Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035903.500ON1401407189e-99
YPR153W3.500ON1401405557e-74
Skud_16.4473.500ON1401405548e-74
Suva_16.4813.500ON1391395541e-73
Smik_16.4053.500ON1391395358e-71
CAGL0L08382g3.500ON1401405271e-69
TDEL0D056803.500ON1401405062e-66
KNAG0A079803.500ON1471404942e-64
SAKL0F02508g3.500ON1401334811e-62
TBLA0C045203.500ON1401334783e-62
TPHA0A057103.500ON1411384697e-61
ZYRO0D09724g3.500ON1391284653e-60
Kpol_480.93.500ON1411354412e-56
KLTH0G02354g3.500ON1401344306e-55
KAFR0G037303.500ON1441354264e-54
KLLA0E03895g3.500ON1401403839e-48
AFR319W3.500ON1411302813e-32
Kwal_47.189033.500ON113441298e-10
CAGL0F03443g8.832ON31278720.33
NDAI0G009903.485ON105456671.4
KNAG0B008603.485ON108852671.6
CAGL0B02211g5.113ON212483652.6
NCAS0E009503.485ON105256652.7
TDEL0D03250singletonON45657634.9
KAFR0C019103.485ON102056627.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03590
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   281   9e-99
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   218   7e-74
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   218   8e-74
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   218   1e-73
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   210   8e-71
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   207   1e-69
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   199   2e-66
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   194   2e-64
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   189   1e-62
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   188   3e-62
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   185   7e-61
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   183   3e-60
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   174   2e-56
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   170   6e-55
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   168   4e-54
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   152   9e-48
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   112   3e-32
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    54   8e-10
CAGL0F03443g Chr6 complement(339175..340113) [939 bp, 312 aa] {O...    32   0.33 
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...    30   1.4  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...    30   1.6  
CAGL0B02211g Chr2 complement(206410..212784) [6375 bp, 2124 aa] ...    30   2.6  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...    30   2.7  
TDEL0D03250 Chr4 (608173..609543) [1371 bp, 456 aa] {ON}               29   4.9  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    28   7.3  

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  281 bits (718), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA
Sbjct: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
           AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC
Sbjct: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120

Query: 121 AVAQILFDVIMAYSSVSGIL 140
           AVAQILFDVIMAYSSVSGIL
Sbjct: 121 AVAQILFDVIMAYSSVSGIL 140

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  218 bits (555), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 118/140 (84%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           MRSF+TNNDIP+GY+TPKFPSLYWPINN KY+  FLY ISDIWKF+LYWTLIFN AFY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
           AG+ AS +HR+  G +WI V+Y+ + GVQGL  GT+MGFLIGAIY +GLF+MSTW+PLCC
Sbjct: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120

Query: 121 AVAQILFDVIMAYSSVSGIL 140
           AV QILFDV+++YS V  ++
Sbjct: 121 AVVQILFDVVLSYSMVGSVM 140

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  218 bits (554), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 99/140 (70%), Positives = 118/140 (84%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           MRSF+TNNDIP+GY+TPKFPSLYWPIN+ +Y+I FLY ISDIWKF+LYWTLIFN AFY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
            GL AS +HR+ GG IWI V+Y+ + GVQGL  GT+MGFLIGAIY +GLF+MSTWIPLCC
Sbjct: 61  TGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCC 120

Query: 121 AVAQILFDVIMAYSSVSGIL 140
           AV QILFDVI+ YS +  ++
Sbjct: 121 AVVQILFDVILGYSMIGSVM 140

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  218 bits (554), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%)

Query: 2   RSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAA 61
           RSFITNNDIP+GYITPKFPSLYWPIN+ +Y+  FLY ISDIWKF+LYWTLIFN AFY AA
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 62  GLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCA 121
           GL AS +HR+  G IWI V+Y+ F GVQGL  GTIMGFLIGAIY +GLF+MSTWIPLCCA
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VAQILFDVIMAYSSVSGIL 140
           V QILFDV++ YS +  I+
Sbjct: 121 VVQILFDVVLGYSMIGSIM 139

