Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035703.496ON23023010081e-140
NDAI0B058903.496ON2782492882e-30
TDEL0D056403.496ON1241042683e-29
KNAG0A079603.496ON1771412429e-25
YPR151C (SUE1)3.496ON2061492301e-22
TPHA0D033003.496ON1961402291e-22
Suva_16.4793.496ON2121392291e-22
CAGL0L08426g3.496ON1401432232e-22
Smik_16.4033.496ON2031492212e-21
Skud_16.4453.496ON2151392222e-21
SAKL0F02618g3.496ON2531532224e-21
ZYRO0D09812g3.496ON1851652168e-21
KLLA0E03983g3.496ON1911392141e-20
Kpol_1017.43.496ON1841472062e-19
Kwal_55.212483.496ON2221391933e-17
KLTH0F14938g3.496ON2291371908e-17
TBLA0D029403.496ON71601572e-13
Ecym_12333.496ON87421423e-11
ZYRO0F07480g8.682ON236981391e-09
KNAG0J017608.682ON2581021401e-09
NDAI0K013208.682ON2581031347e-09
SAKL0H06380g8.682ON2191011321e-08
KAFR0G037103.496ON79411222e-08
Suva_16.1518.682ON2531221251e-07
AFR315C3.496ON77651152e-07
NCAS0C013108.682ON2571221223e-07
KLLA0D06061g8.682ON249991223e-07
KLTH0D11396g8.682ON2251001213e-07
Smik_6.3568.682ON2531071197e-07
Kwal_26.88288.682ON2231041171e-06
YPL159C (PET20)8.682ON2531071171e-06
Skud_16.1238.682ON2551281171e-06
CAGL0M02101g8.682ON2671051171e-06
KAFR0H023808.682ON2201061133e-06
Kpol_1013.98.682ON2611011144e-06
TDEL0A062708.682ON2421191126e-06
Kpol_1072.128.682ON222971082e-05
TPHA0G015708.682ON2551041082e-05
TPHA0D012908.682ON2181091045e-05
Skud_14.423.62ON524141910.004
Ecym_23908.682ON227101880.006
Suva_14.443.62ON525152890.007
TBLA0B038008.682ON32498870.011
KLLA0A07447g3.62ON486129830.044
YNL295W3.62ON524138810.067
NCAS0A099403.62ON49428810.083
Kwal_23.52773.62ON470125780.15
TDEL0E007103.62ON47628780.19
Smik_14.363.62ON524131770.20
SAKL0C12342g3.62ON552129760.32
ZYRO0C02244g3.62ON46028750.38
TBLA0B044508.574ON466104711.1
CAGL0H08866g6.243ON65855692.4
KLTH0G06600g5.292ON69054692.5
TDEL0F044708.321ON80948683.0
Kpol_1066.443.62ON47928683.1
Skud_10.1141.266ON60736658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03570
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...   392   e-140
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   115   2e-30
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...   107   3e-29
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...    98   9e-25
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...    93   1e-22
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...    93   1e-22
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...    93   1e-22
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    91   2e-22
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...    90   2e-21
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...    90   2e-21
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...    90   4e-21
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...    88   8e-21
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...    87   1e-20
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...    84   2e-19
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...    79   3e-17
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...    78   8e-17
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    65   2e-13
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    59   3e-11
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    58   1e-09
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    59   1e-09
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    56   7e-09
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    55   1e-08
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    52   2e-08
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    53   1e-07
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    49   2e-07
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    52   3e-07
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    52   3e-07
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    51   3e-07
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    50   7e-07
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    50   1e-06
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    50   1e-06
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    50   1e-06
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    50   1e-06
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    48   3e-06
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    49   4e-06
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    48   6e-06
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    46   2e-05
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    46   2e-05
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    45   5e-05
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    40   0.004
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    39   0.006
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    39   0.007
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    38   0.011
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    37   0.044
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    36   0.067
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    36   0.083
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    35   0.15 
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    35   0.19 
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    34   0.20 
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    34   0.32 
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    33   0.38 
TBLA0B04450 Chr2 complement(1024767..1026167) [1401 bp, 466 aa] ...    32   1.1  
CAGL0H08866g Chr8 complement(864317..866293) [1977 bp, 658 aa] {...    31   2.4  
KLTH0G06600g Chr7 (525647..527719) [2073 bp, 690 aa] {ON} simila...    31   2.5  
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...    31   3.0  
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    31   3.1  
Skud_10.114 Chr10 (205358..207181) [1824 bp, 607 aa] {ON} YJL100...    30   8.4  

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score =  392 bits (1008), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/230 (85%), Positives = 197/230 (85%)

