Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035803.498ON41341319040.0
KNAG0A079703.498ON3883994723e-54
YPR152C (URN1)3.498ON4653684391e-48
CAGL0L08404g3.498ON4104164167e-46
NDAI0B059003.498ON5222553587e-37
Skud_16.4463.498ON4561852961e-28
Kpol_480.113.498ON4632322908e-28
Smik_16.4043.498ON4602162872e-27
TPHA0A056903.498ON4782442792e-26
Suva_16.4803.498ON4521522731e-25
TDEL0D056603.498ON4422382712e-25
AFR317C3.498ON3282232611e-24
Kwal_47.188953.498ON4432262651e-24
ZYRO0D09768g3.498ON4602262642e-24
Ecym_12313.498ON3292332565e-24
KAFR0G037203.498ON4092222589e-24
KLTH0G02398g3.498ON4622342492e-22
SAKL0F02552g3.498ON4782532441e-21
KLLA0E03939g3.498ON4352352093e-17
TBLA0D029303.498ON2761041405e-09
NCAS0C051102.649ON604641052e-04
Kpol_1073.42.649ON530641000.001
SAKL0G19360g2.649ON56828970.002
Ecym_33972.649ON57598970.003
Skud_11.2172.649ON58370970.003
TBLA0C009302.649ON65840960.004
YKL012W (PRP40)2.649ON58334950.004
KAFR0A002302.649ON55642950.005
Smik_11.2432.649ON57939940.005
ZYRO0E00682g2.649ON57034940.005
CAGL0L05368g2.649ON59069900.016
NDAI0G046002.649ON64731900.019
KNAG0M024702.649ON60683890.023
Kwal_14.9392.649ON56263890.024
Suva_11.2162.649ON58528870.034
KLLA0E18239g2.649ON57165870.043
TPHA0L020202.649ON58332850.064
KLTH0C00924g2.649ON56428820.16
TDEL0B074402.649ON57027760.71
ADR159C2.649ON56965741.6
KLTH0D09416g8.601ON39595713.3
Kwal_26.84798.601ON39764704.4
TDEL0A054708.601ON39567694.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03580
         (413 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   738   0.0  
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   186   3e-54
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   173   1e-48
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   164   7e-46
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   142   7e-37
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   118   1e-28
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   116   8e-28
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   115   2e-27
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   112   2e-26
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   109   1e-25
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   108   2e-25
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   105   1e-24
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   106   1e-24
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   106   2e-24
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   103   5e-24
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   103   9e-24
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   100   2e-22
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...    99   1e-21
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...    85   3e-17
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    59   5e-09
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    45   2e-04
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    43   0.001
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    42   0.002
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    42   0.003
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    42   0.003
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    42   0.004
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    41   0.004
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    41   0.005
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    41   0.005
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    41   0.005
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    39   0.016
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    39   0.019
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    39   0.023
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    39   0.024
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    38   0.034
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    38   0.043
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    37   0.064
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    36   0.16 
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    34   0.71 
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    33   1.6  
KLTH0D09416g Chr4 (779251..780438) [1188 bp, 395 aa] {ON} simila...    32   3.3  
Kwal_26.8479 s26 (802801..803994) [1194 bp, 397 aa] {ON} YPL112C...    32   4.4  
TDEL0A05470 Chr1 (959725..960912) [1188 bp, 395 aa] {ON} Anc_8.6...    31   4.5  

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/413 (88%), Positives = 365/413 (88%)

Query: 1   MNRGKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLI 60
           MNRGKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLI
Sbjct: 1   MNRGKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLI 60

Query: 61  RGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG 120
           RGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG
Sbjct: 61  RGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG 120

Query: 121 VYDDIAQDINFLKQEILNDAMXXXXXXXXXXXXXXXXXXXXXXXXQDDHTVXXXXXXXXX 180
           VYDDIAQDINFLKQEILNDAM                        QDDHTV         
Sbjct: 121 VYDDIAQDINFLKQEILNDAMELERLNAEAEEEESEKEEALPQEEQDDHTVELLNNLEEE 180

Query: 181 XXXQDVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA 240
              QDVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA
Sbjct: 181 EEEQDVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA 240

Query: 241 QLPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIP 300
           QLP            PTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIP
Sbjct: 241 QLPEDESEAEDDDYEPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIP 300

Query: 301 DRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDNDDAGSLSGEQMETR 360
           DRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDNDDAGSLSGEQMETR
Sbjct: 301 DRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDNDDAGSLSGEQMETR 360

Query: 361 ILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLRLKPPATAAELQLRTDSH 413
           ILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLRLKPPATAAELQLRTDSH
Sbjct: 361 ILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLRLKPPATAAELQLRTDSH 413

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  186 bits (472), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/399 (33%), Positives = 195/399 (48%), Gaps = 38/399 (9%)

Query: 6   LWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGG 65
           +WREY+APNG+KYY+N  T ETTW  P    KP+   + + ++   L + W L+I  +G 
Sbjct: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYTR-KPQRELSIKPQYVIPLLNAWNLVICNNGA 62

Query: 66  KLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG---VY 122
           K FY + +    L        E    ++ L+D+EK+ILLIG+ RG     YH      VY
Sbjct: 63  K-FYLNPDGDPVLTLDDADSSE----LLSLVDREKLILLIGVARG-----YHCTSGDKVY 112

Query: 123 DDIAQDINFLKQEILND--AMXXXXXXXXXXXXXXXXXXXXXXXXQDDHTVXXXXXXXXX 180
           + + ++I+FLK ++ ND   +                           +           
Sbjct: 113 NSVLEEISFLKDDLANDKAPLAEERELQEEPLETNVQSEPVPSALVSGYGSSSDGSDDEE 172

Query: 181 XXXQDV-KDRL--FHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAM 237
               D   +R+  F+LF  + LD YS WS++S KISN   + ++ DD QREE+FE+WC  
Sbjct: 173 EVPPDTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCS 232

Query: 238 KVA-QLPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIK 296
            V                 PTKYHYLS+I+   +  +   T+  DI +    LFKQY IK
Sbjct: 233 GVVDDSEDEGYSSGDDDLSPTKYHYLSQIV--AKSTVTPTTIFQDIKQEKASLFKQYGIK 290

