2e-06
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    50   2e-06
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    49   3e-06
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    49   4e-06
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    49   4e-06
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    49   5e-06
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    49   5e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    49   6e-06
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    49   6e-06
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    48   8e-06
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    47   1e-05
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    47   1e-05
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    47   2e-05
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    47   2e-05
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    46   5e-05
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    46   5e-05
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    46   5e-05
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    45   7e-05
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    45   8e-05
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    45   1e-04
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    45   1e-04
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    44   1e-04
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    44   2e-04
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    44   2e-04
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    43   3e-04
SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {...    43   3e-04
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    43   4e-04
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    42   5e-04
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    42   6e-04
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    42   6e-04
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    42   7e-04
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    42   8e-04
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    42   0.001
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    42   0.001
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    42   0.001
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    41   0.002
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    41   0.002
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    41   0.002
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    37   0.002
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    40   0.003
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    40   0.004
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    40   0.004
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    40   0.004
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    40   0.004
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    40   0.005
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    40   0.005
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    40   0.005
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    39   0.005
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    39   0.007
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    39   0.011
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    38   0.012
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    38   0.015
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    38   0.015
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    37   0.017
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    38   0.019
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    38   0.019
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    37   0.020
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    38   0.021
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    38   0.022
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    37   0.023
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    38   0.024
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    37   0.027
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    37   0.027
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    37   0.030
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    37   0.037
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    37   0.040
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    37   0.040
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    37   0.042
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    37   0.042
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    37   0.047
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    37   0.050
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    37   0.053
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    37   0.055
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    36   0.063
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    36   0.064
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    36   0.065
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    36   0.067
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    36   0.072
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    36   0.079
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    36   0.080
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    36   0.082
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    36   0.086
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    35   0.087
YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON} ...    36   0.088
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    36   0.089
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    35   0.093
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    36   0.094
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    35   0.096
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    36   0.098
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    36   0.10 
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    35   0.10 
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    35   0.11 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    35   0.11 
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    35   0.12 
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    35   0.12 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    35   0.13 
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    35   0.13 
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    35   0.13 
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    35   0.14 
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    35   0.18 
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    35   0.19 
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    35   0.19 
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    34   0.19 
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    35   0.20 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    35   0.21 
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    34   0.21 
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    34   0.21 
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    35   0.22 
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    34   0.23 
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    34   0.24 
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    34   0.24 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    34   0.27 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    34   0.27 
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    34   0.28 
TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {...    34   0.30 
NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.34...    33   0.30 
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    34   0.30 
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    34   0.31 
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    34   0.31 
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    34   0.35 
Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar ...    34   0.36 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    34   0.36 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    33   0.37 
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    34   0.38 
NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]...    33   0.44 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    33   0.45 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    33   0.47 
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    33   0.49 
ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa] ...    33   0.51 
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    33   0.54 
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    33   0.55 
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    33   0.55 
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    33   0.56 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    33   0.56 
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    33   0.57 
ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic h...    33   0.59 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    33   0.60 
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    33   0.62 
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    33   0.62 
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    33   0.65 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    32   0.66 
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    33   0.71 
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    33   0.74 
Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {O...    33   0.76 
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    32   0.79 
Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)    33   0.84 
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    33   0.85 
Skud_5.265 Chr5 (427799..430930) [3132 bp, 1043 aa] {ON} YER114C...    33   0.89 
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    33   0.94 
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    33   0.97 
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     32   0.99 
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    32   1.0  
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    32   1.0  
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    32   1.1  
YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein ...    32   1.2  
YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}  ...    32   1.2  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    32   1.3  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    32   1.3  
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    32   1.3  
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    32   1.3  
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    32   1.4  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    32   1.5  
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    32   1.6  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    31   1.6  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    31   1.8  
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    31   2.0  
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    32   2.1  
CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {...    31   2.2  
Smik_5.259 Chr5 complement(399447..402572) [3126 bp, 1041 aa] {O...    31   2.5  
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    31   2.5  
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    31   2.7  
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    31   2.8  
Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C ...    31   2.9  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    31   3.4  
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    31   3.8  
Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON} (1021...    30   4.4  
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    30   5.0  
Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]...    30   7.0  

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  379 bits (973), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 193/237 (81%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 121 FSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPSXXXXXXXXXXLTNYYXXXXXXXXXXXX 180
           FSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPS          LTNYY            
Sbjct: 121 FSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPSFQQPAPFPPALTNYYQQQQPQFIQTPQ 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
                                 HHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 181 QQQPQQVQQQPVQQQQPQQQEQHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  229 bits (585), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 154/243 (63%), Gaps = 14/243 (5%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSL  IRTELDFLKESNVIS+ETF+QI + LP +YDP+ SR  S+ S      
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRE-SVSS------ 53

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           Q    E+VEAIYPFEPQQ+GDLALK GDKI+VIEKPSPEWFKG+CNGQ G+FPSNYV+PA
Sbjct: 54  QAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPA 113

Query: 121 FSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPSXXXXXXXXXXL-TNYYXXXXXXXXXXX 179
           FSG+S        P GPPQYQ S++TQ+ H+ S            TNYY           
Sbjct: 114 FSGTSQPSKTRLTP-GPPQYQASVETQSIHSSSNVSYQPPFPPASTNYYQQPAQQPQAQY 172

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXHHSHH-----GLKKFGSKLGNAAIFGAGATIGSDIVN 234
                                     HH      LKKFGSKLGNAAIFGAGATIGSDIVN
Sbjct: 173 IPPPQPVQQVQQQVQQQPQQQQPQQQHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVN 232

Query: 235 SIF 237
           SIF
Sbjct: 233 SIF 235

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  206 bits (523), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/238 (51%), Positives = 143/238 (60%), Gaps = 27/238 (11%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDP-DASRAPSIHSSNNNQ 59
           MSAS INRSL  IRTELDFLKESNVIS + FDQI  +LP+++DP  ASR  S  S     
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSL---- 56

Query: 60  PQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
                 E+VEA+Y F+PQQ GDL LKPGDKI+++EK SPEW+KG CNG+TG+FP+NYVKP
Sbjct: 57  ------EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110

Query: 120 AFSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPSXXXXXXXXXXLTNYYXXXXXXXXXXX 179
           AFSGS+G  N    P    Q    + TQNS   S           TNYY           
Sbjct: 111 AFSGSNGQSNLPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPS-TNYY----------- 158

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
                                   +SH+ LK FGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 159 ----QQPQQAPAPAPQQQQQQQQPNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  205 bits (522), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 147/241 (60%), Gaps = 37/241 (15%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSL TIRTELDFLKESNVIS + FDQI  +LPV+++P ++   +  +S     
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASL---- 56

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEA+Y F+PQQ GDL LKPGDK++++EK SPEW+KG CNG+ G+FP+NYVKPA
Sbjct: 57  -----EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPA 111

Query: 121 FSGSSGSVNKVARPNGPPQYQ-NSLQ---TQNSHTPSXXXXXXXXXXLTNYYXXXXXXXX 176
           FSGS+GS N       PPQY+   LQ   TQNS   S           TNYY        
Sbjct: 112 FSGSNGSSNLPP----PPQYKAQELQQAPTQNSAVSSYQQQPFPPPS-TNYY-------- 158

Query: 177 XXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSI 236
                                       SH+ LK FGSKLGNAAIFGAGA+IGSDIVNSI
Sbjct: 159 -----------QQPQQQPQQAPPQQQPSSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSI 207

Query: 237 F 237
           F
Sbjct: 208 F 208

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  206 bits (523), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 147/256 (57%), Gaps = 54/256 (21%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSL  +RTELDFL+ES VIS+ETF++I  +LP KYDP+          N+N+ 
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPN--------QHNDNRS 52

Query: 61  QDQGN-----EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSN 115
           +D        E+VEA+Y F+PQQ GDL L+PGDKI+V+EKPS EW+KG+C GQ GMFPSN
Sbjct: 53  RDSSESHAKLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSN 112

Query: 116 YVKPAFSGSSGSVNKVARPNGPP--------------QYQNSLQTQNSHTPSXXXXXXXX 161
           YVKPAFSG S +     RP GPP              Q QN+  +Q+S+ P         
Sbjct: 113 YVKPAFSGESSAPK---RPAGPPYQPQQQHLAAPMYQQPQNTGYSQSSNPPFPPQS---- 165

Query: 162 XXLTNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAI 221
               NYY                                   H H+  KKFGS+LGNAAI
Sbjct: 166 ---ANYYPPQQQQQPQQVVVEQQQP-----------------HKHNAFKKFGSQLGNAAI 205

Query: 222 FGAGATIGSDIVNSIF 237
           FGAGATIGSDIVNSIF
Sbjct: 206 FGAGATIGSDIVNSIF 221

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  202 bits (513), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 138/239 (57%), Gaps = 40/239 (16%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSLAT+RTELDFL+ESNVISQE +D +  +LP                     
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP------------------QNA 42

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
            ++G E++EA+Y F+PQQ GDLAL PGDKIEV+EKPS EWFKGRCNG+ GMFP+NYVK A
Sbjct: 43  SNKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAA 102

Query: 121 FSGSSGSVNKVARPN--GPPQYQNSLQTQNSHTPSXXXXXXXXXXLTNYYXXXXXXXXXX 178
           +SGS        RP+   PPQY+ + +T    +             +  Y          
Sbjct: 103 YSGSD-------RPSVPPPPQYEQAQRTNTGQS-------------SGSYQQPFPPPSTN 142

Query: 179 XXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
                                   HHSH+ LKKFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 143 YYQQPPQQYQQPQQQQPQQEQQQQHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  197 bits (502), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 139/237 (58%), Gaps = 22/237 (9%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSL  IRTELDFLK SNVIS + +DQI  +LP K+DP  + AP      N  P
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDP--ANAP-----RNASP 53

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEA+Y F+PQQ GDL LKPGDK++++EK SPEW+KG CNG+TG+FP+NYVKPA
Sbjct: 54  ASL--EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPA 111

Query: 121 FSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPSXXXXXXXXXXLTNYYXXXXXXXXXXXX 180
           FSGS+G  N    P    Q    + TQNS   S           TNYY            
Sbjct: 112 FSGSNGPSNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPS-TNYY------------ 158

Query: 181 XXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
                                   SH  LK FGSKLGNAAIFGAGA+IGSDIVN+IF
Sbjct: 159 QQPQQQPQQAPPPQQQQQQQQHQSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  198 bits (503), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 139/248 (56%), Gaps = 23/248 (9%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSASSINRSL+T+RTEL+FL+ESNVI++ ++  I   LP +Y+P  S  P++ SS +   
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRS-TPTVPSSQS--- 56

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                EFVEAIY F+ QQ GDL L+ GDKIEV+EKPSPEW+KGRCNG+ GMFPSNYVKPA
Sbjct: 57  -----EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA 111