Query: 1   MNECMDEHTGSISQPAISNMIRIATPQNIAVLPATRIRLFSTINSLLREQQQKTTASKNK 60
           MNECMDEHTGSISQPAISNMIRIATPQNIAVLPATRIRLFSTINSLLREQQQKTTASKNK
Sbjct: 1   MNECMDEHTGSISQPAISNMIRIATPQNIAVLPATRIRLFSTINSLLREQQQKTTASKNK 60

Query: 61  TKTRNYYSYHYHPSKRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKYSNNIFRK 120
           TKTRNYYSYHYHPSKRV                                 FKYSNNIFRK
Sbjct: 61  TKTRNYYSYHYHPSKRVPASQNQASAAAPEASSSTTAQTTSAPATSTTPAFKYSNNIFRK 120

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRALGSS 180
           LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRALGSS
Sbjct: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRALGSS 180

Query: 181 VSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFDEELASITIKKNKK 230
           VSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFDEELASITIKKNKK
Sbjct: 181 VSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFDEELASITIKKNKK 230

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  115 bits (288), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 118/249 (47%), Gaps = 60/249 (24%)

Query: 37  IRLFSTINSLLREQQQKTT-----ASKNKT----KTRNYYSYHYHP-------------S 74
           +RLFST+N+   +  +  T      S +KT    K R+YYSYH+ P             +
Sbjct: 28  VRLFSTLNNRTFQSHRTATNGNIVGSNSKTDPLRKKRSYYSYHHPPNTVPSSSSSSSSST 87

Query: 75  KRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKYSNNIFRKLPKVPMTRYLETKQ 134
           KR                                   +  NNIFR +PKVPMT+YLETK+
Sbjct: 88  KRRTISSPTSTSASPPPSSSSSSPTHTTISSLAPCILQ--NNIFRTMPKVPMTKYLETKE 145

Query: 135 LSKEILFAGYKPIMYPVRENPLFKLKIK-----------------------QEDAKRENG 171
           LS+++L++GY+PIMYPV+ENPLF+L +K                       QE  K+   
Sbjct: 146 LSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTTSSSSSEKKKPQQEQMKKHYD 205

Query: 172 NEKRAL---GSSVSHKYK----------GIWSTSILGLQDYPEWNNVPWNNIKNLKPFDE 218
           +E   +   G + + +Y            IWS SI+G++ YPEW  VP+N +KNLKPFD+
Sbjct: 206 DEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPEWKGVPFNIVKNLKPFDK 265

Query: 219 ELASITIKK 227
              ++ + K
Sbjct: 266 SRGTVEVMK 274

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score =  107 bits (268), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 10/104 (9%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNE 173
           ++++FR LP+VP TR+LET++LS +ILF+GY+P+MYPVRENPLF    K E       N 
Sbjct: 27  TDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPASLESNL 86

Query: 174 KRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFD 217
            R            +WST+ +GL+ +PEW+NVP   ++ L+PFD
Sbjct: 87  PRY----------DLWSTTTMGLERFPEWSNVPREVVRKLRPFD 120

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score = 97.8 bits (242), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 79/141 (56%), Gaps = 35/141 (24%)

Query: 116 NIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK-------LKIKQEDAKR 168
           ++FR+LPKVPMT+YLET++L+K+IL++GY+P+MYPVRENPLF+       +   + D + 
Sbjct: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEG 89

Query: 169 ENGNEKRA------------------LGSSVSHKYK----------GIWSTSILGLQDYP 200
             G  + +                  LG + + KY             WS S L ++ YP
Sbjct: 90  TEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYP 149

Query: 201 EWNNVPWNNIKNLKPFDEELA 221
           EW++VP + +K LKPFD  L 
Sbjct: 150 EWSSVPKHVVKGLKPFDLLLG 170

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score = 93.2 bits (230), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 77/149 (51%), Gaps = 36/149 (24%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEK--- 174
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+ K ++        NEK   
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114

Query: 175 -----------------RALGSSVSHKYKGI----------------WSTSILGLQDYPE 201
                            R  G  +S    G                 WSTS +G++ +PE
Sbjct: 115 EAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 174

Query: 202 WNNVPWNNIKNLKPFDEELASITIKKNKK 230
           W NVP   ++ LKPFD+ L      K+KK
Sbjct: 175 WKNVPPYMMRKLKPFDKALQMRLTHKSKK 203

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 74/140 (52%), Gaps = 37/140 (26%)

Query: 115 NNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK--------LKIKQEDA 166
           N+IF+ LP+VP TRYLE+ +L+ +ILF+GY+PI YPV+ENPLF+            QE  
Sbjct: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107

Query: 167 KRENG-------------NEKRALGSSVSHKYKGI----------------WSTSILGLQ 197
           ++ N                ++  G  +S    G                 WSTSI+G++
Sbjct: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167