Query: 297 QFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQ-RYGLLPGEDVDNDDAGSLSGE 355
           QF+  +RE    VS+LLFYYK+FT  ER  +F  ++++ R G +P        A S + E
Sbjct: 291 QFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVPSP---TSPADSATPE 346

Query: 356 QMETRILQWERDRQTEGNSSWDPTALE---YYVVGLREK 391
            +ET +LQ E        S   PT L+   YY + ++ K
Sbjct: 347 DIETNLLQME--------SHLPPTVLDNTVYYTLDIKTK 377

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  173 bits (439), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/368 (29%), Positives = 173/368 (47%), Gaps = 41/368 (11%)

Query: 3   RGKLWREYKAPNGRKYYYNVKTKETTWTKP-------VEEEKPEPGDNKEVKFAFELFDG 55
           RG+ W+E+K P G+KYYYN  TK++ W KP       +E    E    ++  F+ EL +G
Sbjct: 2   RGE-WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60

Query: 56  WYLLIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDR 115
           W+L+I  DG KL+++  + K +    +++       +IE +DKEK++LLIG+ RG+    
Sbjct: 61  WHLIIYNDGTKLYFND-DSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMRE 119

Query: 116 YHIKGVYDDIAQDINFL---------KQEILNDAMXXXXXXXXXXXXXXXXXXXXXXXXQ 166
             I  + +   ++I+           K EI  +A                          
Sbjct: 120 EDIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEED 179

Query: 167 DDHTVXXXXXXXXXXXXQDV----------------KDRLFHLFESFNLDVYSTWSLQSR 210
           ++               QD+                ++  F LF+ + LD +STWSLQS+
Sbjct: 180 EEEDEEEDEENEEQIVNQDISIIDDLNRIDTDDIDERNIFFELFDRYKLDKFSTWSLQSK 239

Query: 211 KISNQADYFLVHDDTQREEMFEDWCAMKVAQLPXXXXXXXXXXX------XPTKYHYLSE 264
           KI N  D++ + DDT RE +FE+WC  +                       PTKYHYL++
Sbjct: 240 KIENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTKYHYLAQ 299

Query: 265 IMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARER 324
           I+      I  DT+  DI +  + L+K Y IK++IP +R+    VS+LLFYYK F   +R
Sbjct: 300 IVANA-GTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQR 358

Query: 325 RAVFHDYV 332
           + +F D +
Sbjct: 359 KEIFCDCL 366

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  164 bits (416), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 133/416 (31%), Positives = 213/416 (51%), Gaps = 50/416 (12%)

Query: 2   NRGKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNK-EVK--FAFELFDGWYL 58
           +R KLW+EY APNG KYYYN KT+ETTWTKP  E+K E  D + E+K   AFEL  GW L
Sbjct: 4   SRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWAL 63

Query: 59  LIRGDGGKLFYDSVNEKSYLETRTKKMGENNE-KIIELMDKEKIILLIGMTRGFRDDRYH 117
           +I  DG K +Y+  NE  +    ++K+      K+I+L++K++++LLIG+ RG+R  R +
Sbjct: 64  IIFSDGSKKYYN-CNESQW----SRKISHPECLKLIDLLNKDRLLLLIGIIRGYR-CRTN 117

Query: 118 IKGVYDDIAQDINFLKQEILNDAMXXXXXXXXXXXXXXXXXXXX---------------- 161
            K + ++I +DI+F++++ +N A                                     
Sbjct: 118 AKDLVNEIREDIDFIRED-MNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKR 176

Query: 162 ---XXXXQDDHTVXXXXXXXXXXXXQDVKDRLFHLFESFNLDVYSTWSLQSRKISNQADY 218
                  + D T             QD+KD  F LF    L+ YSTW ++S K+S   ++
Sbjct: 177 DEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEF 236

Query: 219 FLVHDDTQREEMFEDWCAMKVAQLPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTV 278
           + + DD  RE +FE+WC     +              PTKYHYLS+++     ++  DT+
Sbjct: 237 YKIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANY--DLKPDTI 294

Query: 279 ADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGL 338
            +DI++  + L K+Y IK +   + E R  +S++L +YK  +  +R+ +F  Y+  R  +
Sbjct: 295 PEDIIKDKK-LIKKYRIKDYTT-KSEQRQFLSKMLAWYKHMSLEDRKQMFQTYID-RIPV 351

Query: 339 LPGEDVDNDDAGSLSGEQMETRILQWERDRQTEGNSSWDPTA---LEYYVVGLREK 391
               D+D+D     + E +E+++L+ E       N    PT+   LEYY + LR K
Sbjct: 352 GKYTDIDSD-----AQEDVESQLLELE-------NQLGIPTSENDLEYYCIDLRSK 395

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  142 bits (358), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 129/255 (50%), Gaps = 43/255 (16%)

Query: 184 QDVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFL-VHDDTQREEMFEDWCAMKVAQL 242
           Q VK   F L +   LD+YSTWS+QSR+I  +   F  + +D++REE+FEDWC  +V   
Sbjct: 253 QKVKQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHST 312

Query: 243 PXXXXXXXXXX--------------------------XXPTKYHYLSEIMYQLRDEINAD 276
                                                  PTKYHYLSE++++LRD IN  
Sbjct: 313 GLYSSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINER 372

Query: 277 TVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRY 336
           ++  DI R  + LFK Y IK +IPD++EL   VS LLFYYK+ + +ER   F +YV++ Y
Sbjct: 373 SIFQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKHY 432

Query: 337 G---LLPGEDVD-------NDDAGSLSGEQMETRILQWER------DRQTEGNSSWDPTA 380
           G    L  E+++       + DA + +   +E  ILQ E       D      ++ D   
Sbjct: 433 GEKIKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPG 492

Query: 381 LEYYVVGLREKYIGL 395
           LEYY++GLR K+  L
Sbjct: 493 LEYYIIGLRAKHSAL 507

 Score =  117 bits (294), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 93/149 (62%), Gaps = 12/149 (8%)

Query: 5   KLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNK-----------EVKFAFELF 53
           ++W+EYK PNG+KYYYN++TK++TW KP    K    ++            E KFAF+L 
Sbjct: 10  RIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLL 69