Query: 121 FSGSSGSVNKVARPNGP-----------PQYQNSLQTQNSHTPSXXXXXXXXXXLTNYYX 169
           FSGS+ S+    RPN P           PQ  N+    N   P                 
Sbjct: 112 FSGSNASLE---RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSTAYYQGPPQQY 168

Query: 170 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIG 229
                                             H+    KKFG KLGNAAIFGAGATIG
Sbjct: 169 QPQQQYQQQYYQGQQATPQPAPAAPAAQQGTGSSHTGAAFKKFGGKLGNAAIFGAGATIG 228

Query: 230 SDIVNSIF 237
           SDIVNSIF
Sbjct: 229 SDIVNSIF 236

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  195 bits (496), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 142/241 (58%), Gaps = 28/241 (11%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS +NRSL  IRTELDFLKESNVIS + FDQI  +LPVK+DP  S AP   +S     
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDP--SSAPRGSNS----- 71

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEA+Y F+PQQ GDL LK GDK++++EK SPEW+KG CNG+TG+FP+NYVKP 
Sbjct: 72  --ASLEYVEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPV 129

Query: 121 FSGSSGSVNKVARPNGPPQYQ----NSLQTQNSHTPSXXXXXXXXXXLTNYYXXXXXXXX 176
           FS S G      R   PPQY+      + TQNS+  S           TNYY        
Sbjct: 130 FSDSDGQ----HRLPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPS-TNYYQQPLQQPQ 184

Query: 177 XXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSI 236
                                       S++ LK FGSKLGNAAIFGAGA+IGSDIVNSI
Sbjct: 185 LQPQQPPPPQQQQQQQSS----------SNNHLKSFGSKLGNAAIFGAGASIGSDIVNSI 234

Query: 237 F 237
           F
Sbjct: 235 F 235

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  192 bits (488), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 138/238 (57%), Gaps = 17/238 (7%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MS+S IN+SL+TI TELDFL +SN I ++T+ +I   LP +    A   PS   SN+++ 
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR----APEVPSRQQSNSSK- 55

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEAIY F+PQQ GDL L PGDKI V EKPSPEWFKG+CNG+ G+FPSNYV+PA
Sbjct: 56  ---NEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPA 112

Query: 121 FSGSSGSVNKVARPN-GPPQYQNSLQTQNSHTPSXXXXXXXXXXLTNYYXXXXXXXXXXX 179
           FSGS+   N+ +R +  PPQYQ     Q+ H  S              Y           
Sbjct: 113 FSGSN---NEKSRSDAAPPQYQ-----QDDHHISKHSSHQSSMMPPQPYPQQQQVYQAPP 164

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
                                  HH H  LK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 165 PQQQQAYQAPPQQVVVEQAPAKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  176 bits (446), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 137/257 (53%), Gaps = 43/257 (16%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPS--------- 51
           MS++ INR++  I+TELDFL+ES +I+Q+  D+I   LP KYDP + +A S         
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 52  -----------IHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEW 100
                       H+S    P +Q  E+VEA+Y FEPQQ+GDL L  GDK++++EKPS EW
Sbjct: 61  NAAANSSSASVDHASATPPPANQL-EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEW 119

Query: 101 FKGRCNGQTGMFPSNYVKPAFSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPSXXXXXXX 160
           +KG CNGQ GMFP+NYVKP        V K +    PPQYQ   Q  N++          
Sbjct: 120 YKGTCNGQIGMFPANYVKP--------VTKDSFAPPPPQYQ---QYSNNYQQPSYSQPAY 168

Query: 161 XXXLTNYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAA 220
               T YY                                    ++  LK+FGSKLGNAA
Sbjct: 169 PPASTGYYQQPQQVQVQQPQQVQVQQQPQQQS-----------QTNEQLKRFGSKLGNAA 217

Query: 221 IFGAGATIGSDIVNSIF 237
           IFGAGAT+GSD+VNSIF
Sbjct: 218 IFGAGATLGSDLVNSIF 234

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  170 bits (431), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 98/126 (77%), Gaps = 9/126 (7%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSL TIRTELDFL+ES VIS+ETF QI+++LP +YDP+A         N N+ 
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNA---------NGNRS 51

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEAIY F+ QQ GDL LKPGDKI+V+EKPS EW+KG+CNG  GMFPSNYVKPA
Sbjct: 52  SSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA 111

Query: 121 FSGSSG 126
           FSGS+G
Sbjct: 112 FSGSNG 117

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/35 (82%), Positives = 30/35 (85%)

Query: 203 HHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
           H+     KKFGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  166 bits (419), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (77%), Gaps = 9/125 (7%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSASSINRSL+T+RTEL+FL+ES+VI++ ++  I S LP +YDP  SR P        QP
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDP--SRGP-------QQP 51

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                EFVEAIY F+ QQ GDL L+ GDK+EV+EKPSPEWFKG+CNG+ GMFPSNYVKPA
Sbjct: 52  SATQGEFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPA 111

Query: 121 FSGSS 125
           FSGS+
Sbjct: 112 FSGST 116

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%)

Query: 204 HSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
            +    KKFG KLGNAA+FGAGATIGSDIVNSIF
Sbjct: 200 QASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  165 bits (418), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 138/251 (54%), Gaps = 24/251 (9%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSA+ +NRSL  IR EL+FL+ESNVIS + FD I S LP K++ D +R+P     NN   
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWN-DNTRSP-----NNADT 54

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           +    E+VEA+Y FE QQ GDL+LK GDKI+V+EK SP+W+KG+ N + G+FP+NYVKPA
Sbjct: 55  E----EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPA 110

Query: 121 FSGS------SGSV-NKVARPNG-PPQYQNSL------QTQNSHTPSXXXXXXXXXXLTN 166
           F+ S       G + +KV+RP+  PP Y+ ++      QT  S+ P              
Sbjct: 111 FTRSVLTKPEEGDLSSKVSRPSVPPPSYEPAVSQYPPQQTPASYAPPLGYMQAPPPQQQQ 170

Query: 167 YYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGA 226
                                                 +    K FGSKLGNAAIFGAG+
Sbjct: 171 APLPFPPSFTNYYQQPQQQYVPPPQQAQVEAQPQQSSAASSAFKSFGSKLGNAAIFGAGS 230

Query: 227 TIGSDIVNSIF 237
            IGSDIVNSIF
Sbjct: 231 AIGSDIVNSIF 241

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  163 bits (413), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 125/241 (51%), Gaps = 43/241 (17%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MS S+INRSL  IR ELDFL+ESNVIS+  F +I   LP      AS  P   S      
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN---GASPVPPPMSL----- 52

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEA+Y F+PQQ GDLA++ GDKI+V+EKPS EW++G  NG+ GMFPSNYV+PA
Sbjct: 53  -----EYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPA 107

Query: 121 FSGSSGSVNKVARPNGPPQYQN----SLQTQNSHTPSXXXXXXXXXXLTNYYXXXXXXXX 176
            + S+           PP Y N       T  S  P              YY        
Sbjct: 108 AAPSANL--------APPAYDNPKLSPQPTVQSFQPPAQPIVAQPSPQPAYY-------- 151

Query: 177 XXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSI 236
                                       +H+GLK FGSKLGNAAIFGAGAT+GSD+VNSI
Sbjct: 152 ----------QAPPQQVVVEQQPVQQSSAHNGLKSFGSKLGNAAIFGAGATLGSDLVNSI 201

Query: 237 F 237
           F
Sbjct: 202 F 202

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  163 bits (413), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 129/252 (51%), Gaps = 26/252 (10%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS +NRSL  IR EL+FLKESNVIS + F+ I S LP K+D            N   P
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWD-----------GNQRSP 49

Query: 61  QDQGNE-FVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           Q+   E +VEA+Y FE QQ GDL+LK GDKI+V+EK SP+W++G+ N + G+FP+NYVKP
Sbjct: 50  QNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKP 109

Query: 120 AF-------SGSSGSVNKVARPN-GPPQYQN------SLQTQNSHTPSXXXXXXXXXXLT 165
           AF       S  + S + V+RP+  PP Y+       S Q    + P             
Sbjct: 110 AFTRSASPKSAEAASSSTVSRPSVPPPSYEPAASQYPSQQVSAPYAPPAGYMQAPPPQQQ 169

Query: 166 NYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAG 225
                                                  +    K FGSKLGNAAIFGAG
Sbjct: 170 QAPLPYPPPFTNYYQQPQQQYAPPSQQAPVEAQPQQSSGASSAFKSFGSKLGNAAIFGAG 229

Query: 226 ATIGSDIVNSIF 237
           + IGSDIVNSIF
Sbjct: 230 SAIGSDIVNSIF 241

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  162 bits (409), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (76%), Gaps = 3/125 (2%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MS S INRSL TIRTEL+FLKES VIS   F +I S+LP +YDP  S APS+ S+   + 
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDP--SNAPSMLSATTTR- 57

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEAIY F+PQQ GDLA++PGDKI+V+EK SPEW+KG CNG+ G+FPSNY KPA
Sbjct: 58  DSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA 117

Query: 121 FSGSS 125
           FSGS+
Sbjct: 118 FSGST 122

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 2/37 (5%)

Query: 203 HHSHHG--LKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
           HHS+ G  LK FGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 184 HHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  159 bits (402), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 106/176 (60%), Gaps = 21/176 (11%)

Query: 64  GNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPAFSG 123
           G EFVEAIY F+PQQ+GDLAL PGDKIEV+EKPSPEWF+GRCNG+ GMFPSNYVKPAF  
Sbjct: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAF-- 59

Query: 124 SSGSVNKVARPNGPPQY-QNSLQTQNSHTPSX-XXXXXXXXXLTNYYXXXXXXXXXXXXX 181
            SG  ++ A P  PPQY Q ++ +Q S   +            TNYY             
Sbjct: 60  -SGGFDRPAAPP-PPQYDQKAMASQPSGGNAMWQQPSPYPPPSTNYYQPPPPQQQQPQPM 117

Query: 182 XXXXXXXXXXXXXXXXXXXXXHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
                                   HHGL KFGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 118 VVQQEQG---------------KRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  159 bits (401), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 99/125 (79%), Gaps = 7/125 (5%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MS++SINRSL +++TEL+FL++SNVIS E FDQI + LP ++DP         ++NN+ P
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESL----ATNNSSP 56

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEAIY F+PQQ GDLA++PGDKI+V+EK SPEW+KG+CNG+ G+FPSNYVKPA
Sbjct: 57  NL---EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPA 113

Query: 121 FSGSS 125
           FSG S
Sbjct: 114 FSGGS 118

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  144 bits (363), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 96/145 (66%), Gaps = 17/145 (11%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSL  IR ELDFLKES VIS + F+ I S LP K+D +    P+         
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASV------ 54

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                EFVEA+Y FEPQQ+GDL LK GDKI+++EK SP+W++G+ N + G+FP+NYVKPA
Sbjct: 55  ----EEFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPA 110