Query: 198 DYPEWNNVPWNNIKNLKPFD 217
            YPEWNNVP   +K LKPF+
Sbjct: 168 YYPEWNNVPRRFLKTLKPFE 187

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 75/139 (53%), Gaps = 36/139 (25%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQE------------- 164
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+ K K+              
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121

Query: 165 DAKRENGNE-------KRALGSSVSHKYKGI----------------WSTSILGLQDYPE 201
           +AK    +E       +R  G  +S    G                 WSTS +G++ +PE
Sbjct: 122 EAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPE 181

Query: 202 WNNVPWNNIKNLKPFDEEL 220
           W NVP   ++ LKPFD  L
Sbjct: 182 WKNVPSYMMRKLKPFDRAL 200

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 90.5 bits (223), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 80/143 (55%), Gaps = 29/143 (20%)

Query: 111 FKYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLF------------- 157
            K  N IFRKLPKVPMTRYLE + LS+++L+ GY+PI+YP+RENPL              
Sbjct: 1   MKRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE 60

Query: 158 ---KLKIKQEDAKRE--NGNEKRALGSSVS-------HKYKGIWSTSILGLQDYPEWNNV 205
              +L+ K E+   E   G E R   S++         K K   S SI+G++ YPEW  V
Sbjct: 61  SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKV 120

Query: 206 PWNNIKNLKPFDEELASITIKKN 228
           P + +K +KP++     + +KKN
Sbjct: 121 PRDVVKRIKPYE----VMKVKKN 139

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score = 89.7 bits (221), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 76/149 (51%), Gaps = 36/149 (24%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNE---- 173
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+ K K+        +E    
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112

Query: 174 ----------------KRALGSSVSHKYKGI----------------WSTSILGLQDYPE 201
                           +R  G  +S    G                 WSTS +G++ +PE
Sbjct: 113 EAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 172

Query: 202 WNNVPWNNIKNLKPFDEELASITIKKNKK 230
           W N+P    + LKPFD+ L      K+KK
Sbjct: 173 WRNIPSYMTRKLKPFDKPLQIQLKHKSKK 201

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score = 90.1 bits (222), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 72/139 (51%), Gaps = 36/139 (25%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK------------------- 158
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+                   
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPAA 121

Query: 159 -LKIKQEDAKRENGNEKRALGSSVSHKYKGI----------------WSTSILGLQDYPE 201
             K  ++D  +     +R  G   S    G                 WSTS +G++ +PE
Sbjct: 122 EAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 181

Query: 202 WNNVPWNNIKNLKPFDEEL 220
           W NVP   ++ LKPFD+ L
Sbjct: 182 WKNVPSYMMRKLKPFDKSL 200

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score = 90.1 bits (222), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 80/153 (52%), Gaps = 37/153 (24%)

Query: 112 KYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQED------ 165
           K +++IFR LPKVP T++LE ++L+++ILF+GY+P+ YPV+ENP F +  +++       
Sbjct: 17  KKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETS 76

Query: 166 AKRENGNEK---------------RALGSSVSHKYKG----------------IWSTSIL 194
           AK+E  NE                R  G  VS    G                +WS+S +
Sbjct: 77  AKKEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTM 136

Query: 195 GLQDYPEWNNVPWNNIKNLKPFDEELASITIKK 227
            ++ YPEW NVP      LKPFD  + S+  KK
Sbjct: 137 AMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKK 169

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score = 87.8 bits (216), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 83/165 (50%), Gaps = 48/165 (29%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIK-----QEDAKR 168
           S++IFR +P+VP T++LE+++L+++ILF+GY+P+MYPV+ENPLFK + +      E   R
Sbjct: 21  SSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSR 80

Query: 169 ENGNEKRALGS----------SVSHKYKGI---------------------------WST 191
            N   ++              SV    +G                            WST
Sbjct: 81  HNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWWST 140

Query: 192 SILGLQDYPEWNNVPWNNIKNLKPFD------EELASITIKKNKK 230
           + +G++ +PEW  VP + ++ LKPFD      + L SI +  N K
Sbjct: 141 TSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILESIKVNGNPK 185

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score = 87.0 bits (214), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 36/139 (25%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRE-NGN 172
           +  ++R+LP+VP TR+L  ++L+ +ILF+GY+PI+ P+R+NPLF+ K+K+ + +RE NG 
Sbjct: 8   ATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGG 67

Query: 173 ----EKRALGSSVSHKY-------------------------------KGIWSTSILGLQ 197
                K A  S   H +                                 +WS+S +G++
Sbjct: 68  GKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGME 127

Query: 198 DYPEWNNVPWNNIKNLKPF 216
            YPEWN+VP     +LKP+
Sbjct: 128 FYPEWNDVPNKVSASLKPY 146

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score = 84.0 bits (206), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 70/147 (47%), Gaps = 44/147 (29%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK--------------- 158
           + +IFR LP+VP T++LE+  L+ +ILF+GY+PI YPV+ENPLF+               
Sbjct: 32  TEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVN 91