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  210 bits (535), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%)

Query: 2   RSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAA 61
           RSF+TNNDIP+GY+TPKFPSLYWPINN +Y+  FLY ISDIWKF+LYWTLIFN AFY   
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 62  GLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCA 121
           GL AS +HR+  G +WI  +Y+ + GVQGL  GT+MGFLIGAIY +GLF+MSTWIPLCCA
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VAQILFDVIMAYSSVSGIL 140
           V QILFDV++ YS V  ++
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  207 bits (527), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 95/140 (67%), Positives = 115/140 (82%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           M+SFIT+ D+PIGY TP FPSLYWPIN+++YD  FLY I DIWKFTLYWT IFN AFYG 
Sbjct: 1   MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGG 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
           AGL AS +H + GGG+WI  IY+ +AGVQG+ +GT+MGFLIGAIY +GLF+MSTW+P+CC
Sbjct: 61  AGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCC 120

Query: 121 AVAQILFDVIMAYSSVSGIL 140
           AV QIL DV M+YS V  I+
Sbjct: 121 AVVQILLDVTMSYSMVGSIM 140

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  199 bits (506), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 113/140 (80%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           MRSFITNND+PIGY+TP FPSL+WPI+N K+ +  LY++  IWKFTLYW+LIFN AFYG 
Sbjct: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
           AGL AS+SHRR  GG+WIM IYL + G+Q +A GT++GFLIG+IY AGLF+MSTWIP CC
Sbjct: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120

Query: 121 AVAQILFDVIMAYSSVSGIL 140
            + QILFD  ++Y S   I+
Sbjct: 121 VIVQILFDFSVSYLSSGTIM 140

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  194 bits (494), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 111/140 (79%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           +R+F+ NN+IP+GY TP FPSLYWPI+N+ Y + FLYNI DIWKFT+YW LI N AFYG 
Sbjct: 8   LRTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGT 67

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
           +GL+A+ SH +    I I+ +YL +AG+QG+ +G I G L+GAIY AGLF MSTWIPLCC
Sbjct: 68  SGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCC 127

Query: 121 AVAQILFDVIMAYSSVSGIL 140
           AVAQILFDV+M+YS V  +L
Sbjct: 128 AVAQILFDVVMSYSHVGSLL 147

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  189 bits (481), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 108/133 (81%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           M+SF+T  D+P+GY+TP FPSLYWP+NN+K+ +++LY  SDIW+FT+YWTLI  A FYG+
Sbjct: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
           AGL+AS+SHR+T GGIWIM  YL   G+Q +A GT++G LI  IY AGLFAMSTW+PL C
Sbjct: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120

Query: 121 AVAQILFDVIMAY 133
           A+ QILF+V  +Y
Sbjct: 121 ALMQILFNVSTSY 133

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  188 bits (478), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           M+SFITNNDIP+GY+TP FPSLYWPINN+KY+ +FLY+ +DIWKF++YW +I N  FYG 
Sbjct: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
            G +A  SHR   G IWI+ IYL    VQG+  GTIMG++I AIY +GLF MSTWIP CC
Sbjct: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120

Query: 121 AVAQILFDVIMAY 133
           AV QILFDV+ ++
Sbjct: 121 AVVQILFDVVQSF 133

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  185 bits (469), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%)

Query: 3   SFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAAG 62
           +F+T+ND+P+GY+TP FPSLYWPINN KY+  +LY+   IW FT+YW+LI N  FYG AG
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 63  LLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCAV 122
            LA F+HR+ GGG WI+ IYL   GVQG+ +GTI+G++I A Y + LF+MSTWIPLCCAV
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 123 AQILFDVIMAYSSVSGIL 140
           AQ+LF+V  +YS V  ++
Sbjct: 124 AQVLFEVTTSYSLVGNLM 141