Query: 121 FSGSSGSVN-------KVARPNGPP 138
           F+ S+   N       KV+RP+ PP
Sbjct: 111 FARSASPENEGASLSSKVSRPSAPP 135

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%)

Query: 208 GLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
             K FGSKLGNAAIFGAG+TIGSDIV+SIF
Sbjct: 220 AFKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  141 bits (356), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 14/140 (10%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MS++ INRSLATIRTEL FL +S VI+++  +QI S LP     + + A     +NN  P
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP-----NPNEALRGAPANNAGP 55

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
                E+VEA+Y F+ QQ GDL  K G+KIEV+EKPSPEW+KGRCNG+ GMFPSNYVKPA
Sbjct: 56  V----EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA 111

Query: 121 FSGSSGSVNKVARPNGPPQY 140
           FSG  GS+ K A    PP+Y
Sbjct: 112 FSG--GSLMKEAS---PPRY 126

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 28/28 (100%)

Query: 210 KKFGSKLGNAAIFGAGATIGSDIVNSIF 237
           KKFGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  132 bits (331), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (66%), Gaps = 17/145 (11%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MSAS INRSL  IR EL+FLKESNVIS E F  I S LP K+D ++       S+NN   
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENS------KSANNAST 54

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           +    E+VEA+Y FE QQ GDL+LK GDKI+++EK S +W+KG+ N   G+FP+NYVKPA
Sbjct: 55  E----EYVEALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPA 110

Query: 121 FSGSSGS-------VNKVARPNGPP 138
           F+ S+          ++V+RP+ PP
Sbjct: 111 FTRSTSPDFEKTPLSSRVSRPSVPP 135

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/29 (82%), Positives = 27/29 (93%)

Query: 209 LKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
            K FGSKLG+AAIFGAG+TIGSDI+NSIF
Sbjct: 210 FKSFGSKLGDAAIFGAGSTIGSDIINSIF 238

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  123 bits (308), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 78/114 (68%), Gaps = 10/114 (8%)

Query: 5   SINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQPQDQG 64
           S+  S+ATI++EL +LKE   +++  +  I S LP +  P    A ++          Q 
Sbjct: 3   SVEESVATIKSELKYLKEQGALAELAYKDIESLLP-RVRPQPPVADTMG---------QN 52

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           NE VEA+Y F+PQQ GDLALKPGDKIE++EK SPEW+KG+CNGQ G+FPSNYVK
Sbjct: 53  NEIVEALYAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (82%)

Query: 203 HHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
           H      KKFGSKLGNAAIFGAGATIGSD+VNSIF
Sbjct: 186 HQGSAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  112 bits (279), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 7/124 (5%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MS  S+NRS+  IRTEL++L ES VIS++TFD+    LP  +D        I  +    P
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWD-----GKPIGGAGEKHP 55

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
             +  E+VEAI+ ++PQ++ DL L+ GDK+E++EK S +W++G+  G+ G+FPSNYVK  
Sbjct: 56  PHE-PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114

Query: 121 -FSG 123
            FSG
Sbjct: 115 KFSG 118

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 203 HHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSI 236
           HHS  G K    + GN+ +FGAG  IGSDIVN I
Sbjct: 181 HHSGAG-KNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  108 bits (270), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/149 (49%), Positives = 94/149 (63%), Gaps = 16/149 (10%)

Query: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60
           MS+S INRSLA I+TEL+FL ESNVISQ    QI S L         R  ++ +++    
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSML------SNPREGTMKAAS---- 50

Query: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           Q    E+VEA+Y F PQQ GDL  K GDKIEV+EKPS +W+KG+ NG+ GMFPSNYVK  
Sbjct: 51  QQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSL 110

Query: 121 FSGSSGSVNKVARPNGPPQYQNSLQTQNS 149
            +  +G   +   P  PPQY  SL  Q++
Sbjct: 111 RTLPNG--GRFDEP--PPQY--SLMVQDT 133

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 209 LKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
            KKFGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 91.7 bits (226), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 3/72 (4%)

Query: 53  HSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMF 112
           H SN  + Q    E+VE +Y F+PQ + DL +KPGDK+EV+EK S +W+KG+CNG+ GMF
Sbjct: 5   HHSNKEKSQ---GEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMF 61

Query: 113 PSNYVKPAFSGS 124
           P+NYVKP   G 
Sbjct: 62  PANYVKPVGGGD 73

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/34 (73%), Positives = 29/34 (85%)

Query: 204 HSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237
           H HH L K GSKLGNAAIFG GAT+G+D+V+SIF
Sbjct: 117 HRHHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 74/120 (61%), Gaps = 11/120 (9%)

Query: 4   SSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNN----- 58
           ++I  +   IR  L+ L ++  IS+  +D+I   L  K      R+PS  S +N      
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHK-----RRSPSASSYSNPTKGAL 62

Query: 59  QPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
            P++ G ++VEAIY +  +Q+GDL L PGD IEVI K SP+W++GR NG+ G+FP+NYVK
Sbjct: 63  SPRN-GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 215 KLGNAAIFGAGATIGSDIVNSIF 237
           KLGNAA+FGAG+  G+DIVN IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 8/70 (11%)

Query: 51  SIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQ 108
           S   +NNN P+        A+Y F+ +++GDL+ + GD I +I+K     +W+ GRCNG+
Sbjct: 403 SQRQTNNNLPK------AVALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGE 456

Query: 109 TGMFPSNYVK 118
            G+FP+NYV+
Sbjct: 457 EGIFPANYVE 466

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  +Q GDLA K GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 39  PVKYDPDASRAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP 98
           P    PD   +PS HS    +    G     A+Y F+ +Q GDL  + GD I +++K   
Sbjct: 320 PRTEKPDFGLSPSAHS----RTASSGAPKAVALYTFKGEQSGDLPFRKGDVITILKKSES 375

Query: 99  --EWFKGRCNGQTGMFPSNYVK 118
             +W+ GR NGQ G+FP+NYV+
Sbjct: 376 QDDWWTGRNNGQEGIFPANYVE 397

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  +Q GDLA K GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 40/56 (71%), Gaps = 3/56 (5%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           NE V A+Y F  +Q+GDL+ + GDKI ++++     +W+ GR NG+ G+FP+NYV+
Sbjct: 378 NEAV-ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  +Q GDLA K GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 32  DQITSTLPVKYDPD----ASRAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPG 87
           D I  + P    PD     + +   HS++       G     A+Y F+ +Q GDL  + G
Sbjct: 358 DSIAPSRPTSEKPDFGLLNTGSKGSHSASIRDRPSSGTPKAVALYTFKGEQDGDLPFRTG 417

Query: 88  DKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           D I +++K +   +W+ GR NGQ G+FP+NYV+
Sbjct: 418 DVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  +Q GDLA K GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 53  HSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTG 110
           +SS N+  ++ G     A+Y F+ ++ GDL  + GD I +I+K     +W+ GR NG+ G
Sbjct: 354 NSSANSPARNSGAPKAVALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEG 413

Query: 111 MFPSNYVK 118
           +FP+NYV+
Sbjct: 414 IFPANYVE 421

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 6/80 (7%)

Query: 41  KYDPDASRAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP-- 98
           +Y P  +  P + ++    P   G E V A+Y ++ Q  GDL+   G  IE++++ +   
Sbjct: 438 QYTPTPTAQPGMGAA----PMPTGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVN 493

Query: 99  EWFKGRCNGQTGMFPSNYVK 118
           EW+ GR NGQ G+FP NYV+
Sbjct: 494 EWWTGRYNGQQGVFPGNYVQ 513

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 4/58 (6%)

Query: 64  GNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP---EWFKGRCNGQTGMFPSNYVK 118
           G E V A+Y ++ Q  GDL+   G  IE++E+ +P   EW+ GR NGQ G+FP NYV+
Sbjct: 403 GGETVTALYEYQAQAAGDLSFPAGAVIEIVER-TPDVNEWWTGRYNGQQGVFPGNYVQ 459

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL+ K GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 52  IHSSNNNQPQDQGN-EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTG 110
           I SS++N+ Q Q     V A++    ++  +L+ + GD I VIE+   +W++GR  G+ G
Sbjct: 200 IESSHHNESQTQNTVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVG 259

Query: 111 MFPSNYVKPA 120
           +FP NYV P 
Sbjct: 260 IFPLNYVTPV 269

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYV 117
           A+Y F+ +Q+GDL  + GD I ++++     +W+ GR NGQ G+FP+NYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 64  GNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           G E V A+Y ++ Q  GDL+   G  IE++E+ S   EW+ G+ NGQ G+FP NYV+
Sbjct: 399 GVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 60  PQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYV 117
           P   G     A+Y F+ +Q GDL  + GD + +++K     +W+ GR NGQ G+FP+NYV
Sbjct: 366 PASSGAPKAVALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYV 425

Query: 118 K 118
           +
Sbjct: 426 E 426

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPS--PEWFKGRCNGQTGMFPSNYVK 118
           A+Y F  +Q GDL  + GD I +++K     +W+ GR NGQ G+FP+NYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q +GDL+   G  IE++++ +   EW+ G+ NGQ G+FP NYVK
Sbjct: 435 ETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVK 489

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 64  GNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE--WFKGRCNGQTGMFPSNYVK 118
           G E V A+Y ++ Q  GDL+   G  IE++++ + E  W+ GR NGQ G+FP NYV+
Sbjct: 382 GMETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 64  GNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE--WFKGRCNGQTGMFPSNYVK 118
           G E V A+Y ++ Q +GDL    G  IEV+E+ +    W+ GR NGQ G+FP NYV+
Sbjct: 408 GVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           E V A+Y F  +Q+GDLA K GD I VI+K     +W+ G+   + G+FP+NYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPAFSGSSGS 127
           V A+Y    Q++ +L+ + GD I V+E+   +W++G  +G+ G+FP NYV P    S+  
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELSNED 293

Query: 128 VNK 130
           + K
Sbjct: 294 IIK 296

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 5/77 (6%)

Query: 44  PDASRAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWF 101
           P  SR   I + ++  P   G+    A+Y F  +++GDL+ + GD I +I+K     +W+
Sbjct: 436 PGPSRMTGIPTRDDAVP---GSPKAVALYSFTGEERGDLSFRKGDVITIIKKSESQNDWW 492

Query: 102 KGRCNGQTGMFPSNYVK 118
            GR +G+ G+FP+NYV+
Sbjct: 493 TGRVSGREGIFPANYVE 509

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 7/71 (9%)

Query: 56  NNNQPQDQGNE-------FVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQ 108
           N+N P  Q +E        V A+Y     + G+L+ K GD I+VIE+   +W++G   G 
Sbjct: 226 NSNNPNQQIDEQKPAVVKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGT 285

Query: 109 TGMFPSNYVKP 119
            G+FP NYV P
Sbjct: 286 VGIFPLNYVNP 296

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL  + GD I V++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 8/67 (11%)