Query: 54  DGWYLLIRGDGGKLFYDSVNEKSYLETRTKKMGEN-NEKIIELMDKEKIILLIGMTRGFR 112
           + WYL++R DG K +Y++ + +S L+    K  E  +  +++ +DK  +I LIG+ RG+ 
Sbjct: 70  NEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYN 129

Query: 113 DDRYHIKGVYDDIAQDINFLKQEILNDAM 141
           D    IKG+Y++I  +I FLKQ+IL + M
Sbjct: 130 DPSIDIKGLYEEIVANIGFLKQDILTEQM 158

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 101/185 (54%), Gaps = 14/185 (7%)

Query: 185 DVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMK---VAQ 241
           D +   F LF+ + LD +STWSLQS+KI N  D++ + DD  RE  FE+WC  +    A 
Sbjct: 210 DERGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCGHEHSDSAA 269

Query: 242 LPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPD 301
                         PTKYHYL++I+ +    I  D V  DI +  + L+K Y IK+++P 
Sbjct: 270 AEASGSEDVGDVLEPTKYHYLAQILAKA-GTIPPDAVPQDIRKQQKELYKAYRIKEYVPS 328

Query: 302 RRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDNDDAGSLSGEQMETRI 361
           +RE    VS+LLFYYK F+  +R+ +F D +          D + D AG++   + E+ +
Sbjct: 329 KREQDKFVSQLLFYYKTFSLEQRKEIFQDCL---------RDHERDFAGAVKSIRRESGL 379

Query: 362 L-QWE 365
           + QW+
Sbjct: 380 ISQWQ 384

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 78/136 (57%), Gaps = 8/136 (5%)

Query: 6   LWREYKAPNGRKYYYNVKTKETTWTKP-----VEEEKPEPGDNKEVK--FAFELFDGWYL 58
           +W+E+K P G +YYYN KTK++ W  P      ++E  E     E K  F+ EL D W+L
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 59  LIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHI 118
           +I  DG K +Y+S + K +    +++       ++E +DKEK++LLIG+ RG+      +
Sbjct: 61  VICNDGTKFYYNS-DSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDV 119

Query: 119 KGVYDDIAQDINFLKQ 134
             +++ + ++IN  K+
Sbjct: 120 DKIFESLNEEINLFKK 135

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  116 bits (290), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 119/232 (51%), Gaps = 40/232 (17%)

Query: 193 LFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKV-----------AQ 241
           LFE F LD YS+W LQ +KI N  DYF + D++ REE+FE WC+ K             +
Sbjct: 237 LFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTNFEGE 296

Query: 242 LPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPD 301
                         PTK+HYL+ I+   + +I ADT+  DI   ++ LFK++ IK FI  
Sbjct: 297 DEETLTSDEEDDFEPTKFHYLAHIIS--KADIAADTIFLDIKENNKSLFKEFKIKDFIKS 354

Query: 302 RRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGL-LPG-------------EDVDND 347
           +++  A  S+LLF+YK+F   ER+ +F   + +   L +P               DVD  
Sbjct: 355 KKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIVRHIIKNDVD-- 412

Query: 348 DAGSLSGEQMETRILQWERDRQTEG---NSSWDPTALEYYVVGLREKYIGLR 396
                   ++ET++LQ E+    +    + + DP   +YY++G+++K I L+
Sbjct: 413 -----EAYEIETQLLQIEKIIGLQNMLVDLANDP---KYYILGIKDKLILLK 456

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 89/139 (64%), Gaps = 12/139 (8%)

Query: 5   KLWREYKAPNGRKYYYNVKTKETTWTKP---VEEEKPEPGDNKEVK--FAFELFDGWYLL 59
           K+W+E+ AP+GRKYYYN+K+KE+TWTKP    + EK + G ++     F F L +GW+L+
Sbjct: 4   KIWKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDRAGAPLFVFPLLNGWHLI 63

Query: 60  IRGDGGKLFYDSVNEKSYLETRTKKMGENNE-KIIELMDKEKIILLIGMTRGFRDDRYHI 118
           I   G K +Y+ V      +T +K++ +++  +++  +DK+K+ILLI + RG+    Y  
Sbjct: 64  ICVGGEKYYYNKV----LNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDY-- 117

Query: 119 KGVYDDIAQDINFLKQEIL 137
           + +YD++ ++   +  +++
Sbjct: 118 EKLYDELLKEFELISNDMM 136

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 107/216 (49%), Gaps = 18/216 (8%)

Query: 190 LFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPXXXXXX 249
            F L + + LD +STWSLQS+KI N  +++ + DDT RE +FE+WC    A+        
Sbjct: 222 FFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAK--ESDSED 279

Query: 250 XXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVV 309
                 PTKYHYL++I+ +  + I  D +  DI +  + L+K Y IK+++P +RE    V
Sbjct: 280 ESNVLEPTKYHYLAQIVAKAGN-IAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFV 338

Query: 310 SRLLFYYKRFTARERRAVFHDYVSQRY----GLLPGEDVDNDDAG--------SLSGEQM 357
           S+LLFYYK F   +R+ +F D +        G +     DN             + G  +
Sbjct: 339 SQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSI 398

Query: 358 ETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYI 393
           E  +L  E           DP    YYVVG+ EK +
Sbjct: 399 EDVLLSIENRCCVSAIVVADP---RYYVVGILEKTV 431

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 6   LWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK-------FAFELFDGWYL 58
           +W+E+K P G KYYYN  TK++ W KP  ++  +  D+ +V        FA EL DGW+L
Sbjct: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63

Query: 59  LIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHI 118
           +I  DG KL+++  + K +     ++ G     +IE +DK+K++LLIG+ RG+      I
Sbjct: 64  IICNDGTKLYFNH-DSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDI 122

Query: 119 KGVYDDIAQDINFLKQ 134
             +++ + ++I+  K+
Sbjct: 123 DKIFESLNEEIDLFKK 138

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  112 bits (279), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 123/244 (50%), Gaps = 36/244 (14%)

