Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035603.493ON1831837001e-94
NDAI0B058803.493ON1821844726e-60
Smik_16.4023.493ON1731834212e-52
YPR149W (NCE102)3.493ON1731834161e-51
Skud_16.4443.493ON1731834152e-51
KAFR0C019703.493ON1791863911e-47
NDAI0G009303.493ON1761833857e-47
CAGL0I10494g3.493ON1721843804e-46
CAGL0L08448g3.493ON1731833787e-46
TDEL0D056103.493ON1751833752e-45
KNAG0B008003.493ON1821563702e-44
KAFR0G037003.493ON1861873684e-44
YGR131W (FHN1)3.493ON1741833571e-42
Suva_16.4783.493ON1661833482e-41
TPHA0D032803.493ON1841573468e-41
Kpol_1017.63.493ON1871663414e-40
Suva_7.4193.493ON1741833405e-40
KNAG0A079503.493ON1821693372e-39
NCAS0E008003.493ON1741833334e-39
Skud_7.4423.493ON1741833231e-37
ZYRO0D09966g3.493ON1781533129e-36
TBLA0C044903.493ON1861693102e-35
Smik_6.2273.493ON1741833083e-35
TBLA0D029603.493ON1891552991e-33
KLLA0D16280g3.493ON1691832962e-33
SAKL0F02750g3.493ON1701462831e-31
KLTH0F14850g3.493ON1711842596e-28
Kwal_55.212383.493ON1701832466e-26
Ecym_12363.493ON1691562241e-22
AFR312W3.493ON1681462222e-22
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03560
         (183 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   274   1e-94
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   186   6e-60
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   166   2e-52
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   164   1e-51
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   164   2e-51
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   155   1e-47
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   152   7e-47
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   150   4e-46
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   150   7e-46
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   149   2e-45
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   147   2e-44
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   146   4e-44
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   142   1e-42
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   138   2e-41
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   137   8e-41
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   135   4e-40
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   135   5e-40
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   134   2e-39
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   132   4e-39
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   129   1e-37
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   124   9e-36
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   124   2e-35
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   123   3e-35
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   119   1e-33
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   118   2e-33
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   113   1e-31
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   104   6e-28
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...    99   6e-26
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    91   1e-22
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...    90   2e-22

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  274 bits (700), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 144/183 (78%), Positives = 144/183 (78%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
           LIDFLSSWPII              AGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           SQ             LAKMIMSAISMASNGAFGSGSFMSRRKRRS            PTI
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 181 SEV 183
           SEV
Sbjct: 181 SEV 183

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  186 bits (472), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 104/184 (56%), Positives = 120/184 (65%), Gaps = 3/184 (1%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLSKVDN LR  N IFLVL +AFIS LL+TQ + SSR+N+CMFAAAFGLLTDSFFG+A N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
           + D L+SWPI+              AGTVLAV IR HSC N RY+ SN I QGS  RCR+
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFM-SRRKRRSXXXXXXXXXXXXPT 179
           SQ             LAKMIMS I+MASNG FGSG++  SR KRR+            PT
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRT--NRSGANEVGVPT 178

Query: 180 ISEV 183
           IS+V
Sbjct: 179 ISQV 182

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  166 bits (421), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 91/183 (49%), Positives = 113/183 (61%), Gaps = 10/183 (5%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML+  DN LR  N +FLV++IA IS+LL+TQ+  SSRVNYCMFA A+G+ TDS +G+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
            I+ L+ WP++              AGTVLAVGIR HSCNN  Y++SNKI QGSG RCR 
Sbjct: 61  FIEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           +Q             LAK +MS  +M SNGAFGSGSF  RR+               PTI
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRR---------TGQVGVPTI 170

Query: 181 SEV 183
           S+V
Sbjct: 171 SQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  164 bits (416), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 112/183 (61%), Gaps = 10/183 (5%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML+  DN LR  N +FLV++I  IS+LL+TQ+  SSRVNYCMFA A+G+ TDS +G+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
            I+ L+ WP++              AGTVLAVGIR HSCNN  Y++SNKI QGSG RCR 
Sbjct: 61  FIEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           +Q             LAK +MS  +M SNGAFGSGSF  RR+               PTI
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---------TGQVGVPTI 170

Query: 181 SEV 183
           S+V
Sbjct: 171 SQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  164 bits (415), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 89/183 (48%), Positives = 111/183 (60%), Gaps = 10/183 (5%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML+  DN LR  N +FLV+ I  IS+LL+TQ+  SSRVN+CMFAAA+G+ TDS +G+ AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
             + L+ WP++              AGTVLAVGIR HSCNNR Y++SN I QGSG RCR 
Sbjct: 61  FFEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           +Q             LAK +MS  +M SNGAFGSGSF  RR+               PTI
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---------TGQVGVPTI 170