Query: 54  SSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGM 111
           SS++N P+        A+Y F  ++ GDL  + GD I +++K     +W+ GR NG+ G+
Sbjct: 397 SSSSNAPK------AVALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGI 450

Query: 112 FPSNYVK 118
           FP+NYV+
Sbjct: 451 FPANYVE 457

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL+ + GD I +I+K     +W+ G+ NG+ G+FP+NYV+
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVE 435

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKP--SPEWFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q  GDL+   G  IE++++   + EW+ GR NGQ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL  + GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP---EWFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q  GDL+   G  IEV+++ +P   EW+ GR NGQ G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 464

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL  + GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP---EWFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q  GDL+   G  IE++++ +P   EW+ GR NGQ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL  + GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL  + GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP---EWFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q  GDL+   G  IE++++ +P   EW+ GR NGQ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           V A+Y ++ Q  GDL+   G  IEV+++     EW+ GR NGQ G+FP NYV+
Sbjct: 417 VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQ 469

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%)

Query: 58  NQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYV 117
            QPQ Q    V+AI+     +  +L+ K GD I VIE+   +W++G   G+ G+FP NYV
Sbjct: 205 EQPQPQIVRRVKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           V A+Y F   +Q +L+ K GD I V+E+   +W++G   G  G+FP NYV P 
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPV 279

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           V A+Y        +L+ K GD I V+E+   +W+KG+   QTG+FP NYV P 
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 64  GNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           G   V A+Y     +Q +L+ + GD I V+E+   +W++G  +G+ G+FP NYV P
Sbjct: 213 GIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A++ F+ +Q GDL+   GD + +++K     +W+ GR N Q G+FP+NYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 43  DPDASRAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WF 101
           DP A   PS  SS+ +       E   A+Y F  Q  GDL+      IE++++     W+
Sbjct: 309 DPPAYSEPSYGSSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWW 368

Query: 102 KGRCNGQTGMFPSNYV 117
            GR NG+ G+FP+NYV
Sbjct: 369 TGRYNGREGLFPANYV 384

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 63  QGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           Q  E+  ++Y ++ Q QGDL+   G  I+++++ +   +W+ G  NGQ G+FP NYV+
Sbjct: 397 QAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 4/56 (7%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE---WFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q +GDL    G  IEV+E+ +P+   W+ GR NG  G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL  + GD I +++K     +W+ GR +G+ G+FP+NYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A++ F  ++ GDL  + GD + +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++ GDL  K GD I +++K     +W+ GR N   G+FP+NYV+
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVE 447

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           E   ++Y ++ Q  GDL+   G  IE++E+ +   EW+ GR NGQ G+FP NYV+
Sbjct: 413 ETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE--WFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q +GDL    G  IEV+E+ +    W+ GR NG  G+FP NYV+
Sbjct: 378 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%)

Query: 64  GNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPAF 121
           G + V A+Y F   +  +L+ K GD I V+E+   +W++G   G+ G+FP NYV P  
Sbjct: 212 GVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTPIM 269

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  +++GDL  K GD I ++++     +W+ G  NG+ G+FP+NYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A+Y F  ++  DL  + GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPAFSGSSGS 127
           V A+Y     +  +L+ + GD I V+E+   +W+KG   G+ G+FP NYV P    S   
Sbjct: 217 VRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTPISEPSKEE 276

Query: 128 VNK 130
           + K
Sbjct: 277 IEK 279

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 6/91 (6%)

Query: 35  TSTLPVK------YDPDASRAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGD 88
           TS +PV+      Y   AS  P+   +    P     + V A+Y     +  +L+ K GD
Sbjct: 194 TSAVPVQQNQQTSYGVLASFVPTSEPAPTPAPAQTVIKRVRAMYDLTATESDELSFKKGD 253

Query: 89  KIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
            I V+E+   +W++G   G+ G+FP NYV P
Sbjct: 254 VITVVEQVYRDWWRGNIRGRVGIFPLNYVTP 284

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           V A+Y     +  +L+ + GD I V+E+   +W+KG   G+ G+FP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPAFSGSSGS 127
           V A+Y     +  +L+ K GD I V+E+   +W+KG   G  G+FP NYV P    S+  
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISDLSNAE 299

Query: 128 VNK 130
           + +
Sbjct: 300 LEQ 302

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 8/72 (11%)

Query: 49  APSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCN 106
           +PS   + +N P+        A+Y F  ++ GDL  + GD I +++K     +W+ GR  
Sbjct: 402 SPSAGDTFSNTPK------AVALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVG 455

Query: 107 GQTGMFPSNYVK 118
           G+ G+FP+NYV+
Sbjct: 456 GREGIFPANYVE 467

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           V+A+Y     +  +LA K GD I V+E+   +W++G   G  G+FP NYV P 
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           V A+Y     +  +L+   GD I VIE+   +W++G   G+ G+FP NYV P 
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKP--SPEWFKGRCNGQTGMFPSNYVK 118
           E V A+Y ++ Q  GDL+      IE++++   + EW+ GR +GQ G+FP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           V A+Y     +  +L+ + GD I V+E+   +W+KG   G  G+FP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           V A+Y     +  +L+   GD I V+E+   +W++G   G TG+FP NYV P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           +EAIY +E Q   ++++ PGD I VI       W  G C+G  G+FP++Y K
Sbjct: 582 MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFK--GRCNGQTGMFPSNYVKPAFSGSS 125
           + +Y +  +   ++ + PGDKI ++ + +   W K      G+TG+ P+ Y++ + + + 
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATV 558

Query: 126 GSVNKVARPNGPPQYQNSL 144
            + ++   P  PP  +++L
Sbjct: 559 KANDRGPAPEVPPPRRSTL 577

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           V A+Y    ++  +L+ + GD I V+E+   +W++G   G+ G+FP NYV P
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTP 279

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYV 117
           V A+Y F  QQQGDL+ K  D I V +K     +W+ G  +G  G+FP+NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKP-SPEWFKGRCNGQTGMFPSNYVK 118
           E   ++Y F  Q + DL       IE++++  S  W+ GR NGQ G+FP NYV+
Sbjct: 364 ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNYVR 417

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 9/90 (10%)

Query: 38  LPVKYDPDASRAPSIHSSNN-NQPQDQGN-EFVEAIYPFEPQQQG-DLALKPGDKIEVIE 94
           LP   +   S+  +I SS+  N+  D  N EF  A++ F P+ +  +L L  GD + ++ 
Sbjct: 277 LPYILNRVISKLQTIESSHGVNEKIDLSNLEFARALFDFNPENRKIELTLTKGDLMAILT 336

Query: 95  KPSP-----EWFKGRC-NGQTGMFPSNYVK 118
           K  P     +W+K R  NG TG  PSNY++
Sbjct: 337 KKDPYGNTSKWWKVRTKNGDTGYVPSNYIE 366

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           V A+Y     +  +L+ +  D I V+E+   +W+KG   G+ G+FP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           +EA+Y +E Q   ++++  GD+I VI       W  G C+G  G+FP++Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 62  DQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFK--GRCNGQTGMFPSNYVK 118
           D GN+    +Y +  Q   ++ + PGDKI ++ + +   W K      G+TG+ P+ Y++
Sbjct: 495 DSGNK---VLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIR 551

Query: 119 PAFSGSSGSVN 129
            + S +S + N
Sbjct: 552 VS-SAASATAN 561

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSP--EWFKGRCNGQTGMFPSNYVK 118
           A++ F   + GDL  K GD I +I++     +W+ GR N + G+FP+NYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 60  PQDQGN--EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFKGRCNGQTGMFPSNY 116
           P+  GN    V+A++ +E Q   +++++ GD I V++      W  G  NGQ G+FP+NY
Sbjct: 561 PRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNY 620

Query: 117 VK 118
            +
Sbjct: 621 CQ 622

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 46  ASRAPSIHSSNNNQPQDQGNEFV-EAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-W--F 101
           AS A  + SSN N  QD         ++ ++ Q   ++++ PG+ I ++   S   W   
Sbjct: 470 ASGASEVTSSNMNSIQDSSEHNKNRVLFQYQKQDNDEVSVSPGNAISLLTADSGSGWTRI 529

Query: 102 KGRCNGQTGMFPSNYVK 118
           K    G+ G+ P++Y++
Sbjct: 530 KNDSTGEAGLVPTSYIE 546

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120
           V A++    +   +L+ + GD I V+E+   +W++G   G+ G+FP NYV P 
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPV 281

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119
           V A+Y  E     +LA +  D I VIE+   +W+ G    + G+FP NYV P
Sbjct: 219 VRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTP 270

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFKGRCNGQTGMFPSNYVK 118
           VEA+Y ++ Q + + +L  GD I V++      W  G  NG+ G+FP++Y K
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFKGRCN--GQTGMFPSNYVKPAFSGSSG 126
            +Y ++ Q   ++++ PGD I ++   +   W K + +  GQTG+ P+ YV       S 
Sbjct: 495 VLYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYVDIKEKARSS 554

Query: 127 SVNKVARPNGPP 138
           +      P  PP
Sbjct: 555 A------PRAPP 560

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           +EA+Y +E Q   ++++  GD I VI       W  G C+G  G+FP++Y K
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFK--GRCNGQTGMFPSNYVKPAFSGSS 125
           + +Y +  Q   ++++ PGD+I ++ + +   W K      G++G+ P+ Y++ + + ++
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 126 GSVNKVARPNGPPQYQNSL 144
            + N+   P  PP  +++L
Sbjct: 559 TANNRGPAPEVPPPRRSTL 577

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 60  PQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFKGRCNGQTGMFPSNYVK 118
           P   G E   A+Y +  Q +GDL    G  I+V+++     W+ G  NG  G+FP NYV+
Sbjct: 365 PTSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 56  NNNQPQDQGN-EFVEAIYPFEPQQ-QGDLALKPGDKIEVIEKPSP-----EWFKGRC-NG 107
           N ++P D    EF  A+Y F P+  Q ++ALK GD + ++ K  P     +W+K R  NG
Sbjct: 304 NGDEPIDPSKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNG 363

Query: 108 QTGMFPSNYVK 118
             G  P NY++
Sbjct: 364 SIGYIPYNYIE 374

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           VEAIY +E     +L++  G+ I+VI       W  G  NG  G+FPS+Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFKGRCNGQTGMFPSNYV 117
           V AIY +  Q   +++++ GD I+V+   +   W  G  NG  G+FPSNY 
Sbjct: 575 VTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFKGR--CNGQTGMFPSNYVK 118
            ++P+  Q + ++ + PG+ I ++ +     W K R     Q G+ PS YV+
Sbjct: 497 VLFPYTKQDEDEVTIAPGNSIVLLRQDDGSGWVKIRNASTQQEGLVPSTYVE 548

>SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 48  RAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQ-QGDLALKPGDKIEVIEKPSP-----EWF 101
           R  +  SS    P  +  EF  A+Y F P+  Q ++ LK GD + +I K  P     +W+
Sbjct: 306 RVGASSSSLRTSPDPKNLEFARAVYDFTPENPQIEVTLKKGDLMAIISKQDPIGNESQWW 365