Query: 187 KDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPXXX 246
           K++ F LFE + L+ +STWS QS+ + +  D++L+ D++ RE++FE+WC+ K +      
Sbjct: 230 KEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSIT 289

Query: 247 X---------------------------XXXXXXXXPTKYHYLSEIMYQLRDEINADTVA 279
                                               PTKYHYLS I+ +    I+ DT+ 
Sbjct: 290 SVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKAN--ISPDTIF 347

Query: 280 DDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLL 339
            DI + ++ LFKQ+ I +FI  +R+L +  S+L+FYYK+F   +RR +F   + Q    +
Sbjct: 348 QDIKKDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAI 407

Query: 340 PGEDVDNDDA------GSLSGE-QMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKY 392
               V++ D        S++ + + ET++L+ E      G+        +YY++G+++K 
Sbjct: 408 NKHVVEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKL 467

Query: 393 IGLR 396
             L+
Sbjct: 468 ECLK 471

 Score =  105 bits (263), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 89/139 (64%), Gaps = 10/139 (7%)

Query: 5   KLWREYKAPNGRKYYYNVKTKETTWTKP---VEEEKPEPGDNKEVK-FAFELFDGWYLLI 60
           ++W+E+ APNG+KYYYN+KTK+TTW +P    E      G   E   FAF LF+ WYL+I
Sbjct: 4   RVWKEFIAPNGQKYYYNLKTKKTTWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVI 63

Query: 61  RGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG 120
              G K ++++V   S LE       E N ++++ +DK+K+ILL+G+ RGF  D Y    
Sbjct: 64  SSLGKKFYFNAVENISVLELH----DELNTQLLQSIDKQKLILLVGVARGFIYDEYL--Q 117

Query: 121 VYDDIAQDINFLKQEILND 139
           VY++I ++++F+K EI N+
Sbjct: 118 VYEEIMENLDFVKNEISNE 136

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  109 bits (273), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 87/152 (57%), Gaps = 6/152 (3%)

Query: 185 DVKDR--LFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQL 242
           DV +R   F L + + LD +STWSLQ +KI N  D++ V D   RE +FE+WCA   A  
Sbjct: 206 DVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFEEWCASASASA 265

Query: 243 PXXXXXXX--XXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIP 300
                          PTK+HYL++I+   + EI  D +  DI +  + LFK Y IK+++P
Sbjct: 266 SGNESEDEDDADLLEPTKFHYLAQIV--AKAEIAPDCIPQDIRKQQKALFKAYRIKEYVP 323

Query: 301 DRRELRAVVSRLLFYYKRFTARERRAVFHDYV 332
            +R+    VS+LLFYYK F+  +R+ +F + +
Sbjct: 324 SKRDQDRFVSQLLFYYKTFSLEQRKEIFQECL 355

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 8/141 (5%)

Query: 1   MNRGKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK-------FAFELF 53
           M R ++W+E+K P G++Y+YN  TKE+ W KP  ++     D  +V        FA EL 
Sbjct: 1   MRRNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELI 60

Query: 54  DGWYLLIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRD 113
           D W+L+I  DG K +Y+  +  S  E   +  G+    ++  +DKEK+ILLIG+ RG+  
Sbjct: 61  DDWHLIICNDGTKFYYNGESNISKYEIDEEGAGQ-CAALMNSLDKEKLILLIGVARGYNV 119

Query: 114 DRYHIKGVYDDIAQDINFLKQ 134
               ++ +++ + ++I+  K+
Sbjct: 120 REEDVEKIFESLNEEIDLFKK 140

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  108 bits (271), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 114/238 (47%), Gaps = 36/238 (15%)

Query: 186 VKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPXX 245
           +++  F L +    D YSTWS+Q+RKI     ++ + DD+ RE MFE+WC   + +    
Sbjct: 205 IRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNP 264

Query: 246 X-------------XXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQ 292
                                  P  +HYL+ I+ +    I   T+  DI   ++  FK+
Sbjct: 265 QDLVDEDNLDDDSREEEEEDELEPLPFHYLAHIVSKAN--ITPSTIFQDIKDQNKADFKK 322

Query: 293 YHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGE---------D 343
           Y IKQF+  + +    VS+LLFYYK+FT  ER+ +FHD +      +             
Sbjct: 323 YKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRS 382

Query: 344 VDNDDAGSLSGEQMETRILQWE------RDRQTEGNSSWDPTALEYYVVGLREKYIGL 395
             +++AGS     +ET++L+ E      RD +   N   DP   +YYV+G+++K I L
Sbjct: 383 TLSEEAGSNDAYAIETKLLKMENLIGLARDMEELAN---DP---KYYVLGIKDKMIEL 434

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 77/142 (54%), Gaps = 22/142 (15%)

Query: 4   GKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK--------FAFELFDG 55
           G+LW  + AP+G KYYYN++TKE+TW +P  E   E G NK  K        +A  L + 
Sbjct: 2   GRLWTTFTAPSGEKYYYNLRTKESTWKRP--ESFYEDGGNKRPKLTREPEPFYAIPLVND 59

Query: 56  WYLLIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRD-- 113
           W+L+I   GGK ++DS  E++       +  E    ++  +DK KIILL+ + RG+    
Sbjct: 60  WFLVIDDIGGKYYFDSSTEEASWTLEDPESAE----LLSTIDKNKIILLVAIARGYNTNV 115

Query: 114 -DRYHIKGVYDDIAQDINFLKQ 134
            DR     VY ++  D+  L++
Sbjct: 116 GDR-----VYQEVIDDLKALRK 132

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 108/223 (48%), Gaps = 17/223 (7%)

Query: 187 KDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA----QL 242
           K  L+ LFE   LD YS W  +S KIS  A ++ V DD  R+E+FE WCA K+A     +
Sbjct: 97  KAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNAV 156

Query: 243 PXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPDR 302
                        PT++HYL+ I+   +  +  DTV  D+ R H+ LF Q  +   I D+
Sbjct: 157 LEDGEEAEEVELVPTRFHYLAHIVS--KSTVRPDTVYSDVRREHKELFDQLEVD--ILDK 212

Query: 303 RELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDND---------DAGSLS 353
           +E R  V+ LLFYYK+  A  R  VF   +      +    ++ND         D     
Sbjct: 213 KEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQD 272