Query: 181 SEV 183
           S+V
Sbjct: 171 SQV 173

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  155 bits (391), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 110/186 (59%), Gaps = 10/186 (5%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQN-HGSSRVNYCMFAAAFGLLTDSFFGMAA 59
           ML   DN LR  N +FL++AIA  S L++TQN H +SRVNYCMFA AFGL  DS +G+ A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NLIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119
           N    L+ WP++              A T LAVGIR HSC N+ YL+SNKI++GSG RCR
Sbjct: 61  NFFQVLA-WPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119

Query: 120 VSQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGS--FMSRRKRRSXXXXXXXXXXXX 177
            +Q             +AKMIMS I++  NGAF SGS  F+SRRK+ +            
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHA------TDVGGV 173

Query: 178 PTISEV 183
           P IS+V
Sbjct: 174 PNISQV 179

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  152 bits (385), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/183 (48%), Positives = 106/183 (57%), Gaps = 7/183 (3%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS  DN LR  N +FLV+ I   S LL+TQ   +SR+NYCMF   + LLTDSFFG+ AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
             +FLS +P I              AGTVLA GIR HSCNN+ YL+ NKI QGSG RCR 
Sbjct: 61  FFEFLS-FPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           SQ             L K+ MS ISM  NGAF S +F SRR+RR+            P+I
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAF-SNTFTSRRRRRN-----GAAEVGVPSI 173

Query: 181 SEV 183
           S+V
Sbjct: 174 SQV 176

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  150 bits (380), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 110/184 (59%), Gaps = 13/184 (7%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS  DN LR  N +FL++ I   S+L++T+   SSRVN+C+FAAA+G+ TDS +G+ AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLE-SNKIIQGSGIRCR 119
             + L +WP++              AGTVLAVGIR HSCNN+RYLE   KI+QGSG RCR
Sbjct: 61  FFEPL-AWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 VSQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPT 179
            +Q             LAKMIMS +S+ SNGAFG+     RRK  +            P+
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK---LRRKHHT--------EVGVPS 168

Query: 180 ISEV 183
           IS+V
Sbjct: 169 ISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  150 bits (378), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 110/183 (60%), Gaps = 10/183 (5%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML+  DN LR  N +F+V+ I  IS L++T++  SSRVNYCMFAAA+G+ TDS +G+ AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
             + L+ WP+I              AG VLAVGIR HSCNN  Y E+NKIIQGS  RCR 
Sbjct: 61  FFEILA-WPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           SQ             LAKMIMS +++ SNGAFG+  F+ RR+  +            P++
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT-KFIRRRRNNA--------EVGVPSV 170

Query: 181 SEV 183
           S+V
Sbjct: 171 SQV 173

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  149 bits (375), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 109/183 (59%), Gaps = 8/183 (4%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML+ VDN LR  N  FLV+ +  +  L+S+++  SSRVN+CMFAAAFG++TDSF+G+ AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
           + +  + WP+I              A T LAVGIR HSC N+ YL+SN I QGS  RCR+
Sbjct: 61  IWEVFA-WPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           +Q             LAKMIMS I + +NG F S + ++ R+R+S            PTI
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKS-------AQVGVPTI 172

Query: 181 SEV 183
           S+V
Sbjct: 173 SQV 175

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  147 bits (370), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 79/156 (50%), Positives = 96/156 (61%), Gaps = 1/156 (0%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML   DN LR  N  FLV+ +AFISTL++TQ    SRVNYCMFAAA+G+ TD  +G+ AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
             + L+ WP+I              AG VLAVGIR HSC N RY E N IIQGS  RCR+
Sbjct: 61  FWEPLA-WPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGS 156
           SQ             +AKM+MS I++ASNGAF + S
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTAS 155

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  146 bits (368), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 108/187 (57%), Gaps = 5/187 (2%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLST-QNHGSSRVNYCMFAAAFGLLTDSFFGMAA 59
           ML+  DN+LR  N  F+V+ +AFI+ LL+T Q H S+RVNYCMFA AFG+LTDS +G+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NLIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119
           N  + L+ WPII              AGTVLAVGIR H+CNN  Y  SNKI++GS  RCR
Sbjct: 61  NFFEQLA-WPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

Query: 120 VSQXXXXXXXXXXXXXLAK---MIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXX 176
           V+Q             L K    IM AIS    G+  S  F SRRKRRS           
Sbjct: 120 VAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTG 179

Query: 177 XPTISEV 183
            PT+SEV
Sbjct: 180 VPTVSEV 186

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  142 bits (357), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 100/183 (54%), Gaps = 9/183 (4%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS  DN +R  N +FL+++I  IS L+ TQ   SSRVN+CMFAA +GL+TDS +G  AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
               L+ +P I              A T LAVGIRCHSC N+ YLE NKIIQGS  RC  
Sbjct: 61  FWTSLT-YPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           SQ             L K+ ++ + M  NG FGS +  SRR+ R             PTI
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARR--------QMGIPTI 171