Query: 159 -------LKIKQEDAKRENGNE------KRALGSSVSHKYKGI----------------W 189
                    + QE  K     E       R  G   S    G                 W
Sbjct: 92  AESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWW 151

Query: 190 STSILGLQDYPEWNNVPWNNIKNLKPF 216
           STSI+G++ YPEW N+P   +K+LKP+
Sbjct: 152 STSIMGMEYYPEWKNIPRKVVKDLKPY 178

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score = 79.0 bits (193), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 72/139 (51%), Gaps = 33/139 (23%)

Query: 112 KYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK-LKIKQEDAKREN 170
           + S++IFR LPKVP T+YLE  +L+++IL++GY+P++YPV+ENPLFK    K +  + E 
Sbjct: 17  RRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEP 76

Query: 171 GNEKRALGSSVSHKYK--------------------------------GIWSTSILGLQD 198
           G++     +  S K                                   +WS++ + ++ 
Sbjct: 77  GSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLWSSTSMAMEY 136

Query: 199 YPEWNNVPWNNIKNLKPFD 217
           +PEW  VP   +  L+PF+
Sbjct: 137 HPEWLAVPRTVVNKLRPFN 155

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score = 77.8 bits (190), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 71/137 (51%), Gaps = 33/137 (24%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK------LKIKQEDAK 167
           S+ IFR LPKVP T+YLE  +L+++IL++GY+P++YPV+ENPLFK       +++ E   
Sbjct: 19  SSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGA 78

Query: 168 REN-----GNEKRALGSSVSHKYK----------------------GIWSTSILGLQDYP 200
           R++      +E  A+   +                            +WS + + ++ +P
Sbjct: 79  RKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPSKLLPYNLWSCTSMAMEYHP 138

Query: 201 EWNNVPWNNIKNLKPFD 217
           EW  VP   +  L+PF+
Sbjct: 139 EWLAVPRTVVNKLRPFE 155

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
           YPR151C
          Length = 71

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (71%), Gaps = 3/60 (5%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK---LKIKQEDAKREN 170
           S ++ R LP+VP T YLE  +L  +I F+GY+P+MYPV+ENPLF+   LK K E+  R++
Sbjct: 12  SKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKKKWEEQLRQD 71

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
           Ashbya gossypii AFR315C
          Length = 87

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (80%)

Query: 117 IFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK 158
           I R LP+VP T+YL  ++L  +I F+GY+P++YPV++NPLF+
Sbjct: 9   ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFR 50

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRALGSS 180
           LP+VP T YL  + +S +IL++GY+P+      NP  +LK  Q+     NG         
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLFL----NP-DELKTSQDGGNANNGARLYEFAMK 142

Query: 181 VSH-KYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFD 217
           +     + +W++S  G + YPEW+ VP    + LKPF+
Sbjct: 143 LEELGEQSLWTSSATGQEIYPEWDYVPMEVQRKLKPFN 180

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 55/102 (53%), Gaps = 3/102 (2%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRAL 177
           +  LP VP T+++E   +  E+L++GY+P+           L  K++ +  ++ +   + 
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYRPLFLDSTALERGLLAAKEQASFTQSASPTGST 152

Query: 178 GSSVSHKYKG---IWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
              ++ K +    IW+ S  GL+ Y EW+N+P++   +LKPF
Sbjct: 153 FYEIAMKLEDPACIWANSATGLEKYTEWDNIPYSVANSLKPF 194

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 13/103 (12%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRAL 177
           F +LPK+     L  + +S ++L++GY+P+  P   N  F      +  ++ NG+     
Sbjct: 91  FSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSF------QQGQKNNGSTLYEF 141

Query: 178 GSSVSH----KYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
              +      K   IW TS  G++ + EW+NVP + I+NLKPF
Sbjct: 142 AMKLDEFKKDKNSTIWDTSATGVETFTEWDNVPESVIRNLKPF 184

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 22/101 (21%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPI-MYPVR----ENPLFKLKIKQEDAKRENGNEKR 175
           LPK P T +L+ +++S ++ ++GY+PI + P      E+ L++  +K E           
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIFLNPASPKESESTLYEFAMKLE----------- 131

Query: 176 ALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
           ALG  +       W +S  G + Y EW+NVP   IK LKPF
Sbjct: 132 ALGDPIP------WVSSATGTEFYGEWDNVPTEVIKKLKPF 166

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
           Anc_3.496 YPR151C
          Length = 79

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 32/41 (78%)