Query: 354 GEQMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLR 396
              +ET +   E+     G  S   + ++YYV+G+++K + ++
Sbjct: 273 SYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMK 315

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 6  LWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKE 45
          +W+  K+ +G+ YYYN +T ETTW KP   +  EP D +E
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKP---DAVEPSDGEE 38

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 119/226 (52%), Gaps = 22/226 (9%)

Query: 190 LFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKV---AQLPXXX 246
              LF  + +D YSTW++QSRKI +   ++ + +D  R+E+FE+WC  +    +++P   
Sbjct: 214 FISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAID 273

Query: 247 XXXXXX--------XXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQF 298
                            P++YHYL+ I+   + +I + T+  DI    + LFKQ+ IK  
Sbjct: 274 EQIISSDDEDPAIDSLEPSRYHYLAHIVS--KSKITSSTLPKDIRTDQKELFKQFRIKDS 331

Query: 299 IPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDND------DAGSL 352
           +  +RE  A +S+LLFYYKR T  +R A+F  ++  +   L     + +         SL
Sbjct: 332 L-SKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEGKKKALKKGLKNQERLSTILSTPSL 390

Query: 353 SGEQ--METRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLR 396
             E   +ET++L  E    T G++++    ++YYV+G+++K + LR
Sbjct: 391 PQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALR 436

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 82/145 (56%), Gaps = 21/145 (14%)

Query: 4   GKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK------FAFELFDGWY 57
            + WREYK P+G KYYYN+ TK++T+  P + ++ +    K  K      FA  LF+ W 
Sbjct: 2   ARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWA 61

Query: 58  LLIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIEL---MDKEKIILLIGMTRGF-RD 113
           L+I   G + FY+S       E+ T +   ++E  +EL   +D+EK++LL+G+ +GF   
Sbjct: 62  LIICNTGLRFFYNS-------ESHTSRWDLDDEASLELLAKLDREKLVLLVGVAKGFDPG 114

Query: 114 DRYHIKGVYDDIAQDINFLKQEILN 138
           DR     VY +++  I+ LK++  N
Sbjct: 115 DR----NVYQELSDSISELKEDSNN 135

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  106 bits (264), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 116/226 (51%), Gaps = 20/226 (8%)

Query: 187 KDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA--QLP- 243
           K  L+ LF  ++L+ YS W  + +KI +  D+  V DD+ RE++FE+WCA  ++  Q+  
Sbjct: 230 KKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVEP 289

Query: 244 ----XXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFI 299
                           PTKYHYL+ I+   +  I   T+  DI   ++  FK+Y+IK F+
Sbjct: 290 VDEIKSEDFDEEEDLEPTKYHYLAHIVS--KSNITPTTIFMDIKNDNKSSFKKYNIKDFL 347

Query: 300 PDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDND----------DA 349
             +++  + VS+LLFYYKR    ER+ VF   + Q  G    E++ ND          + 
Sbjct: 348 TSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQN-GKTIEENLSNDMDKVRHCLAQEI 406

Query: 350 GSLSGEQMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGL 395
            S     +ET++ + E+     GN S      +YY++G+R+K + L
Sbjct: 407 DSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLEL 452

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 80/143 (55%), Gaps = 21/143 (14%)

Query: 4   GKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK----------FAFELF 53
            ++WREY AP+GRKYYYN  TK++TW KP  E   E  +N+ VK           A EL+
Sbjct: 2   ARIWREYVAPDGRKYYYNAVTKQSTWHKP--ESLDEMDENRGVKRFKKIESKPHVALELY 59

Query: 54  DGWYLLIRGDGGKLFYD-SVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFR 112
            GW+L+I   G K +Y+   NE ++         E +  +I+ +DK K++ LIG+ RG+ 
Sbjct: 60  HGWHLVICDTGKKFYYNVETNESAW-----NLPDEGSRNLIDALDKNKLVALIGLARGYS 114

Query: 113 DDRYHIKGVYDDIAQDINFLKQE 135
               HI   Y+++  D+  L+QE
Sbjct: 115 PGGLHI---YEELVTDLVKLRQE 134

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  103 bits (256), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 117/233 (50%), Gaps = 34/233 (14%)

Query: 189 RLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPXXXXX 248
           R   LF+ + L+ YS+WSLQSRK+ +  +++ + DD  R E+FEDWC MK+A+       
Sbjct: 89  RFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSA 148

Query: 249 XXX--------------XXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYH 294
                                P K+HYLS I+   +  I   TV  D+   ++ LFK ++
Sbjct: 149 SLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVS--KSTIKPQTVFSDVKTENKLLFKNFN 206

Query: 295 IKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYV-----------SQRYGLLPGED 343
           I +  P ++E R  VS LLFYYK+ +++ER  +F + +            Q   +L  E+
Sbjct: 207 IDETHP-KQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDTKVKHEINNEDQLQQILDQEN 265

Query: 344 VDNDDAGSLSGEQMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLR 396
           + ND        ++E++++  E+      +       ++YYVVG+R+K I ++
Sbjct: 266 LPND------AYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIK 312

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  103 bits (258), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 114/222 (51%), Gaps = 21/222 (9%)

Query: 187 KDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMK-------- 238
           K +   LF+ + LD +S WS++  K+S   D++LV DD +RE++FE WC+ +        
Sbjct: 187 KAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDE 246

Query: 239 VAQLPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQF 298
            A+              PTK+HYLS+I+   + EI   T+  DI R ++ LFK+Y IK F
Sbjct: 247 EAKEGGEPEEHEERPLEPTKFHYLSQIVS--KSEIRRTTIFQDIKRQNKRLFKEYKIKDF 304

Query: 299 IPDRRELRAVVSRLLFYYKRFTARE-RRAVFHDYVSQR---YGLLPGEDVDNDDAGSLSG 354
           I   +E    VS+LLFYYK F   E R   F+D++ ++   Y  +   +  ++       
Sbjct: 305 IESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSMSDMNTLSEHIKRNDT 364

Query: 355 EQMETRILQWERDRQTEGNSSWDPTA-LEYYVVGLREKYIGL 395
             +ET +L      Q E N   D  + + YY++ L++K I L
Sbjct: 365 YAIETTLL------QIECNFPQDVLSDVRYYILDLKQKTIEL 400