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  183 bits (465), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 83/128 (64%), Positives = 102/128 (79%), Gaps = 1/128 (0%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           MRSFIT ND+P+GY TP FPSLYWP  ++   +  +Y++S IWKFTLYW+LIFN  FY  
Sbjct: 1   MRSFITTNDVPVGYETPSFPSLYWPTESRT-SLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
            GL ASFSHR+  GG+WIM +Y T+ GVQG+A+GTI GFLIG IY +GLF+MSTWIP CC
Sbjct: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119

Query: 121 AVAQILFD 128
           AVAQ+L+D
Sbjct: 120 AVAQVLYD 127

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  174 bits (441), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 105/135 (77%), Gaps = 1/135 (0%)

Query: 1   MRS-FITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYG 59
           MRS F+T+ DIP+GY  P FPSLYWPI++KKY +++LY+   IW+FT+YW++I N  FY 
Sbjct: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60

Query: 60  AAGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLC 119
            +GL+AS++HR+  GG+WIMVIYL     QG+  GT+ G+L+  IY +GLFAMSTWIPLC
Sbjct: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120

Query: 120 CAVAQILFDVIMAYS 134
           CA+ Q+LFD+  ++S
Sbjct: 121 CAITQVLFDLCSSFS 135

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  170 bits (430), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 79/134 (58%), Positives = 96/134 (71%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           M+SF+T  D+PIGY TPKFPSL+WPINNK+Y +++LY  +DIWKFT++WTLI    FY A
Sbjct: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
           AGL AS SHR+   G+WIM  Y+   G Q LA GT+ G ++   Y AGLF MSTWIPLC 
Sbjct: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120

Query: 121 AVAQILFDVIMAYS 134
           AV  ILF V   YS
Sbjct: 121 AVVLILFHVSTTYS 134

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  168 bits (426), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 102/135 (75%), Gaps = 1/135 (0%)

Query: 7   NNDIPIGYITPKFPSLYWPIN-NKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAAGLLA 65
              +PIGYITPKFPSLYWPI  ++ +D  FLY++ DIWKFTLYW+LIFN AFY +AG +A
Sbjct: 10  EQSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVA 69

Query: 66  SFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCAVAQI 125
             + ++    + I   Y  F G+QG+ +GT+MGFL+G IY AGLF MS WIP+CCAVAQI
Sbjct: 70  CLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQI 129

Query: 126 LFDVIMAYSSVSGIL 140
           L+DV+++YS+V  I+
Sbjct: 130 LYDVLVSYSTVGRIM 144

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  152 bits (383), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (67%)

Query: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60
           M++F    D+P+GY  P FPSLYWP+NN K+ + +LY + DIW+FT++WT+I  A  YG 
Sbjct: 1   MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGT 60

Query: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120
            G +A  +H++   G W++ +Y+     Q    GT++G LI  IY AGLFAMSTWIPLCC
Sbjct: 61  TGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCC 120

Query: 121 AVAQILFDVIMAYSSVSGIL 140
           AV QILF+V  +YS  S I+
Sbjct: 121 AVVQILFNVSTSYSMTSPII 140

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  112 bits (281), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 79/130 (60%), Gaps = 1/130 (0%)

Query: 11  PIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAAGLLASFSHR 70
           P GYI+P FPSL W  +++  +   LY   DI +FT++WTLI     YGA GL+A +SHR
Sbjct: 13  PAGYISPSFPSLLWTADDRA-NGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71

Query: 71  RTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCAVAQILFDVI 130
           R  GG+ I+ IYL    +  +  GT  G +  AIY A L AMSTWIPL  AV Q L+ + 
Sbjct: 72  RITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131

Query: 131 MAYSSVSGIL 140
            A+ + S ++
Sbjct: 132 AAFVAQSKLI 141

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 54.3 bits (129), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 30/44 (68%)