Query: 102 KGRC-NGQTGMFPSNYVK 118
           K R   G  G  P NY++
Sbjct: 366 KVRTKKGDIGYVPYNYIE 383

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 8/61 (13%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKP 119
           V+A+Y +EPQ   +LA+K  D + ++EK    EW+  K R  G      TG+ PSNYV+P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 120 A 120
           A
Sbjct: 68  A 68

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 47  SRAPSIHSSNNNQPQDQGN-EFVEAIYPFEPQQ-QGDLALKPGDKIEVIEKPSP-----E 99
           S A  I   + ++P D    EF  A+Y F P+  Q ++AL  GD + ++ K  P     +
Sbjct: 306 SGAIQISKGSGSEPIDPSKLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSD 365

Query: 100 WFKGRC-NGQTGMFPSNYVK 118
           W+K R  NG+ G  P NY++
Sbjct: 366 WWKVRTKNGKIGYIPYNYIE 385

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 66  EFVEAIYPFEPQQ-QGDLALKPGDKIEVIEKPSP-----EWFKGRC-NGQTGMFPSNYVK 118
           EF  A+Y F P+  + ++ALK GD + ++ K  P     +W+K R  NG  G  P NY++
Sbjct: 311 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYIE 370

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRCNGQTGMFPSNYV 117
           A YP++ Q   +L+L+ GDKI+V+ E     W  G  NG  G+FP+ Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           V+A+Y +E Q   ++++  GD I VI+      W  G  NG  G+FPS+Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           +EA Y +E +   ++++  GD I VI       W  G C+G  G+FP++Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 62  DQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFK--GRCNGQTGMFPSNYVK 118
           D GN+    +Y +  Q   ++++ PGDKI ++ + S   W K      G+TG+ P+ YV+
Sbjct: 495 DGGNK---VLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

Query: 119 PAFSGSSGSVN-KVARPNGPPQYQNSL 144
            + +    + N +   P  PP  + +L
Sbjct: 552 ISNADGGDAANGRGPAPEVPPPRRTAL 578

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQ-----TGMFPSNYVKPAFS 122
           V A+  +EPQ   DL +  GDKI V+      W+ GR   +     +G+FPS++VK    
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK-VIE 69

Query: 123 GSSG 126
           G  G
Sbjct: 70  GKDG 73

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 66  EFVEAIYPFEPQQ-QGDLALKPGDKIEVIEKPSP-----EWFKGRCN-GQTGMFPSNYVK 118
           EF  A+Y F P+  + + +LK GD + +I K  P     +W+K R   G+ G  PSNY++
Sbjct: 315 EFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIE 374

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF-----KGRCNGQTGMFPSNYVKPA 120
           V A Y +E    GDL  + G +IEVI     +W+      G  N Q G+FP NYV+ A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG--RCNGQTGMFPSNYVK 118
           A Y +E  +  +L  K GD+I  IE    +W+ G  +  G+ G+FPSNYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPS--PEWFKGRCNGQTGMFPSNYVK 118
           A+YP+E Q   +++L  GD I+VI KP     W  G  N +  +FP++Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFK--GRCNGQTGMFPSNYVK 118
           + +Y +      ++++ PGD I+V+EK +   W K      G+ G+ PS+Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           ++A Y +E Q   +L+L P D + VI       W  G  NG+ G+FP++Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 36.6 bits (83), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 82  LALKPGDKIEVIEKP--SPEWFKGRCNGQTGMFPSNYVK 118
           L    G  IE++++   + EW+ GR NGQ G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 67  FVEAIYPF-EPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYVK 118
           + +A+Y F EP +   L  + GD + + EK + +W+ G     NG+ G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 58  NQPQDQGNEF-VEAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPS 114
           N  +D+   + V+A+Y ++       +L+ + GD ++V +     W   + NGQTG+ PS
Sbjct: 289 NDLEDENFTYTVKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPS 348

Query: 115 NYVK 118
           NYVK
Sbjct: 349 NYVK 352

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 67  FVEAIYPF-EPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYVK 118
           +  AIY F EP     L  + GD + + EK + +W+ G     NG+ G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 62  DQGNEFVEAI--YPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           +QG +   AI  Y  E ++  +LA K GDKI  I     +W+ G     G+ G+FPSNYV
Sbjct: 568 EQGEQLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYV 627

Query: 118 K 118
           +
Sbjct: 628 Q 628

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 66  EFVEAIYPF-EPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYVK 118
           ++V+A+Y + EP +   L    GD + ++E  + +W+ G     N Q G+ P NYVK
Sbjct: 548 KYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 44  PDASRAPSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG 103
           P ++ A S+      +P   G     A Y ++  +  +L    GDKI  IE    +W+ G
Sbjct: 491 PASASAGSVPPPPPRKPAQSGGPSAVAEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLG 550

Query: 104 RCN--GQTGMFPSNYV 117
                G+ G+FPSNYV
Sbjct: 551 ELEKTGEKGLFPSNYV 566

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 67  FVEAIYPF--EPQQQG---DLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVK 118
           +  A+Y +  +P QQG   DL  K GD I VI+K    W+ G      + G FP N+V+
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 59  QPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNY 116
           +P+++   +  A Y ++  ++ +L     DKI  IE    +W+ G    NG+ G+FPSNY
Sbjct: 551 EPKEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNY 610

Query: 117 V 117
           V
Sbjct: 611 V 611

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPAFS 122
           N++  A+Y FEP+   +L LK  D + +  K    W   +     QTG+ P  YV    S
Sbjct: 106 NQWAVALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYVSYLES 165

Query: 123 GSSGSVNKVARPNGPPQYQN 142
           G       VA  NG  + Q+
Sbjct: 166 GEED----VAATNGRTEEQD 181

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPE-WFKGRCNGQTGMFPSNYV 117
           V A+Y +  +   +++++ GD I+VI   +   W  G   G  G+FPSNY 
Sbjct: 621 VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCN--GQTGMFPSNYVKPA 120
           A Y +E  ++ +L    GDKI  IE    +W+ G     G+ G+FPSNYV+ A
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVELA 635

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 60  PQDQG-NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQ--TGMFPSNY 116
           PQD   N+   A+Y FEP+   +L LK GD I +  +    W   + + Q  TG+ P  +
Sbjct: 90  PQDYVVNQKAVALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEF 149

Query: 117 VKPAFSGSSGSV 128
           V    S  S SV
Sbjct: 150 VSYLDSEESDSV 161

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           A Y +E  +  +L  +  DKI  IE    +W+ G    NG+ G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVKPAFSGSS 125
           V+A+Y +  + + DL     D IEV  K    W  GR   N ++G FP NYV+  +   +
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEVT-KVKGNWLYGRLLRNKKSGYFPVNYVQVLYEVPN 70

Query: 126 GSVNK 130
           G + +
Sbjct: 71  GYIER 75

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 4/81 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPAFSGSSGS 127
           AIY F P+   +LALK GD + +  K    W   +     +TG+ P  YV  +F      
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV--SFIEDDED 152

Query: 128 VNKVARPNGPPQYQNSLQTQN 148
               A     P Y     TQN
Sbjct: 153 TQSGAEEEARPFYLTHFITQN 173

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 52  IHSSNNNQPQDQGNEFVEAIYPFEPQQ-QGDLALKPGDKIEVIEKP-----SPEWFKGRC 105
           I S  N Q      EF  A+Y F P+  Q ++ LK GD + ++ K        EW+K R 
Sbjct: 295 IGSQPNQQIDPSKLEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRT 354

Query: 106 -NGQTGMFPSNYVK 118
            +G  G  P NY++
Sbjct: 355 KSGDIGYVPFNYIE 368

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPS--PEWFKGRCNGQTGMFPSNYVK 118
           +EA+Y ++ Q   +L++  G  ++V+ KP     W  G  +G  G+FP++Y K
Sbjct: 574 IEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTYGELDGAKGLFPTSYCK 625

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 15/106 (14%)

Query: 41  KYDPDASRAPSIHSSNNNQPQDQGNEFVEA-----IYPFEPQQQGDLALKPGDKIEVIEK 95
           + D   S A S   SN ++     N  VE+     +YP+  Q   ++ + PGD I ++ K
Sbjct: 465 RRDRTQSNASSTVQSNVSEDSFSVNSSVESSINRVLYPYAKQDADEVTINPGDLISLVTK 524

Query: 96  PSPE-W--FKGRCNGQTGMFPSNYVKPAFSGSSGSVNKVARPNGPP 138
            +   W   K    G+ G+ PS+YV      S+ SV     P+ PP
Sbjct: 525 DTGSGWTKIKNSTTGEMGLVPSSYVD--IKESTHSV-----PHAPP 563

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 62  DQGNEFV------EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFP 113
           D G+E +       A+Y +E  +    +++ + G+ + V +     W   R NG+TG+ P
Sbjct: 260 DVGDELISFPYTSRALYAYEADESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIP 319

Query: 114 SNYVK 118
           SNYV+
Sbjct: 320 SNYVE 324

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 59  QPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFP 113
           Q     N  + A+  +  + + ++++KPGDKI+VI   E  +  W+ GR    G+ G+FP
Sbjct: 22  QEVKNSNTMLIAVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFP 81

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 59  QPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNY 116
           +P+++ N +  A Y ++  +  +L     DKI  IE    +W+ G    +G  G+FPSNY
Sbjct: 536 KPKEKENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNY 595

Query: 117 V 117
           V
Sbjct: 596 V 596

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           EA+Y ++  Q    +++ + G+ + V +     W   + NG+TG+ PSNYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYVKP 119
           V A Y +  Q +GDL    GD +EV  + + +WF GR        G FP+N+V P
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEVT-RVAGDWFYGRLLRNKKCAGYFPNNFVIP 66

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYVK 118
           V+A Y +  Q +GDL    GD +EV  K + +W+ GR       +G FP+N+VK
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEVT-KITGDWYYGRLLRNRKCSGYFPNNFVK 67

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 48  RAPSIHSSNNNQPQDQGN-EFVEAIYPFEPQQQG-DLALKPGDKIEVIEKP-----SPEW 100
           R   + S+NNN   D    EF  AIY F P+    ++ L+ GD + ++ K        +W
Sbjct: 241 RNKRLASNNNNIQLDPTKLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQW 300

Query: 101 FKGRC-NGQTGMFPSNYVK 118
           +K R  NG  G  P NY++
Sbjct: 301 WKVRTKNGSVGFVPFNYIE 319

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 5/89 (5%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGR---CNGQT--GMFPSNYVKPAFS 122
           VEA++P+    + DL    G  I V+E    EWF G     +G+T  G+FP  +V     
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFVSEPLK 66

Query: 123 GSSGSVNKVARPNGPPQYQNSLQTQNSHT 151
            ++    +  +P   P  +  ++   + T
Sbjct: 67  ETASEPAQEKQPEEKPNVETPVKIPETQT 95