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 90/139 (64%), Gaps = 17/139 (12%)

Query: 4   GKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK--FAFELFDGWYLLIR 61
            K+W+EY+APNG+KYYYN +TK+TTW      EKPE    +E++  F   L + W L+I 
Sbjct: 2   NKIWKEYRAPNGKKYYYNTETKKTTW------EKPEAAKREEIEPVFVIRLMNDWKLVIC 55

Query: 62  GDGGKLFYDSVNEKSYLETRTKKMG-ENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG 120
            +G K + D+ NE       TK++  E + ++IEL DKEK++ LIG+ RG+  +  +++ 
Sbjct: 56  NNGMKYYLDNENEP------TKELSDEESLRLIELFDKEKLVCLIGIARGYAIE--NVEK 107

Query: 121 VYDDIAQDINFLKQEILND 139
           +Y +I +++ FLK+++ N+
Sbjct: 108 IYGNIVEEVEFLKEDMKNE 126

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 112/234 (47%), Gaps = 26/234 (11%)

Query: 186 VKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKV------ 239
            K     LF+ ++LD YSTW++QS+KI +   ++ V  D +R E+FEDWC  KV      
Sbjct: 222 TKQMFTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVI 281

Query: 240 ---------AQLPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLF 290
                    +               PT+YHYL+ I+   + E+   T+  D+    + LF
Sbjct: 282 EDPAHQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVS--KAEVAPSTLPRDLRSEQKQLF 339

Query: 291 KQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPG--------E 342
           KQ+ IK+ +  +++    +S+LLFYYK  T  +R  V   ++  R  L+          E
Sbjct: 340 KQFKIKESL-GKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLE 398

Query: 343 DVDNDDAGSLSGEQMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLR 396
            V +      SG  +E+++L+ E      G S      ++YYV+G+++K   L+
Sbjct: 399 SVLSQQDLPTSGFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALK 452

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 13/134 (9%)

Query: 7   WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKE------VKFAFELFDGWYLLI 60
           WREYK P+G KYYYNV TK +T  KP + E+ +   +K       V F   L + W L +
Sbjct: 10  WREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSNDWVLSV 69

Query: 61  RGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG 120
             +G + FY S  E    E+R     E + +I+ L+DK K++LL+   RGF       + 
Sbjct: 70  CENGQRFFYKSSTE----ESRWDIEDEESLRILSLVDKNKLVLLLATARGFDIGE---RD 122

Query: 121 VYDDIAQDINFLKQ 134
           VY ++ +DIN LKQ
Sbjct: 123 VYQELLEDINNLKQ 136

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 111/253 (43%), Gaps = 44/253 (17%)

Query: 185 DVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPX 244
           D K+R   LF+ +NLD YS W  QSRKI+   D++LV + + R+++FE WC   +A    
Sbjct: 222 DAKNRFTILFDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKD 281

Query: 245 XXXXXXXXXX---------------------------------XPTKYHYLSEIMYQLRD 271
                                                       PT++HYLS I+   + 
Sbjct: 282 AISDANINENDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIIS--KS 339

Query: 272 EINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDY 331
            I   T+  DI + ++ LFK + IK  +  +++     S+LLFYYKR    +R+ +F   
Sbjct: 340 SIEQTTIFLDIKKENKALFKTFRIKSSLK-KKDQEDFASKLLFYYKRMDLEQRKLIFQKL 398

Query: 332 VSQRYGLLPGE--------DVDNDDAGSLSGEQMETRILQWERDRQTEGNSSWDPTALEY 383
           +  +  ++           D+  + +       +ET++L  E      G  S+    + Y
Sbjct: 399 LLSKLDIIRSNLRNVEKLRDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHY 458

Query: 384 YVVGLREKYIGLR 396
           Y++G+++K I L+
Sbjct: 459 YILGIKDKTIQLK 471

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 7   WREYKAPNGRKYYYNVKTKETTWTKPV----EEEKPEPGDNKEVKFAFELFDGWYLLIRG 62
           W E+  P+G KYYYN++TK++T  KP     ++ +       + K+   L  GW L++  
Sbjct: 5   WNEFTTPSGDKYYYNLETKQSTLEKPAGFDDQKSRKRQKLQHKPKYLVPLDKGWSLVLCN 64

Query: 63  DGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKGVY 122
            G K +++ +  +S+         E    +++ +DKEK++LLIG++RG+   R   + VY
Sbjct: 65  TGTKFYHNKITNESHWTLDDPCSIE----LLQQLDKEKLVLLIGISRGYYCPR---RNVY 117

Query: 123 DDIAQDINFLKQEIL 137
           D+I  D+ FLK + L
Sbjct: 118 DEIINDLKFLKDKSL 132

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 112/235 (47%), Gaps = 32/235 (13%)

Query: 185 DVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA---- 240
           +++ +   L     LD YSTWS+Q+++I +   Y+L+  + +R+E+F+ WC+ ++     
Sbjct: 201 EIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQLNNSNN 260

Query: 241 --------QLPXXXXXXXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQ 292
                                  PTKYHYL+ I+   +  I  +T+  +I + ++ LFK+
Sbjct: 261 DNENNAQDSAENSDEEDSDVTLEPTKYHYLAHIIS--KANITPETLFSNIKKENKSLFKE 318

Query: 293 YHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDY---------VSQRYGLLPGED 343
             I + +  ++E     S+++ YYKR    +R  +F            +S++   L  E+
Sbjct: 319 LEINKTLT-KKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNKLRFPPISEKLSQLMLEE 377

Query: 344 VDNDDAGSLSGEQMETRILQWERDRQTEGN--SSWDPTALEYYVVGLREKYIGLR 396
             +D        ++ET++LQ E       N  +S+    + YY++G+++K   L+
Sbjct: 378 TPSDSF------KLETQLLQLENALLILDNLQNSYMQNEIMYYILGIKDKLAALK 426

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 71/126 (56%), Gaps = 11/126 (8%)