Query: 117 IFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLF 157
           + + LP+VP T+YL+  +L  +IL+ GY+P++YP++ENPL 
Sbjct: 7   LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 21/122 (17%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRAL 177
           F  LP+VP T +L+   ++  +L++GY+PI      NP           K + G+     
Sbjct: 100 FSWLPRVPSTSHLKHSDMTTNVLYSGYRPIFI----NP------NDPKLKEDTGSTLYEF 149

Query: 178 GSSVSHKYKGI--WSTSILGLQDYPEWNNVPWNNIKNLKPFD---------EELASITIK 226
              +    + +  W +S  GL+ + EW N+P   +KNLKPF          +EL ++T K
Sbjct: 150 AMKLDDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPFHPPGEKAMDVDELTNVTAK 209

Query: 227 KN 228
            N
Sbjct: 210 AN 211

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR151C
           (SUE1)
          Length = 77

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 117 IFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK--------LKIKQEDAKR 168
            FR LP+VP T++L   ++  +ILF+ ++P+ YPV +NPL +        L    E  KR
Sbjct: 6   FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTKR 65

Query: 169 ENGNE 173
           ++G+ 
Sbjct: 66  DDGSR 70

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 30/122 (24%)

Query: 111 FKYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRE---------------NP 155
           F YS      LPKV     L   ++S +IL++GY+P+    ++               + 
Sbjct: 85  FDYST-----LPKVEPITNLRHNEISTDILYSGYRPLFLNFKDLENSSRKAEFGNSNNST 139

Query: 156 LFKLKIKQEDAKRENGNEKRALGSSVSHKYKGIW-STSILGLQDYPEWNNVPWNNIKNLK 214
           L+++ +K +D   E      A+  S S  +   W STS  G++ + EW+NVP + +KNLK
Sbjct: 140 LYEIAMKLDDLSPE------AISGSTSSNF---WHSTSATGMEVFDEWDNVPNSILKNLK 190

Query: 215 PF 216
           PF
Sbjct: 191 PF 192

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 20/99 (20%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYP---VRENPLFKLKIKQEDAKRENGNEKRAL 177
           LP+VP T ++  ++ + ++L++GY+PI+      +EN L +  +K E            L
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFAMKLE-----------KL 160

Query: 178 GSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
              V       W +S  G + + EW+NVP   IK+LKPF
Sbjct: 161 SEPVP------WVSSATGQEFFSEWDNVPSEIIKDLKPF 193

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 14/100 (14%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKR-ENGNEKRA 176
           F  LPK P T +L+ + +S  +L++GY+P +    E        KQ D+   E   +  A
Sbjct: 82  FSWLPKAPSTDHLKHRDVSTTLLYSGYRPFVLNSSEQ-------KQTDSTLYEFAMKLEA 134

Query: 177 LGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
           LG  +       W +S  G + Y EW+N+P + IK L+PF
Sbjct: 135 LGDPLP------WISSATGTEFYGEWDNIPADVIKKLRPF 168

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 24/107 (22%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMY-----PVRENP---LFKLKIKQEDAKRE 169
           F  LPKVP T +L+   ++  +L++GY+P+        ++E+    L++  +K ED    
Sbjct: 100 FSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFINPNDPKLKEDTGSTLYEFAMKLED---- 155

Query: 170 NGNEKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
                  L   +S      W +S  GL+ + EW+N+P   ++NLKPF
Sbjct: 156 -------LNEPLSP-----WISSATGLEFFSEWDNIPSELLRNLKPF 190

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 22/104 (21%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKP-IMYPVR----ENPLFKLKIKQEDAKRENGN 172
           F  LPK P T +L+ + +S  +L++GY+P ++ P      ++ L++  +K E        
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPADQKQTDSTLYEFAMKLE-------- 133

Query: 173 EKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
              +LG  +       W +S  G + Y EW+ VP + IK L+PF
Sbjct: 134 ---SLGDPLP------WISSATGTEFYGEWDGVPADVIKQLRPF 168

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 24/107 (22%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMY-----PVRENP---LFKLKIKQEDAKRE 169
           F  LP+VP T +L+   ++  +L++GY+P+        ++E+    L++  +K ED    
Sbjct: 100 FSWLPRVPSTSHLKQSDMTTNVLYSGYRPLFINPNDPKLKEDTGSTLYEFAMKLED---- 155

Query: 170 NGNEKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
                  L   +S      W +S  GL+ + EW N+P   +KNLKPF
Sbjct: 156 -------LNEPLS-----PWISSATGLEFFSEWENIPSELLKNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 33/128 (25%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMY-----PVRENP---LFKLKIKQEDAKRE 169
           F  LP+VP T +L+   ++  +L++GY+P+        ++E+    L++  +K ED    
Sbjct: 100 FSWLPRVPSTSHLKHTDMTTNVLYSGYRPLFINPNDPKLKEDTGSTLYEFAMKLED---- 155