Query: 181 SEV 183
           S+V
Sbjct: 172 SQV 174

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  138 bits (348), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 103/183 (56%), Gaps = 17/183 (9%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML+ VDN LR  N +FLV++I  IS+LL+TQ+  SSR+NYCMFA A+ ++TDS +G+ AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
             + L +WP+I              A       IR HSC N+ YL SN I QGSG RCR 
Sbjct: 61  FFEPL-AWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           +Q             LAK +MS  +M SNGAFGSGSF  RR+               PTI
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---------TGQVGVPTI 163

Query: 181 SEV 183
           S+V
Sbjct: 164 SQV 166

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  137 bits (346), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 92/157 (58%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML   DN LR  N  F V+ +  + +LL+TQN  SSRVNYC+F   F L+TD+F+G  AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
           +     +WPII              AGTVLAVG R HSC N+ YL+SN I QGS  RCR 
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSF 157
           +Q             LAK+IMS+I++ +NGA GS SF
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSF 157

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  135 bits (341), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 97/166 (58%), Gaps = 1/166 (0%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS  DN +R  N  F V+ +  I +LL+T+   SSRVNYCMF   F ++TDSF+G+ AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
           +     +WPII              AGTVL+VGIR HSC NR Y+++NKIIQGS  RCR 
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFG-SGSFMSRRKRRS 165
           +Q               K++MSAI++ SNGA G S   + RR+  +
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHT 166

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  135 bits (340), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 108/183 (59%), Gaps = 9/183 (4%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS  DN +R  N IFL+++I  +S L+S+Q   SSRVN+CMFAAA+GLLTDSF+G  AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
           L   L+ +P+I              AGT LAVGIRCHSC+N+ YL++NKI QGSG RC  
Sbjct: 61  LWSSLT-YPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           ++             L K+++S  +M  NG FG G+   RR+ R             PTI
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARR--------QMGIPTI 171

Query: 181 SEV 183
           S+V
Sbjct: 172 SQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  134 bits (337), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 99/169 (58%), Gaps = 7/169 (4%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML+  D  LR  N +FLV+ +  IS LL+TQ+  SSR+NYCMF AA+G+ TDSF+G+ AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
             + LS WP++              AG VLAVGIR HSC N  Y   NKI+QGS  RCR 
Sbjct: 61  FWEPLS-WPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGS------GSFMSRRKR 163
           +Q             LAK IMS +++ +NG FGS      GS  S+RKR
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKR 168

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  132 bits (333), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           ML   DN LR  N +FLV+ I   S LL+T+ H +SR+NYCMF  A+ L TDS +G+ AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
             D L + P +              AGTVLA GIR HSC +  Y+ SNKI QG   RCR 
Sbjct: 61  FFDIL-ALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           SQ             LAK+IMS I+M  NGAF     + RR+RR+            P+I
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQH--IGRRRRRN------AAEIGVPSI 171

Query: 181 SEV 183
           S+V
Sbjct: 172 SQV 174

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  129 bits (323), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS  DN +R  + +FL+++I  I  L+ TQ +GSSRVN+CMFAAA+GL+TDSF+G  AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
               L ++P I              A T LAVGIRCHSC N+ YLE N I QGS  RC  
Sbjct: 61  FWSSL-TYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           SQ             L K+ +S   M  NG FG  +   RR+ R             PTI
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARR--------QMGVPTI 171

Query: 181 SEV 183
           S+V
Sbjct: 172 SQV 174

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  124 bits (312), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 4/153 (2%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHG-SSRVNYCMFAAAFGLLTDSFFGMAA 59
           ML+  DN LR  N  F V+ +  +  L+ ++ HG +SRVN+CMFAAAFG++ DSF+G+ A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NL-IDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRC 118
           N+ + F  ++P+I              A T LAVGIR HSC NR YL+SNKI QGS  RC
Sbjct: 61  NIFVPF--AFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRC 118

Query: 119 RVSQXXXXXXXXXXXXXLAKMIMSAISMASNGA 151
           R +Q             L KM+MS +S+ SNGA
Sbjct: 119 REAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGA 151

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  124 bits (310), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHG-SSRVNYCMFAAAFGLLTDSFFGMAA 59
           MLS+  N LR  N  FLV+    I  L+ ++    S RVNYCMFAA F L+TDSF+ + A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NLIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119
           N      +WPI+              AGTVL+VGIR HSC N+ YL SNKI QGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 VSQXXXXXXXXXXXXXLAKMIMSAISMASNGAF-----GSGSFMSRRKR 163
           ++Q             L +++ S++ M  NG F     G  SF + R+R
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRRR 169