Query: 7   WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK---FAFELFDGWYLLIRGD 63
           W+ +K P+G  YY+N ++K +T  KP E    + G  KE++   F   L + W L+I  D
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAG-MKELRVPVFCLPLRNYWNLVICKD 62

Query: 64  GGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGF--RDDRYHIKGV 121
           G K F+   N++S + ++ K   + ++ +++ +D   + LLIG+ RGF  R+DR  + G 
Sbjct: 63  GSKFFH---NDESNV-SQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDR-DVYGE 117

Query: 122 YDDIAQ 127
             D+ Q
Sbjct: 118 IRDVLQ 123

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 55/104 (52%), Gaps = 4/104 (3%)

Query: 189 RLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPXXXXX 248
           + F L +  N+D YS W L+++KIS+   ++ +  D +RE++FE WC  K+         
Sbjct: 74  QFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKLHSREEETTQ 133

Query: 249 XXXXXXXPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQ 292
                  P  YH L+E++     +I ++T+  DI + ++ + +Q
Sbjct: 134 PQLALALP--YHDLAEMICCF--DIQSNTIYKDIRKANKKMVRQ 173

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGGK 66
          WR  K  NGR YYYN+ TKE+ W +P   E     D+ + K   E   GW   +  +G  
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGSTNNDDSD-KMLLEQI-GWKSNVTNEGKV 68

Query: 67 LFYD 70
           +Y+
Sbjct: 69 YYYN 72

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 6  LWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGG 65
          +W+E K  NGR YYYN KT E+ W KPVE    +    K+        +GW +  +   G
Sbjct: 4  IWKEAKDNNGRVYYYNSKTGESRWEKPVEAPSKQEQLLKK--------NGWSIG-KSKAG 54

Query: 66 KLFY 69
          K++Y
Sbjct: 55 KIYY 58

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 19/28 (67%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVE 34
          W+E K   GR YYYN  T ETTWTKP E
Sbjct: 6  WKEAKDLQGRIYYYNTATSETTWTKPQE 33

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ADR159C
          Length = 575

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 44/98 (44%), Gaps = 12/98 (12%)

Query: 7   WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGGK 66
           W+E   P GR YYYN K  ETTW KP E E         V  A  L  GW +    DG  
Sbjct: 4   WKETIDPEGRVYYYNSKG-ETTWHKPKEMEV--------VLDAILLKQGWKVASTEDGKV 54

Query: 67  LFYDSVNEKSYLE---TRTKKMGENNEKIIELMDKEKI 101
            +Y+    +S  E    R +K  E  EK  E  +K K+
Sbjct: 55  YYYNKNTNESTWELPVVREEKKDEGGEKNEEGKEKRKV 92

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGGK 66
          W+E K  NGR YYYN  TK++TW      EKP    +K+ +   E  +GW      +G  
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTW------EKPTQLVSKQEQLLQE--NGWRAAKTAEGKV 55

Query: 67 LFYDSVNEKS 76
           +Y++   K+
Sbjct: 56 YYYNTTTRKT 65

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEV 46
          W++ K P GR YYYN+KTKE+ W  P    K   G NK +
Sbjct: 5  WKQAKDPKGRVYYYNLKTKESRWDLP----KSSTGTNKSI 40

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 16/26 (61%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKP 32
          WR  +   GR YYYNV TKE+ W  P
Sbjct: 67 WRTAQTKEGRIYYYNVDTKESRWDPP 92

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEP 40
          W+  K  +G+ YYYN  T+ET+WT P  E+K EP
Sbjct: 45 WKAAKTADGKVYYYNPTTRETSWTIPAFEKKVEP 78

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 14/68 (20%)

Query: 6  LWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELF---DGWYLLIRG 62
          +W+E K  +GR YYYN  TK++TW KP           KE+    EL    +GW      
Sbjct: 3  IWKEAKDASGRIYYYNTLTKKSTWEKP-----------KELISQEELLLRENGWKAAKTA 51

Query: 63 DGGKLFYD 70
          DG   +Y+
Sbjct: 52 DGKVYYYN 59

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 3/42 (7%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVE---EEKPEPGDNKE 45
          W+  K  +G+ YYYNVKT+E+ WT P E   EEK E   NK+
Sbjct: 43 WKTGKTKDGKTYYYNVKTRESRWTLPPEMKQEEKEEARPNKD 84

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKP---VEEEKPEPGD 42
          W+  K P GR YYYN  TK++TW KP    E ++P   D
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKPKNFAEPDQPSAND 42

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKE 45
          WR  K   G+ YYYN  T+ET+WT PV E+K +    KE
Sbjct: 45 WRAAKTKEGKVYYYNPATRETSWTIPVFEKKVQTTAKKE 83

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 21/29 (72%)

Query: 6  LWREYKAPNGRKYYYNVKTKETTWTKPVE 34
          +W+E K  NGR YYYN  TK++TW KP E
Sbjct: 3  IWKEAKDANGRVYYYNSLTKKSTWEKPKE 31

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 1  MNRGKLWREYKAPNGRKYYYNVKTKETTWTKPVE 34
          M+   LW+E K  +GR YYYN KT E+ W KP E
Sbjct: 1  MSSESLWKEAKDTSGRIYYYNAKTGESKWEKPRE 34

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 9/69 (13%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGGK 66
          W++    NG+ YYYN  TKE+ W KPVE       D  ++K   +L D  + + +   GK
Sbjct: 5  WKKATDSNGKVYYYNTVTKESRWDKPVE-------DTTDLK--QKLRDAGWNVAKTKEGK 55

Query: 67 LFYDSVNEK 75
          ++Y +V  K
Sbjct: 56 VYYYNVKTK 64

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPE 39
          W   K   G+ YYYNVKTKE+ W  P+ E+  E
Sbjct: 46 WNVAKTKEGKVYYYNVKTKESRWDNPLAEKATE 78

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
          {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%)

Query: 4  GKLWREYKAPNGRKYYYNVKTKETTWTKPVE 34
          G  WR  K   GR YYYN+ TKE+ W KP E
Sbjct: 11 GNQWRSAKDAKGRIYYYNLITKESKWEKPKE 41

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 5/45 (11%)