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 68  VEAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           V+A+Y ++       +++   G+ ++V +     W   R NGQTG+ PSNYV+
Sbjct: 311 VKALYSYQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVE 363

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 36.6 bits (83), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGR--CNGQTGMFPSNYVKPAFSG 123
           + ++A+Y ++ Q  G+L+   GD   V+ +   EW+      +G+ GM P +Y +     
Sbjct: 69  KVIKAMYNYQAQSPGELSFVKGDFFHVLTEDR-EWYDASNPSDGKRGMVPKSYFEIFGRT 127

Query: 124 SSGSVNKVARPNGPPQYQNSLQ 145
             GSVN     + P Q+Q   Q
Sbjct: 128 RPGSVNGSGSFDSPLQHQQVQQ 149

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 31/72 (43%), Gaps = 3/72 (4%)

Query: 49  APSIHSSNNNQPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQ 108
           +P  H      P   G+ +   +Y F+ ++  +L    G+ + V    + EWF  +  G+
Sbjct: 140 SPLQHQQVQQMPSKMGSLYAIVLYDFQAEKSDELTSYAGENLFVCAHHNYEWFIAKPIGR 199

Query: 109 T---GMFPSNYV 117
               G+ P  +V
Sbjct: 200 LGGPGLVPVGFV 211

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 36.6 bits (83), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           +A+YP++   +   +++ +  + ++V +     W   R NG+TG+ PSNYV+
Sbjct: 307 KALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           V+AIY +  +++ DL     D IEV  K    W+ GR   N ++G FP+NYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 62  DQGNEFV------EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFP 113
           D G+E V      +A+Y +E       +++ + G+ + V +     W   + NG+TG+ P
Sbjct: 258 DMGDELVNFPYTAKALYAYEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIP 317

Query: 114 SNYVK 118
           SNYV+
Sbjct: 318 SNYVE 322

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG---RCNGQTGMFPSNYV 117
           V A Y +  Q +GDL    GD +EV +K + +WF G   R    +G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYV 117
           A YP+  Q   ++++  GD I VI       W  G  NG  G+FP++Y 
Sbjct: 590 AKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSYC 638

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +A+Y +EPQ   +LA++  D + ++EK    +W+  K R  G      TG+ PSNYV+ A
Sbjct: 9   KAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNYVEEA 68

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 68  VEAIYPFEPQQQGD--LALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPAFSG 123
           V+AIY ++  Q  D  L     +  +V +    +W   K R   Q G  P NYV+P   G
Sbjct: 74  VKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEPISGG 133

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 72  YPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRC--NGQTGMFPSNYVKPA 120
           Y F  + Q +L +K GDK+ ++ +K S +W+  +   +G++G+ P+ +V+P 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           AIY +EPQ   +LA+   D + +++K    +W+  K R  G       G+ PS Y++ A
Sbjct: 10  AIYDYEPQTPEELAIHEDDLLYLLQKSDIDDWWTVKRRVIGSDSDEPVGLVPSTYIEEA 68

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCN--GQTGMFPSNYVK 118
           A Y  E ++  +LA + GDKI  I     +W+ G     G+ G+FPSNYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQ--QGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           +A+Y ++  +  Q +++ + G+ + V +     W   R NG+TG+ PSNYV+
Sbjct: 273 KALYSYQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVK 118
           V A+Y +  +Q  DL     D IEV  K   +W  GR   N +TG FP  YV+
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEVT-KVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYV 117
           V+A Y +  Q +GDL    GD +EV  + + +WF GR       +G FP+N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDVMEVT-RITGDWFYGRLLRNKKCSGYFPNNFV 65

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 35.8 bits (81), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 38  LPVKYDPDASRAPSIHSSNNNQPQDQ--------------------GNEFVEAIYPFEPQ 77
           LP +  P+   APS+ +  N + Q+                     G     A Y +E  
Sbjct: 471 LPSRSRPEEEDAPSLPNRGNTEQQESEPVPSLPSRENATEEPSKPAGGATAIAQYDYEAA 530

Query: 78  QQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVK 118
           +  +L     DKI  IE    +W+ G    +G+ G+FPSNYV+
Sbjct: 531 EDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG---RCNGQT--GMFPSNYVKPA 120
           + V AI+ +  + + +L L+ GD I VI K    W+ G     NG+   G FP NY + +
Sbjct: 49  DVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRSS 108

Query: 121 FS 122
            S
Sbjct: 109 HS 110

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 35.8 bits (81), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 72  YPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRC--NGQTGMFPSNYVKPA 120
           Y F  + Q +L +K GDK+ ++ +K S +W+  +   +G++G+ P+ +++P 
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPV 410

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
            AIY +EPQ   +LA++  D + +++K    +W+  K R  G       G+ PS Y++ A
Sbjct: 9   RAIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 4/57 (7%)

Query: 68  VEAIYPFEPQQQGD--LALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPA 120
           V AIY +   Q  D  L     D  +V +    +W   K   + + G  P NYV+PA
Sbjct: 74  VRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA 130

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 67  FVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCN--GQTGMFPSNYV 117
           +  A Y +E  +  +L  +  DKI  IE    +W+ G     G+ G+FPSNYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 35.8 bits (81), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           A Y +E  ++ +L     DKI  I+    +W+ G    NG+ G+FPSNYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           +A+YP++       +++ +  + ++V +     W   R NG+TG+ PSNYV+
Sbjct: 307 KALYPYDADGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON}
           BOI2Protein implicated in polar growth, functionally
           redundant with Boi1p; interacts with bud-emergence
           protein Bem1p; contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1040

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 30  TFDQITSTLPVKYDPDASRAPSIHSSNNNQPQDQGN-EFVEAIYPFEPQQQGDLALKPGD 88
           T  Q+ +T+    D   + +P   S  +   +D GN     AI  +  + + +L +KPGD
Sbjct: 9   TLSQLNTTVSRDKDVSDTLSPDFDSKGSATGRDGGNFPMYIAINEYFKRMEDELDMKPGD 68

Query: 89  KIEVI---EKPSPEWFKGR--CNGQTGMFP 113
           KI+VI   E+    W+ GR     + G++P
Sbjct: 69  KIKVITDDEEYKDGWYFGRNLRTNEEGLYP 98

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 72  YPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRC--NGQTGMFPSNYVKPA 120
           Y F  + Q +L +K GDK+ ++ +K S +W+  +   +G++G+ P+ +++P 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 8/59 (13%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           A+Y +EPQ   +LA++  D + +++K    +W+  K R  G       G+ PS Y++ A
Sbjct: 10  AVYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 35.4 bits (80), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQ--QQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           +A+Y ++     Q +++ + G+ ++V +     W   R NG+TG+ PSNYV+
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVE 338

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKP---SPEWFKGR--CNGQTGMFPSNYVKPAFSGS 124
           A+  +  + + +L ++PGDKIEVI      +  W+ GR     + G++P+ + K      
Sbjct: 20  AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTKKITLDK 79

Query: 125 SGSVNKV 131
           S S+ K+
Sbjct: 80  SESLRKI 86

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 35.4 bits (80), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 66  EFVEAIYPFEPQQ-QGDLALKPGDKIEVIEKPS-----PEWFKGRC-NGQTGMFPSNYVK 118
           EF  A+Y F P+  + +  +K G+ + ++++        EW+K R  NG TG  P NY++
Sbjct: 332 EFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTKNGSTGYVPYNYIE 391

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 35.8 bits (81), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +AIY +EPQ   +LAL+  D + ++EK    +W+  K R  G      +G+ PSNY++ A
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWWTVKKRVIGSDAEEPSGLVPSNYIETA 68

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRC--NGQTGMFPSNYVKPAFSG-SS 125
           A+Y FE +   +L ++ GD + VI +K S +W+      NG+ G+ P+ +++ + S  SS
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIEFSKSKESS 436

Query: 126 GSVNKVAR 133
           G +N + +
Sbjct: 437 GLLNSIKK 444

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 68  VEAIYPFEPQQ--QGDLALKPGDKIEVIEKPSPEWFKGRCNG--QTGMFPSNYVKPA 120
           + A+Y F+  Q  Q +L  K  D  +V +   P+W   R +   + G  P NYV+PA
Sbjct: 74  MRALYDFDQAQNPQEELVFKENDMFDVYDDKDPDWILVRSHSSNEYGFVPGNYVEPA 130

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQT-----GMFPSNYVKPA 120
           +A+Y +EPQ   +LA++  D + ++EK    +W+  K R  G       G+ PSNY++ A
Sbjct: 9   KAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKKRIIGSDAEEPQGLVPSNYIEAA 68

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 72  YPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRCNGQTGMFPSNYVK 118
           Y ++ Q++ ++ ++ GD + V+ E     W     +G +G+ P+NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 9/55 (16%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPE----WFKGRCN--GQTGMFPSNYVK 118
            +Y F  +   ++++ PGD I+V+   +P+    W K R N  G  G+ P++Y++
Sbjct: 526 VVYAFRGRDNDEVSVNPGDSIKVL---APDTGSGWTKLRNNTTGDQGLAPTSYLE 577

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKP---SPEWFKGR--CNGQTGMFPSNYVK 118
           A+  +  + + +L++KPGDKIEVI      +  W+ GR     + G++P+ + K
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVK 118
           A Y +E  +  +L  + GD I  I+    +W+ G     GQ G+FPSNYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFPSNYVK 118
           AI  +  + + +L +KPGDKIEVI   ++ +  W+ GR    G+ G++P  + +
Sbjct: 34  AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKLFTQ 87

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 72  YPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRC--NGQTGMFPSNYVKPA 120
           Y F  + Q +L +K GDK+ +++ K S +W+  +   +G++G+ P+ +++P 
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 68  VEAIYPFEPQQQGD--LALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKP 119
           V AIY +E  Q  D  L     D  +V++    +W   K   + + G  P NYV+P
Sbjct: 74  VRAIYDYEQVQNADEELTFHENDVFDVLDDKDVDWLLVKSTVSNEFGFIPGNYVEP 129

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
            AIY +EPQ   +LA++  D + ++ K    +W+  K R  G       G+ PS Y++ A
Sbjct: 9   RAIYAYEPQTPEELAIEEDDLLYLLHKSDVDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG---RCNGQTGMFPSNYV 117
           V+A Y +  Q +GDL    GD +EV  + + +WF G   R    +G FP+N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEVT-RITGDWFYGKLLRNKKCSGYFPNNFV 64

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           A Y ++  ++ +L     DKI  IE    +W+ G    NG+ G+FPSNYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +AIY +EPQ   +L LK  D + ++EK    +W+  K R  G       G+ PSNY++ A
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 68  VEAIYPFEPQQ--QGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPA 120
           V+A+Y +E  Q  + +L     D   V +   P+W   K + + + G  P NYV+P 
Sbjct: 74  VKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQPV 130