Query: 170 NGNEKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF---------DEEL 220
                  L   +S      W +S  GL+ + EW N+P   +KNLKPF          +EL
Sbjct: 156 -------LNEPLSP-----WISSATGLEFFSEWENIPSELLKNLKPFHPPNEKALDTDEL 203

Query: 221 ASITIKKN 228
            +I  K N
Sbjct: 204 VNIIAKGN 211

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 22/105 (20%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVR------ENPLFKLKIKQEDAKRENG 171
           +  LP+V      + K +S E+L++GY+P+ + V          L++  +K E+      
Sbjct: 113 YSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGKTLYEFAMKLEEF----- 167

Query: 172 NEKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
                       +    W +S  G + Y EW+NVP + IK+LKPF
Sbjct: 168 -----------QEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPF 201

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 20/106 (18%)

Query: 111 FKYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKREN 170
           +KYS      LP+VP T  ++ KQL+ E+LF+ Y+P+                 D K ++
Sbjct: 86  YKYS-----ALPRVPSTSNMDRKQLNTELLFSAYRPL---------------SMDLKSDS 125

Query: 171 GNEKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
                 L +         W      L D+  W NVP + ++ LKPF
Sbjct: 126 STMYEFLMAPDQSTTSSPWGRPFSRLHDHRAWRNVPSHTVRKLKPF 171

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 15/101 (14%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRALGSS 180
           LPKVP T  L  +++    L++GY+PI           +  K     + +G  K  + S+
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIY----------INSKGSGKNKLSGTMKNGVNST 161

Query: 181 ---VSHKYK--GIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
              ++ K +    W +S  G++ Y EW++VP + +K+LKPF
Sbjct: 162 FYEIAMKLENPSPWMSSATGMELYSEWDHVPLDVLKDLKPF 202

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 30/119 (25%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRE-----------NPLFKLKIKQEDAKRE 169
           LP+VP T  L+ + +S ++L++GY+P+     E             L++  +K E+    
Sbjct: 96  LPRVPSTGNLKPRDMSMKVLYSGYRPLFINPDEIKTSSEGSGTGGTLYEFAMKLEE---- 151

Query: 170 NGNEKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFD--EELASITIK 226
                  LG       +  W TS  GL+ Y EW+++P    K LKPF   E+ AS  +K
Sbjct: 152 -------LGD------QSPWVTSATGLEYYREWDSIPGELQKKLKPFTAPEQAASDNVK 197

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRALGSS 180
           LPKVP  + L  + ++ +I ++G++P+     E     L+ K ED+          L S 
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTE-----LENKDEDSSTW-YEVSLTLDSP 150

Query: 181 VS-HKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
           V    +  IW++S  G++ Y EW++VP   I +L PF
Sbjct: 151 VPPSGHNSIWTSSATGMERYREWHSVPEEVINSLTPF 187

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 15/104 (14%)

Query: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRAL 177
           +  LPK P T +L + + + ++ ++GY+P+           + + Q  +++EN      +
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPL----------SIDVNQLASEQENPCTCYEI 152

Query: 178 GSSVSHKYKGI-----WSTSILGLQDYPEWNNVPWNNIKNLKPF 216
             S+    K +     W  S  G + Y EW+N+P + + NLK F
Sbjct: 153 SLSMDIVKKNLKVSTPWLFSATGSELYKEWDNIPKSVLDNLKCF 196

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLF-KLKIKQEDAKRENGNEKRALGS 179
           LPKVP T  +  ++++   L++GY+P+    ++  L   +    +DA          L +
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLLGDVNSTAQDANSSIYEFAMKL-N 153

Query: 180 SVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPFDEELASITIKKN 228
            +S      W  S  GL+ Y EW+ VP   IK LKP+D     ++IK+N
Sbjct: 154 ELSEPSP--WMMSATGLESYSEWDYVPSKVIKKLKPYD-----LSIKEN 195

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 63/141 (44%), Gaps = 40/141 (28%)

Query: 113 YSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMY-------PVRENPLF-------- 157
           + +N+   +PKV  T Y+  K++  E LFAGY+P+          +R+   F        
Sbjct: 103 FGSNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPLFLGNSSFSSDMRKGKNFHALDDGLP 162

Query: 158 ------------KLKIKQ--EDAKR----ENGNEKRALGSSVSHKYKGI--WSTSILGL- 196
                       KL +++  ED ++    EN ++K    S  SHK K +  W  SI G+ 
Sbjct: 163 NIQVIDASEKDGKLDVQEIIEDLQKTSLIENVSDKEQFSS--SHKRKPVIPWDASISGMV 220

Query: 197 -QDYPEWNNVPWNNIKNLKPF 216
             D P +  VP N I  +KPF
Sbjct: 221 YNDMP-FKYVPKNVISKMKPF 240

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 22/101 (21%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEKRALGSS 180
            P  P T +L+   ++ ++L++GY+P            L +++ D K     E ++    
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRP------------LSLRRADPK-----EAQSKIYE 131