Query: 57  FYGAAGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFL 100
           FY AAGL AS SHRRT GG+WIM  Y+   G Q +A GT+ G +
Sbjct: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

>CAGL0F03443g Chr6 complement(339175..340113) [939 bp, 312 aa] {ON}
           similar to uniprot|Q03530 Saccharomyces cerevisiae
           YMR274c RCE1 modulator of RAS2P
          Length = 312

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 20  PSLYWPINN--KKYDITFLYNISDIWKFTLYWTLIFNAAFYGAAGLLASFSHRRTGGGIW 77
           PSL++ I +    Y+ T + N S     ++    +F  A+ G  G   +F   RTGG +W
Sbjct: 182 PSLFFSIAHIHHAYEATLVGNFSTT---SIIINTLFQMAYTGIFGAFTNFVFLRTGGNLW 238

Query: 78  IMVIYLTFAGVQGLAMGT 95
             ++  +F  V G   G+
Sbjct: 239 SCILLHSFCNVMGFPSGS 256

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1054

 Score = 30.4 bits (67), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 79  MVIYLTFAGVQGLAMGTIMGF-----LIGAIYGAGLFAMSTWIPLCCAVAQILFDV 129
           M+  LTF  +  L +G I+GF     LIG I G G F + T I +   VA+  + +
Sbjct: 341 MLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTI 396

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1088

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 83  LTFAGVQGLAMGTIMGF-----LIGAIYGAGLFAMSTWIPLCCAVAQILFDV 129
           LTF  +  L +G ++GF     LIG I G G F + T I +C  +A+  + +
Sbjct: 362 LTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSI 413

>CAGL0B02211g Chr2 complement(206410..212784) [6375 bp, 2124 aa] {ON}
            similar to uniprot|P50077 Saccharomyces cerevisiae
            YGR217w CCH1
          Length = 2124

 Score = 29.6 bits (65), Expect = 2.6,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 9/83 (10%)

Query: 35   FLYNISDIWKFTLYWTLIFNAAFYGAAGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMG 94
            FLYNI+ + K  +Y+ +      Y    +L S +++  G G+    +Y  F+    L   
Sbjct: 1573 FLYNIA-VEKNNIYYAIFLQTVTYIHIIMLLSLTYKDHGSGLLYSQVYFMFSTTVFLLQE 1631

Query: 95   TIMGFLIGAIYGAGL--FAMSTW 115
                     +YGAGL  + M+ W
Sbjct: 1632 LFH------VYGAGLRIYKMNKW 1648

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1052

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 79  MVIYLTFAGVQGLAMGTIMGF-----LIGAIYGAGLFAMSTWIPLCCAVAQILFDV 129
           M+  LTF  +  L +G I+GF     LIG I G G F + T I +   VA+  + +
Sbjct: 336 MLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSI 391

>TDEL0D03250 Chr4 (608173..609543) [1371 bp, 456 aa] {ON} 
          Length = 456

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 11/57 (19%)

Query: 44  KFTLYWTLIFNAAFYGAAGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFL 100
           KFTL+ T+     F GAA LLA+FS +     +W   IYLT    QGL +   + FL
Sbjct: 92  KFTLHLTIALGIVFQGAALLLAAFSKK-----LW--QIYLT----QGLLISFGLAFL 137

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 28.5 bits (62), Expect = 7.3,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 79  MVIYLTFAGVQGLAMGTIMGF-----LIGAIYGAGLFAMSTWIPLCCAVAQILFDV 129
           M   LTF  +  L +G I+GF     LIG I G G F + T I +   +A+  + +
Sbjct: 317 MFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSL 372

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.145    0.478 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,824,794
Number of extensions: 596012
Number of successful extensions: 1708
Number of sequences better than 10.0: 38
Number of HSP's gapped: 1704
Number of HSP's successfully gapped: 38
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 60 (27.7 bits)