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 50  PSIHSSNNNQPQD-QGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--N 106
           P+ H  N N+  +   N    A Y ++  +  +L  +  DKI  IE    +W+ G     
Sbjct: 594 PARHVENENESGNTSSNPSAIAEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGST 653

Query: 107 GQTGMFPSNYV 117
           G+ G+FPSNYV
Sbjct: 654 GEKGLFPSNYV 664

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG---RCNGQTGMFPSNYV 117
           V A Y +  Q +GDL    GD +EV  + + +WF G   R     G FP+N+V
Sbjct: 15  VRAKYGWSGQAKGDLGFLEGDIMEVT-RVAGDWFYGKLLRNRKCAGYFPNNFV 66

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYV 117
           V+A Y +  Q +GDL    GD +EV  + +  WF GR       +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCSGYFPHNFV 65

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +AIY +EPQ   +LA++  D + ++EK    +W+  K R  G      +G+ PSNY++ A
Sbjct: 9   KAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWWTVKKRVIGSDAEEPSGLIPSNYIEEA 68

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 62  DQGNEFV------EAIYPF--EPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFP 113
           D G+E        +A+Y +  +     +++ + G+ + V +     W   R NG+TG+ P
Sbjct: 271 DAGDELTSFPYVAKALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIP 330

Query: 114 SNYVK 118
           SNYV+
Sbjct: 331 SNYVE 335

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYV 117
           V+A Y +  Q +GDL    GD +EV  + +  WF GR       +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCSGYFPHNFV 65

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 67  FVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVKPA 120
            ++A+Y +  Q  G+L+   G+ + VI +   EWF+     +G+ GM P +Y +P 
Sbjct: 68  ILKALYTYHAQSPGELSFTKGELVHVIGEDG-EWFEVSSPDSGRKGMVPKSYFEPV 122

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 62  DQGNEF------VEAIYPF--EPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFP 113
           D G+E        +A+Y +  +     +++ + G+ + V +     W   R NG+TG+ P
Sbjct: 272 DAGDELSSFPYLAKALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGIIP 331

Query: 114 SNYVK 118
           SNYV+
Sbjct: 332 SNYVE 336

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVK 118
           A+Y F P+   +L LK GD + +  K    W   +     +TG+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRC--NGQTGMFPSNYVKPAF---S 122
           + +Y F  + Q +L++K G  + ++ +K S +W+      +GQ G+ P+ +++P+    S
Sbjct: 365 KVLYDFIAESQDELSVKQGQTVYILNDKKSRDWWMCELVSSGQKGVVPAQFIEPSKEKDS 424

Query: 123 GSSGSVNKVAR 133
           GS G +N + +
Sbjct: 425 GSGGLLNSIKK 435

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +A+Y +EPQ   +LA++  + + ++EK    EW+  K R  G       G+ PSNYV+ A
Sbjct: 9   KALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNYVEQA 68

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 68  VEAIYPFEPQQQGD--LALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPAFSG 123
           V A+Y ++  Q  D  L     ++ +V +   P+W   + +  G  G  P NYV+P   G
Sbjct: 74  VRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYVEPCGQG 133

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           N +  A Y ++  +  +L     DKI  IE    +W+ G    +G  G+FPSNYV
Sbjct: 528 NPWATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC---NGQTGMFPSNYV 117
           V+A Y +  Q +GDL    GD +EV  + +  WF GR       +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCSGYFPHNFV 65

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           N +  A Y ++  +  +L     DKI  IE    +W+ G    +G  G+FPSNYV
Sbjct: 533 NPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 68  VEAIYPFEPQQQGD--LALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPAFSG 123
           V ++Y +E  Q  D  L  + GD+ +V +    +W   + R +G  G  P NYV+   + 
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVEKVGAA 133

Query: 124 SSG 126
            +G
Sbjct: 134 PAG 136

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 5/58 (8%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC-----NGQTGMFPSNYVK 118
           + V A Y + P ++  L L  GD + V+ K    W+ G           G FP NY K
Sbjct: 24  DVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSK 81

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGR-CNG-QTGMFPSNYV 117
           V A+Y F P+   +L LK GD I +  K    W      +G +TG+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {ON}
           Anc_7.413 YER114C
          Length = 1016

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFP 113
           AI  +  + + +L +KPGDKI+VI   E+ +  WF GR     + G++P
Sbjct: 45  AINEYTKRMEDELDMKPGDKIQVITTDEEYNDGWFYGRNLRTKEEGLYP 93

>NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.344
           YDR162C
          Length = 233

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 39/104 (37%), Gaps = 4/104 (3%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPAFS 122
           N++  AIY F P+ + +L LK  D + +  K    W   +     +TG+ P  +V  ++ 
Sbjct: 110 NQWAVAIYDFVPENENELDLKENDIVFISYKHGQGWLVAENEARTKTGLVPEEFV--SYL 167

Query: 123 GSSGSVNKVARPNGPPQYQNSLQTQNSHTPSXXXXXXXXXXLTN 166
                 + +      P Y   + T N   P           L N
Sbjct: 168 QPEEEADMLHEDKARPFYLTHMITNNMEVPVEADSRTNAVKLKN 211

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           V+  + +  +++ DL    GD IEV  + + +W+ G+   N + G FPSNYV
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEVT-RVTGDWYFGKLIRNKKQGYFPSNYV 61

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFP 113
            I  +  + + +L ++PGDKIEV+   E+ +  W+ GR    G+ G++P
Sbjct: 46  CINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYP 94

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 8/58 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVK 118
           +A+Y +EPQ + +LA++  D + +++K    +W+  K R  G      +G+ PSNY++
Sbjct: 9   KAVYDYEPQTEEELAVRENDMLYLLQKSDVDDWWTVKKRVIGSDVEEPSGLVPSNYIE 66

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 69  EAIYPFEPQQQGD--LALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVKP 119
            A+Y ++  Q  D  LA K  D  ++ +   P+W   R   +G  G  P NYV+P
Sbjct: 75  RALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEP 129

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1394

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 33/78 (42%), Gaps = 12/78 (15%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG---RCNGQTGMFPSNYVKPAFS 122
           + V  I+ F P     L L+ G  I VIEK S  W+ G       Q+G         +FS
Sbjct: 10  DIVVVIHNFTPTSSNMLPLQSGSIIYVIEKNSNGWWDGVQLVAGTQSG---------SFS 60

Query: 123 GSSGSVNKVARPNGPPQY 140
             SGS  K+ R   P  Y
Sbjct: 61  PKSGSTQKIIRGWFPANY 78

>Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar to
           Ashbya gossypii AGL293C
          Length = 1029

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFPSNYVK 118
           AI  +  + + +L +KPGDKIE I   ++ +  W+ GR    G+ G++P  + +
Sbjct: 56  AINEYSKRMEDELDMKPGDKIEAITDDQEYNDGWYYGRNLRTGEEGLYPKLFTQ 109

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           A Y +E  +  +L     DKI  IE    +W+ G    +G+ G+FPSNYV
Sbjct: 541 AEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYV 117
           N+   A+Y FEP+   +L L  GD + +  K    W   +     +TG+ P  +V
Sbjct: 112 NQRAVALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGR--CNGQTGMFPSNY 116
           + ++A+Y ++ Q  G+L+   GD   V ++   +W++     +G+ GM P NY
Sbjct: 66  KVIKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNY 117

>NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]
           {ON} Anc_7.413 YBL085W
          Length = 1023

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 14/98 (14%)

Query: 30  TFDQITSTLPVKYDPDASRAPSIHSSN---NNQPQD-QGNEFVEAIYPFEPQQQGDLALK 85
           T +Q+ ST P +      R  SI SS+   N  P+D +       I  +  + + +L ++
Sbjct: 8   TLEQLNSTSPSRI-----RNASIESSSYSGNFHPEDAKSYPMYICINEYTKRMEDELDMR 62

Query: 86  PGDKIEVI---EKPSPEWFKGR--CNGQTGMFPSNYVK 118
           PGDKI+V+   E+    W+ GR     + G++P  + +
Sbjct: 63  PGDKIQVLIDDEEYDDGWYFGRNLRTQEEGLYPVTFTQ 100

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           +A+Y ++       +++ + G+ ++V +     W   R NGQ G+ PSNYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPE---WFKGR--CNGQTGMFPSNYVKP 119
            +  +  + + ++ +KPGDKIEV+         W++G+     Q G++P+ + +P
Sbjct: 7   CVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +AIY +EPQ   +L ++  D + ++EK +  +W+  K R  G       G+ PSNYV+ A
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 68  VEAIYPFEPQQQGD--LALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYVKP 119
           V+A+Y +   Q  D  L     D  +V +   P+W   R     Q G  P NYV+P
Sbjct: 74  VKAVYDYHEVQNPDEELVFNENDTFDVYDDKDPDWILARSISTNQFGFIPGNYVEP 129

>ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa]
           {ON} some similarities with uniprot|P39969 Saccharomyces
           cerevisiae YER114C BOI2 Protein implicated in polar
           growth functionally redundant with Boi1p interacts with
           bud- emergence protein Bem1p contains an SH3 (src
           homology 3) domain and a PH (pleckstrin homology) domain
          Length = 1089

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFP 113
            I  +  + Q +L +KPGDKI+VI   E+ +  W+ GR     + G+FP
Sbjct: 42  VINEYTKRMQDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLFP 90

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 77  QQQGDLALKPGDKIEVIEKPSPEWFKGRC------NGQTGMFPSNYVKP 119
           +++  L+++PGD + V+ K    W+ G            G FP NY KP
Sbjct: 33  KKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYTKP 81

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPS---NYVKPAFSGS 124
           A+Y FEP+   +L L  GD + +  K    W   +     +TG+ P    +Y++P   G 
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPE-DGE 175

Query: 125 SGSVNKVARP 134
           +   NK ARP
Sbjct: 176 NEVENK-ARP 184

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 81  DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           +++   G+ ++V +     W   R NG+TG+ PSNYV+
Sbjct: 293 EISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 67  FVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG---RCNGQTGMFPSNYV 117
            V+A Y +  Q +GDL    GD + V  K + +W+ G   R     G FP N+V
Sbjct: 6   MVKARYGWSGQAKGDLGFLEGDIMNVT-KTTGDWYYGFLLRNKKSKGYFPKNFV 58

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           N +  A Y ++  +  +L     DKI  IE    +W+ G    +G  G+FPSNYV
Sbjct: 534 NPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
           CYK3SH3-domain protein located in the mother-bud neck
           and the cytokinetic actin ring; mutant phenotype and
           genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG---RCNGQTGMFPSNYV 117
           V+A Y +  Q +GDL    GD +EV  + +  WF G   R    +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGKLLRNKKCSGYFPHNFV 65

>ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR310C (CDC25),
           YLL016W and YLL017W; YLL016W and YLL017W represent one
           ORF in this genome
          Length = 1509