Query: 181 VSHKYKGI-----WSTSILGLQDYPEWNNVPWNNIKNLKPF 216
           ++ + + +     W  +  G   Y EW+NVP + I+NL+P+
Sbjct: 132 LAMRLEAVEDPLPWVKNATGRVLYDEWDNVPQSVIRNLRPY 172

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 70/152 (46%), Gaps = 38/152 (25%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIM-----YP--VRENPLF--------- 157
            +N+   +PKV  T ++  K+++ E LFAGY+P+      +P  VR+   F         
Sbjct: 105 GSNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLPN 164

Query: 158 -----------KLKIKQ--EDAKRENGNE--KRALGSSVSHKYKGI--WSTSILGL--QD 198
                      KL +++  ED +R +  E       SS SHK + +  W  SI G+   D
Sbjct: 165 IQLVDASEKDGKLNVQEIIEDLQRTSLRESISNMEQSSSSHKRRPVIPWDASISGMVYND 224

Query: 199 YPEWNNVPWNNIKNLKPFDEELASITIKKNKK 230
            P + ++P N +  LKPF  +L  +  K N K
Sbjct: 225 MP-FKHIPKNVVSKLKPF--KLVRVERKSNSK 253

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKP--IMYPVRENPLFKLKIKQEDAKRENGNEKRALG 178
           LPKVP  + L+ + +   +L++GY+P  I +    +P                 E     
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPLSIDFKALNDPTNIYDPYSSPNGSSTLYEFAMQL 226

Query: 179 SSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKPF 216
            S+S  +   W +S  GL+ Y EW+++P   +K LKP 
Sbjct: 227 QSLSEIFP--WMSSAAGLEVYSEWDSIPIEVLKKLKPL 262

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 55/129 (42%), Gaps = 39/129 (30%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMY---PVREN-------PLF----KLKIKQ--- 163
           +P+VP T YL  + L  E LFAGYKP+     P+  N        LF    KLK  Q   
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLFLGNSPLESNNNDVLLDGLFSSIRKLKNAQINS 149

Query: 164 -------------EDAKRENGNEKRALGSSVSHKYKGI-WSTSILGL--QDYPEWNNVPW 207
                        +D K++N   +R     +  K   I W  SI GL   D P +  VP 
Sbjct: 150 ENNTVEIDVSDMLDDLKKDNQEYQR-----LHEKAPKIPWDASISGLVYNDEP-FKGVPR 203

Query: 208 NNIKNLKPF 216
           + +  LKPF
Sbjct: 204 SVVSKLKPF 212

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 61/138 (44%), Gaps = 36/138 (26%)

Query: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIM-----YP--VRENPLFKL------K 160
            +N+   +P+V  T Y+  K++  E LFAGY+P+      +P   R+   F         
Sbjct: 104 GSNLHLLVPRVASTDYISNKEVHTEGLFAGYRPLFLGNSGFPSDARKGKNFHELDDVLPN 163

Query: 161 IKQEDAKRENGN----------EKRALGSSV--------SHKYKGI--WSTSILGL--QD 198
           I+  DA  ++G           ++ +L  S+        SHK K +  W  SI G+   D
Sbjct: 164 IQVVDASEKDGKLNVQEIIEDLQRTSLRESIHSMEQLPSSHKRKPVIPWDASISGMVYND 223

Query: 199 YPEWNNVPWNNIKNLKPF 216
            P +  VP N I  +KPF
Sbjct: 224 MP-FKYVPKNIILKMKPF 240

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIM 148
           +PKVP T Y+ + ++  E LFAGYKP+ 
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLF 97

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 52/125 (41%), Gaps = 30/125 (24%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMY------PVREN--------PLFKLKIKQEDA 166
            PKV  T +L+  ++  E LFAG KP+        P R N         L K+K   ED+
Sbjct: 80  FPKVHSTDHLKQDEVHTEGLFAGNKPLFLGDLSPGPKRPNNALEGIFGTLTKIKRATEDS 139

Query: 167 KRENGN-------------EKRALGSSVSHKYKGIWSTSILGL--QDYPEWNNVPWNNIK 211
           K +  N             E  A  S ++ K    W  SI G+   D P + +VP   + 
Sbjct: 140 KGQEINIQSILKDLQSEDPEVPAKDSDIAEKAVIPWDASISGMVYNDEP-FKHVPRAVVS 198

Query: 212 NLKPF 216
            LKPF
Sbjct: 199 KLKPF 203

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIM 148
           LP+VP T Y+   ++  E LFAGY+P+ 
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF 102