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  123 bits (308), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 96/183 (52%), Gaps = 9/183 (4%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS  DN +R  N +FL+++I  IS L+STQ   SSRVN+CMF AA+GL+TDS +G  AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
               L ++P I              A T LAVGIRCHSC N+ YLE NKI Q S  RC  
Sbjct: 61  FWSSL-TYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           SQ             L K+ ++A     NG FG  S   RR+ R             PTI
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARR--------QLGVPTI 171

Query: 181 SEV 183
           S+V
Sbjct: 172 SQV 174

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  119 bits (299), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 85/155 (54%), Gaps = 1/155 (0%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQN-HGSSRVNYCMFAAAFGLLTDSFFGMAA 59
           ML   DN  R FN  F V+    I  LL+T++ H SSRVNYCMF  A+GL++DSF+G+ A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NLIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119
           NL+    ++P I              AGTVLAVGIR HSC N+ Y   N IIQGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 VSQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGS 154
            +Q             L K++++ ++  + G  G 
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQ 155

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  118 bits (296), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 98/183 (53%), Gaps = 14/183 (7%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS +DN+LR  N +FL++ +  +  L++TQ+H SSRVN+ +FAA FG++ DS + + AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
            I  L +WPII              A T LAVGIR  SC N  +   NKI +GS  RCR 
Sbjct: 61  FISAL-AWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           +Q             L K I+S ++  ++GAFG+    S RK +             PTI
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS---SNRKTQ----------VGVPTI 166

Query: 181 SEV 183
           S+V
Sbjct: 167 SQV 169

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  113 bits (283), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 82/146 (56%), Gaps = 1/146 (0%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS +DN+LR  N  FLV+ +    +L++TQ+  S RVN+ +F AAF L+TDSF+ + AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
           L    + WPI+              A T LAVGIR HSC N  YL SN I QGS  RCR 
Sbjct: 61  LFSAFA-WPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISM 146
           +Q             L K+++S I++
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINV 145

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  104 bits (259), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 99/184 (53%), Gaps = 14/184 (7%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLST-QNHGSSRVNYCMFAAAFGLLTDSFFGMAA 59
           MLS +DN+LR  N  FLV+ +    +L +T + H + +VN+ +F AAFGLL DS + + A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NLIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119
           N +  L+ WP++              A T LAV IR HSC N+ YL+SN + QGS  RCR
Sbjct: 61  NFVSALA-WPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCR 119

Query: 120 VSQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPT 179
            +Q             LAK+ +S +++ S GAFG+GS  SRR                PT
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS--SRRTGN----------VGVPT 167

Query: 180 ISEV 183
           IS+V
Sbjct: 168 ISQV 171

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score = 99.4 bits (246), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/183 (35%), Positives = 99/183 (54%), Gaps = 13/183 (7%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS +DN+LR  N +FL++ +    +L +T+++ + +VN+ +FAAAFGLL D+ + + AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
            I  L+ WP++              A T LAV IR HSC N  Y+++NK+ QGS  RCR 
Sbjct: 61  FISALA-WPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGSFMSRRKRRSXXXXXXXXXXXXPTI 180
           +Q             L K+ +S +++ S GAF + S      R+S            PTI
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSS-----GRKS-------ANVGVPTI 167

Query: 181 SEV 183
           S+V
Sbjct: 168 SQV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 90.9 bits (224), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 82/156 (52%), Gaps = 1/156 (0%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS +DN+LR  N +FL++ +A   +L++ QN   SRVN+ +F A F LL DS + + AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
            I  L +WPI+              A T L   I  HSC+N  +L  N I +G   RCR 
Sbjct: 61  FISAL-AWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISMASNGAFGSGS 156
            Q             LAK ++S +++ S GAF SGS
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGS 155

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score = 90.1 bits (222), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 75/146 (51%), Gaps = 1/146 (0%)

Query: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60
           MLS +DN+LR  N +FL++ +    +L+  Q +  SRVN+ +F A F L+TDSF+ + AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  LIDFLSSWPIIXXXXXXXXXXXXXXAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120
            I    +WPII              A T L   I  HSC+NR +L+ N I + S  RCR 
Sbjct: 61  FISAF-AWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 SQXXXXXXXXXXXXXLAKMIMSAISM 146
            Q             LAK + S +++
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFSGLNI 145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,866,334
Number of extensions: 306108
Number of successful extensions: 913
Number of sequences better than 10.0: 30
Number of HSP's gapped: 892
Number of HSP's successfully gapped: 30
Length of query: 183
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 80
Effective length of database: 41,670,801
Effective search space: 3333664080
Effective search space used: 3333664080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)