Query: 7   WREYKAPNGRKYYYNVKTKETTW-----TKPVEEEKPEPGDNKEV 46
           W+     +G+ YYYN+KT E+ W      K  +E+    G N++V
Sbjct: 82  WKSNVTADGKTYYYNLKTGESRWDISALIKQYKEKSQTKGQNQQV 126

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 13/83 (15%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPG-------DNKEVKFAFELFDG---- 55
          W + + P GR YY+N +T+++ W KP E E  + G         K+V+ A +   G    
Sbjct: 4  WEQARDPQGRVYYFNRETRKSQWEKPAEWEVTDDGAVAAGGAPTKKVEKATQGSSGEPVK 63

Query: 56 --WYLLIRGDGGKLFYDSVNEKS 76
            W      DG   FY+S   KS
Sbjct: 64 GTWKSAKTKDGKVYFYNSATGKS 86

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPV 33
          W+  K  +G+ Y+YN  T +++WT P 
Sbjct: 66 WKSAKTKDGKVYFYNSATGKSSWTLPA 92

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGGK 66
          W E   P GR YYYN ++ ETTW KP E          E++   E   GW      +GGK
Sbjct: 4  WNEAHDPEGRVYYYNSESGETTWDKPREL-------YSELELQLEKH-GWK-TGETEGGK 54

Query: 67 LFY 69
          L+Y
Sbjct: 55 LYY 57

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVE 34
          W+E K  NGR YYYN  TK++ W KP E
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPEE 31

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKE 45
          W+  K   G+ YYYN  T++T+WT P  ++K  P   KE
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIPAFDKKTGPIAKKE 83

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGGK 66
          W+E K P GR YYYN  T +TTW KP  EE     + K +K+      GW   +  DG  
Sbjct: 3  WQETKDPQGRVYYYN-DTGQTTWEKP--EELFTEFERKLLKY------GWKTALAEDGRV 53

Query: 67 LFYDS 71
           +Y S
Sbjct: 54 YYYKS 58

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEE 35
          W+   A +GR YYY   T ETTW  PV E
Sbjct: 43 WKTALAEDGRVYYYKSDTGETTWNVPVFE 71

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 1  MNRGKLWREYKAPNGRKYYYNVKTKETTWTKP 32
          M    LWR  K  NG+ YYYN KT  + W KP
Sbjct: 1  MGADSLWRTAKDSNGKVYYYNTKTGVSQWEKP 32

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVE 34
          W+E     GR YYYN  + ETTW KP E
Sbjct: 4  WKEANDAEGRVYYYNADSGETTWDKPRE 31

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPV 33
          W+  +   G+ YYYN  TKE+ W KP+
Sbjct: 48 WKSSRTAEGKIYYYNSITKESRWEKPI 74

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGGK 66
          W+E     GR YYYN K  E+ W KP E    E            L  GW      +G  
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKPQELFTEEE--------LVLLKHGWKSSRTAEGKI 58

Query: 67 LFYDSVNEKSYLE 79
           +Y+S+ ++S  E
Sbjct: 59 YYYNSITKESRWE 71

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 7  WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFD-GWYLLIRGDGG 65
          W+E +   GR YYYN K  ET+W KP         ++  V+    L + GW +    DG 
Sbjct: 4  WKEAQDSTGRVYYYNSKG-ETSWNKP---------NDTPVELEPRLEECGWKVATTEDGN 53

Query: 66 KLFYD 70
            +Y+
Sbjct: 54 VYYYN 58

>KLTH0D09416g Chr4 (779251..780438) [1188 bp, 395 aa] {ON} similar
           to uniprot|Q6B2A9 Saccharomyces cerevisiae YPL112C PEX25
           Peripheral peroxisomal membrane peroxin required for the
           regulation of peroxisome size and maintenance recruits
           GTPase Rho1p to peroxisomes induced by oleate interacts
           with homologous protein Pex27p
          Length = 395

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 12/95 (12%)

Query: 321 ARERRAVFHDYVSQRYGLLPGEDVDNDDAGSLSGEQMETRILQWERD-------RQTEGN 373
            +   AV H  V  R       DV N   G+L G+    +IL++  D       R   G 
Sbjct: 51  VKHSHAVHHSAVVVR-----NIDVLNHIFGTLGGKDRLAKILKYVLDLVKLFVSRSRIGI 105

Query: 374 SSWDPTALEYYVVGLREKYIGLRLKPPATAAELQL 408
           + WDP  LE+Y   L +  + L L+ PAT A++ +
Sbjct: 106 TRWDPQVLEHYSKVLAQLNLRLLLRHPATIAKIMV 140

>Kwal_26.8479 s26 (802801..803994) [1194 bp, 397 aa] {ON} YPL112C -
           Hypothetical ORF [contig 61] FULL
          Length = 397

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 7/64 (10%)

Query: 350 GSLSGEQMETRILQWERD-------RQTEGNSSWDPTALEYYVVGLREKYIGLRLKPPAT 402
           G+L G+    +IL++  D       R     + WDP  L+YY   L    + L LK P T
Sbjct: 79  GTLGGKDRLAKILKYVLDLLRLFVARSRSSITQWDPQVLQYYSKVLARFNLSLILKHPVT 138

Query: 403 AAEL 406
            +++
Sbjct: 139 ISKI 142

>TDEL0A05470 Chr1 (959725..960912) [1188 bp, 395 aa] {ON} Anc_8.601
           YPL112C
          Length = 395

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 349 AGSLSGEQMETRILQWERD-------RQTEGNSSWDPTALEYYVVGLREKYIGLRLKPPA 401
             SL+G+   T+IL++  D           G + WDPT L YY   L+   +   ++ P 
Sbjct: 87  VNSLAGKDKLTKILKYTLDLLRLLISNSRAGITKWDPTVLLYYKKVLKNFSVRSVIRHPV 146

Query: 402 TAAELQL 408
           T +++ L
Sbjct: 147 TISKILL 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,001,783
Number of extensions: 1854303
Number of successful extensions: 5109
Number of sequences better than 10.0: 53
Number of HSP's gapped: 5153
Number of HSP's successfully gapped: 90
Length of query: 413
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 301
Effective length of database: 40,638,807
Effective search space: 12232280907
Effective search space used: 12232280907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)