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 36/131 (27%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLK-------------IKQEDAK 167
           +PKV  T +++ K++  E LFAGY+P+       P    K             I+  DA 
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFPSDARKGKNFHELGDVLPNIQVIDAS 170

Query: 168 RENGN----------EKRALGSSV--------SHKYKGI--WSTSILGL--QDYPEWNNV 205
            ++G            K +L  S+        SHK K +  W  SI G+   D P + +V
Sbjct: 171 EKDGKLNMQEIIEDLHKSSLRDSIHNMEQHSSSHKRKPVIPWDASISGMVYNDMP-FKHV 229

Query: 206 PWNNIKNLKPF 216
           P + +  +KPF
Sbjct: 230 PKSVVLRMKPF 240

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 53/129 (41%), Gaps = 41/129 (31%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPI------MYPVRENPLFKL-----KIK------- 162
           +P VP T Y+   ++  E LFAGYKP+      +   R + L  L     KIK       
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLFLGNSSLDEKRADVLDGLFTSLTKIKKGTSAPN 220

Query: 163 ------------QEDAKRENGNEKRALGSSVSHKYKGI-WSTSILGL--QDYPEWNNVPW 207
                       Q+D   E   EK       SHK   I W  SI G+   D P + +VP 
Sbjct: 221 GEINVQEILDDLQKDDTMETLKEK-------SHKKPVIPWDASISGMVYNDLP-FKDVPR 272

Query: 208 NNIKNLKPF 216
           N +  LKPF
Sbjct: 273 NVVGKLKPF 281

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIM 148
           +P+VP T Y+   ++  E LFAGY+P+ 
Sbjct: 58  VPRVPPTDYISAPEIQTEGLFAGYRPLF 85

>TBLA0B04450 Chr2 complement(1024767..1026167) [1401 bp, 466 aa]
           {ON} Anc_8.574 YPL095C
          Length = 466

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 11/104 (10%)

Query: 113 YSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGN 172
           +SN +F K     +TR ++      E+   GY+P   P  ENP+F    K         N
Sbjct: 305 WSNKLFSKAITQFLTRLVKVNMGELEVP-EGYEPECKPTPENPIFYTCTKS--------N 355

Query: 173 EKRALGSSVSHKYKGIWSTSILGLQDYPEW--NNVPWNNIKNLK 214
            K+A   + + ++ G+++   LG     E+     P NN++N+K
Sbjct: 356 VKKAKTLTSTIEFDGMFTAPSLGFNSALEYYREASPRNNLENIK 399

>CAGL0H08866g Chr8 complement(864317..866293) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|Q03213 Saccharomyces
           cerevisiae YMR172w HOT1
          Length = 658

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 9   TGSISQPAISNMIRIATPQNIAVLPATRIRLFSTINSL--LREQQQKTTASKNKT 61
           TG + QP     +  ATP N A+ P+  I   ++ + L  L   Q  TTAS  +T
Sbjct: 245 TGQVGQPGYDTSLNSATPNNHAMTPSNVISSSNSYSELQSLNGLQSNTTASDGRT 299

>KLTH0G06600g Chr7 (525647..527719) [2073 bp, 690 aa] {ON} similar
           to uniprot|P16603 Saccharomyces cerevisiae YHR042W NCP1
           NADP-cytochrome P450 reductase involved in ergosterol
           biosynthesis associated and coordinately regulated with
           Erg11p
          Length = 690

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 162 KQEDAKRENGNEKRALGSSVSHKYKGIWSTSILGLQDYPEWNNVPWNNIKNLKP 215
           K +D   E   +K     S++ KY  + + ++L L D  +WN+VPWN +    P
Sbjct: 384 KLKDRLNEISKDKDEFAKSITAKYLNL-ADALLYLSDGAKWNSVPWNFLAESVP 436

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 10  GSISQPAISNMIRIATPQNIAVLPATRIRLFSTINSLLREQQQKTTAS 57
           GS+    I + +++  P+ +  +  T+ +L S +NSL+ E++   T S
Sbjct: 754 GSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERLACTTS 801

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 121 LPKVPMTRYLETKQLSKEILFAGYKPIM 148
           LP+VP T  +  +++  + LFAGY+P+ 
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF 101

>Skud_10.114 Chr10 (205358..207181) [1824 bp, 607 aa] {ON} YJL100W
           (REAL)
          Length = 607

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 138 EILFAGYKPI-MYPVRENPLFKLKIKQEDAKRENGN 172
           EI ++ ++P+  YP R+ P  +L+ K+E  +REN N
Sbjct: 112 EIQYSVFRPVHAYPTRDLPYEQLRRKEEQEQRENFN 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,776,744
Number of extensions: 888935
Number of successful extensions: 3204
Number of sequences better than 10.0: 70
Number of HSP's gapped: 3238
Number of HSP's successfully gapped: 75
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 64 (29.3 bits)