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 46/117 (39%), Gaps = 29/117 (24%)

Query: 63  QGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQT------------G 110
           +  + V A+  F P ++  L LK GD + V+ +    W  G    QT            G
Sbjct: 15  KCKDVVRALCDFVPLKKQHLPLKAGDVVYVLSRHESGWCDGIIIEQTAKGNSTVTQCQRG 74

Query: 111 MFPSNYVKPAF------SGSSGSV----NKVARPN-------GPPQYQNSLQTQNSH 150
            FP  Y +         S S+G+     N V+RP+        P   +NSL  + SH
Sbjct: 75  WFPRTYTRSIRERRCTQSSSAGAAGVAHNFVSRPHMMLRNPSTPTLRRNSLNIRVSH 131

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 82  LALKPGDKIEVIEKPSPEWFKG-RCNGQT---GMFPSNYVKPAFSGSSGSVNKVA 132
           L   PGDKI V+ K    W+ G   +G+    G FP ++VKP  + S G+  KVA
Sbjct: 53  LRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKPYRTVSPGA--KVA 105

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +AIY +EPQ   +L +   D + ++EK    EW+  K R  G       G+ PSNY++ A
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIEEA 68

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 68  VEAIYPF-EPQ-QQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPA 120
           ++A+Y + E Q Q+ +L     D  +V +   P+W   K R + + G  P NYV+P 
Sbjct: 74  MKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNYVEPV 130

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 10/73 (13%)

Query: 71  IYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFPSNYV----KPAF 121
           I  +  + + +L +KPGDKI+VI   E+ +  W+ GR     + G++P  +     KP+ 
Sbjct: 39  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQEISKPSL 98

Query: 122 SGSSGSVNKVARP 134
              + S  +VA P
Sbjct: 99  V-RAKSARRVASP 110

>TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON}
           Anc_8.344 YDR162C
          Length = 264

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYV 117
           N+   A+Y FEP+   +L L  GD + +  +    W   + +   +TG+ P  +V
Sbjct: 116 NQLAVALYDFEPENDNELGLTEGDIVYISYRHGQGWLVAENQEGTKTGLVPEEFV 170

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYV 117
           A+Y FEP+   +L L  GD + +  K    W   +     +TG+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
            A+Y ++  +    +++ +  + +EV +     W   R NG TG+ PSNYV+
Sbjct: 317 RALYSYKANENDAYEISFEQNELLEVSDIEGRWWKARRENGTTGIIPSNYVE 368

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 33/87 (37%), Gaps = 19/87 (21%)

Query: 59  QPQDQGN--------------EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKG- 103
           +PQD+G               + V A Y F P ++  L    GD I VI K    W+ G 
Sbjct: 3   RPQDEGMNPPKAGLSTIIKPLDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGI 62

Query: 104 ----RCNGQTGMFPSNYVKPAFSGSSG 126
               +     G FP +Y K     SS 
Sbjct: 63  LYYNKSLVLRGWFPRSYTKSIKDTSSS 89

>Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {ON}
           YER114C (REAL)
          Length = 1043

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFP 113
           AI  +  + + +L +KPGDKI+VI   EK    W+ GR     + G++P
Sbjct: 50  AINEYFKRMEDELDMKPGDKIKVITDDEKYKDGWYFGRNLRTNEEGLYP 98

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 65  NEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYVKPA 120
           N    A+Y FEP+   +L L+ GD + +  +    W   + +   +TG+ P  +V  A
Sbjct: 128 NRLAVALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYA 185

>Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKP---SPEWFKGR--CNGQTGMFPSNYVK 118
           A+  +  + + +L +KPGDKI+VI      +  W+ GR     + G++P+ + K
Sbjct: 20  AVNEYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGRNLRTEEEGLYPAVFTK 73

>Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016W
           (REAL)
          Length = 1254

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 44  PDASRAPSIHSSNNNQ-PQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFK 102
           PDA    +I +    + P  Q  + VE IY    + +  L+L+ GD + V+ K S  W+ 
Sbjct: 6   PDAGMIRAIKTEERREVPCLQPIDVVECIYEHFTESRDKLSLRIGDMVYVLNKGSNGWWD 65

Query: 103 G 103
           G
Sbjct: 66  G 66

>Skud_5.265 Chr5 (427799..430930) [3132 bp, 1043 aa] {ON} YER114C
           (REAL)
          Length = 1043

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 30  TFDQITSTLPVKYDPDASRAPSIHSSNNNQPQDQGN-EFVEAIYPFEPQQQGDLALKPGD 88
           T  Q+ +T+    +   + +P   S  +   ++ GN     AI  +  + + +L +KPGD
Sbjct: 9   TLSQLNTTVDRDRNASDTLSPEYDSKGSTSGREGGNFPMYIAINEYFKRMEDELDMKPGD 68

Query: 89  KIEVI---EKPSPEWFKGR--CNGQTGMFP 113
           KI+VI   E+    W+ GR     + G++P
Sbjct: 69  KIKVITDDEEYKDGWYFGRNLRTNEEGLYP 98

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPS---PEWFKGR---CNGQTGMFPSNYVK 118
            I  +  + + +L L PGD+IEV+E        W+ G+      Q G+FP  + K
Sbjct: 24  VINRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTK 78

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFPSNYVK 118
           AI  +  + + +L  KPGDKI+VI   E+ +  W+ G+     Q G++P+ + +
Sbjct: 38  AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGKNLRTQQEGLYPAVFTQ 91

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 32.3 bits (72), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           V+A +P++ + + DL       I V      EW+ G    + G+FP ++VK
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           + +Y ++  +    +++ + G+ ++V +     W   R  G+TG+ PSNYVK
Sbjct: 312 QTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSNYVK 363

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVI-EKPSPEWFKGRC--NGQTGMFPSNYVKPAFSGS 124
            +A+Y F      +L +K GD I ++ ++ S +W+       G+ G+ P+ +V+   SGS
Sbjct: 415 AKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVETRGSGS 474

Query: 125 S 125
           S
Sbjct: 475 S 475

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +A+Y +  Q   +L +K GD + ++EK S  +W+  K R  G       G+ P  Y++ A
Sbjct: 9   QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 68  VEAIYPFEPQQQGDLALKPGDKIEVIE-KPSPEWFKGRCNGQTGMFPSNYVK 118
           +E ++ +  Q   ++++  GD + VI+      W  G  NG  G+ P++Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein
           implicated in polar growth, functionally redundant with
           Boi2p; interacts with bud-emergence protein Bem1p;
           contains an SH3 (src homology 3) domain and a PH
           (pleckstrin homology) domain
          Length = 980

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKP---SPEWFKGR--CNGQTGMFPSNYVK 118
           A+  +  + + +L +KPGDKI+VI      +  W+ GR     + G++P+ + K
Sbjct: 20  AVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}
           SHO1Transmembrane osmosensor involved in activation of
           the Cdc42p- and MAP kinase-dependent filamentous growth
           pathway and the high-osmolarity glycerol response
           pathway; phosphorylated by Hog1p; interacts with Pbs2p,
           Msb2p, Hkr1p, and Ste11p
          Length = 367

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 69  EAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118
           +A+YP++       +++ +  + ++V +     W   R NG+TG+ PSNYV+
Sbjct: 306 KALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 357

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFPSNYVK 118
           AI  +  + + +L +KPGDKI+VI   ++ +  W+ GR     + G++P  + +
Sbjct: 43  AINEYTKRMEDELDMKPGDKIQVITDDQEYNDGWYYGRNLRTNEEGLYPKVFTQ 96

>Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER114C
           (BOI2) - involved in bud formation, has SH3 domain
           [contig 33] FULL
          Length = 1014

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 71  IYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFPSNYVK 118
           I  +  + + +L +KPGDKI+VI   E+ +  W+ GR     + G++P  + +
Sbjct: 42  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQ 94

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 9/67 (13%)

Query: 66  EFVEAIYPFEPQQQGDLA-LKPGDKIEVIEKPSPEWFKGRC--------NGQTGMFPSNY 116
           E+ +A+YP    +   LA    GD I + E  + +WFKG          + + G+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 117 VKPAFSG 123
           ++    G
Sbjct: 661 IQLLHQG 667

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +A++ +EPQ   +LA+  GD + +++K    +W+  K R  G       G+ P+NY++ A
Sbjct: 9   KAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 69  EAIYPFEPQQQGDLALKPGDKIEVIEKPS-PEWF--KGRCNGQ-----TGMFPSNYVKPA 120
           +AIY +EPQ   +L ++  D + V+EK    +W+  K R  G       G+ P+NY++ A
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGRC--NGQTGMFP 113
            I  +  +   +L +KPGDKI+VI   E+ +  W+ G+    G+ G++P
Sbjct: 54  VINEYTKRMDDELDMKPGDKIQVITDDEEYNDGWYFGKNLRTGEEGLYP 102

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 66  EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQT-------GMFPSNYV 117
           + V  +Y F P     L L+  + + V+ KP+  W+ G    ++       G FP  +V
Sbjct: 61  DIVRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTFV 119

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYV 117
           A+Y FEP+   +L L  G+ + +  K    W   +     +TG+ P  +V
Sbjct: 117 ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.344
           YDR162C
          Length = 270

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWF--KGRCNGQTGMFPSNYV 117
           A+Y FEP+   +L LK  D + +  K    W   +     +TG+ P  +V
Sbjct: 141 ALYDFEPENDNELELKEEDVVYISYKHGQGWLVAENEQRTKTGLVPEEFV 190

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQ--TGMFPSNYV 117
           A+Y F P+   +L L+ GD + +  K    W      G+  TG+ P  +V
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV 156

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRC--NGQTGMFPSNYV 117
           A Y +E  +  +L  +  ++I  I+    +W+ G    +G+ G+FPSNYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118c SSU81
          Length = 353

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 68  VEAIYPFEPQQQG--DLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYV 117
           V+A+Y +E       +++ + G+ + V +     W   + +G+TG+ PSNYV
Sbjct: 293 VKALYSYEADSADAYEMSFEQGEILMVSDIEGRWWKAKKESGETGIIPSNYV 344

>Smik_5.259 Chr5 complement(399447..402572) [3126 bp, 1041 aa] {ON}
           YER114C (REAL)
          Length = 1041

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 70  AIYPFEPQQQGDLALKPGDKIEVI---EKPSPEWFKGR--CNGQTGMFP 113
           AI  +  + + +L +KPGDKI+VI   E+    W+ GR     + G++P
Sbjct: 50  AINEYFKRMEDELDMKPGDKIKVITDDEEYKDGWYFGRNLRTNEEGLYP 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,113,749
Number of extensions: 925156
Number of successful extensions: 2872
Number of sequences better than 10.0: 276
Number of HSP's gapped: 2785
Number of HSP's successfully gapped: 331
Length of query: 237
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 131
Effective length of database: 41,326,803
Effective search space: 5413811193
Effective search space used: 5413811193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)