Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035503.492ON44142820120.0
NDAI0B058603.492ON6813184333e-46
KNAG0A079403.492ON2752121311e-07
Smik_6.2263.492ON8391231295e-07
TPHA0D042503.492ON6291111277e-07
Skud_7.4413.492ON8071341251e-06
Suva_7.4183.492ON8311201251e-06
YGR130C3.492ON8161201251e-06
CAGL0I10516g3.492ON8131241232e-06
KLLA0D16236g3.492ON8711091115e-05
ZYRO0D09988g3.492ON994961062e-04
NDAI0G009403.492ON6562911053e-04
Kpol_480.143.492ON6991061028e-04
NCAS0E008103.492ON69289950.005
TBLA0C044803.492ON802117940.007
KAFR0G036903.492ON363189920.009
SAKL0F02772g3.492ON77342890.023
Kwal_55.212293.492ON787100890.026
KAFR0C019603.492ON56398870.037
KLTH0F14828g3.492ON83642840.098
AFR310C3.492ON62383770.65
Ecym_12373.492ON727103751.2
ZYRO0D08954gna 1ON86747689.7
NOTE: 2 genes in the same pillar as NCAS0F03550 were not hit in these BLAST results
LIST: KNAG0B00810 TDEL0D05600

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03550
         (441 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...   779   0.0  
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...   171   3e-46
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    55   1e-07
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    54   5e-07
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    54   7e-07
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    53   1e-06
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    53   1e-06
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    53   1e-06
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    52   2e-06
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    47   5e-05
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    45   2e-04
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    45   3e-04
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    44   8e-04
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    41   0.005
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    41   0.007
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    40   0.009
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    39   0.023
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    39   0.026
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    38   0.037
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    37   0.098
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    34   0.65 
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    33   1.2  
ZYRO0D08954g Chr4 (767612..770215) [2604 bp, 867 aa] {ON} some s...    31   9.7  

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/428 (90%), Positives = 388/428 (90%)

Query: 1   MITAKQRSQTIQLDQEHFDQFYDQYVTELNESRRRGTHITQFNAVENEESLTPNARFVST 60
           MITAKQRSQTIQLDQEHFDQFYDQYVTELNESRRRGTHITQFNAVENEESLTPNARFVST
Sbjct: 1   MITAKQRSQTIQLDQEHFDQFYDQYVTELNESRRRGTHITQFNAVENEESLTPNARFVST 60

Query: 61  FREPLMNNRYYANYLYHMKQQRHPSLRKYESRNPNIVTPEFLKGKEEKQKNDLFNLQMKE 120
           FREPLMNNRYYANYLYHMKQQRHPSLRKYESRNPNIVTPEFLKGKEEKQKNDLFNLQMKE
Sbjct: 61  FREPLMNNRYYANYLYHMKQQRHPSLRKYESRNPNIVTPEFLKGKEEKQKNDLFNLQMKE 120

Query: 121 QNLQRLKNSQRIITSSTARTYPQQQNIYPKVYYEHSKKRTPPTEQEQFHRGMNPPSPKYP 180
           QNLQRLKNSQRIITSSTARTYPQQQNIYPKVYYEHSKKRTPPTEQEQFHRGMNPPSPKYP
Sbjct: 121 QNLQRLKNSQRIITSSTARTYPQQQNIYPKVYYEHSKKRTPPTEQEQFHRGMNPPSPKYP 180

Query: 181 IATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQK 240
           IATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQK
Sbjct: 181 IATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQK 240

Query: 241 QIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKNRNYLQ 300
           QIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKNRNYLQ
Sbjct: 241 QIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKNRNYLQ 300

Query: 301 TXXXXXXXXXXXXXXXXXXXXXQPLGTEQAGITKAECTXXXXXXXXXXXXXXXXXXXKEQ 360
           T                     QPLGTEQAGITKAECT                   KEQ
Sbjct: 301 TEIIKLKEQEEREKEKAEGKEIQPLGTEQAGITKAECTSSISSTSSESSPSCASCHSKEQ 360

Query: 361 PGTEPIVEKSTIEPAEEKNVTEPIVEPTKGNDKEPAIEMNEESNVETKKNDRLFEISSNE 420
           PGTEPIVEKSTIEPAEEKNVTEPIVEPTKGNDKEPAIEMNEESNVETKKNDRLFEISSNE
Sbjct: 361 PGTEPIVEKSTIEPAEEKNVTEPIVEPTKGNDKEPAIEMNEESNVETKKNDRLFEISSNE 420

Query: 421 NEQGENDS 428
           NEQGENDS
Sbjct: 421 NEQGENDS 428

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score =  171 bits (433), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 188/318 (59%), Gaps = 23/318 (7%)

Query: 1   MITAKQRSQTIQLDQEHFDQFYDQYVTELN---------ESRRRGTHITQFNAVENEESL 51
           ++T+K+RS   Q DQEHFDQFYD+Y+ ++N         +S+    ++       N+E+ 
Sbjct: 183 VLTSKERSIAYQSDQEHFDQFYDRYLAQINRQQQVSQEKKSKENKQNVFSTQLRTNKENK 242

Query: 52  TPNARFVSTFREPLMNNRYYANYLYHMKQQRHPSLRKYESRNPNIVTPEFLKGKEEKQKN 111
            PN +FVS FR  L++N +Y N+L +M+ QRH S  K + +N   +TP FL   + KQ  
Sbjct: 243 KPNKQFVSQFRHNLIDNEFYENHLNYMRSQRHQSTTKNQLQNKEKITPNFLIENDSKQHR 302

Query: 112 DLFNLQMKEQNLQRLKNSQRIITSSTART---YPQQQ-----NIYPKVYYEH-SKKRTPP 162
            L ++  +E N   LKN Q+II+ S   +    P  Q      IYPKVYY++ +  + PP
Sbjct: 303 ILQDIITRETNFNHLKNLQKIISQSELESQDLTPTMQKIKDSKIYPKVYYKNFNMTKHPP 362

Query: 163 TEQEQF--HRGMNPP-SPKY-PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDA 218
              +Q   ++ + PP +P+  PIAT  NPEIL++L +++  I++K+TYD+L+++  +H  
Sbjct: 363 NINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKT-IITKQTYDKLLELNQDHAN 421

Query: 219 WLKSYNAENMANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKR 278
           W+ + N E+   YN + + YQ++++ L+E+I ++  + ++++ D L+  E+N      KR
Sbjct: 422 WMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKR 481

Query: 279 FQINKLIGEEKILLMKNR 296
           FQ+  L+  EK +L  N+
Sbjct: 482 FQLFSLLNHEKYVLNNNK 499

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 94/212 (44%), Gaps = 28/212 (13%)

Query: 99  PEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII-------TSSTARTYPQQQNIYPKV 151
           P  L   E +Q+  L +L  KEQ+L  LK SQR++            R     Q + PK+
Sbjct: 47  PAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVYIDKPVEKEDVVREPVDIQKV-PKI 105

Query: 152 YYEHSKKRTPPTEQEQFHRGMNPPSPKYPIATPQNPE--ILVQLTENQNKIVSKETYDRL 209
            Y               +   N    + P+ATP+ PE  ++ +     NK  SKE +D +
Sbjct: 106 PYSE-------------YGQCNEAEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFDNI 152

Query: 210 VQVQSEHDAWLKSYNAENMANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEI 269
            +    H+AWL S   +       + + Y KQ+ VLD++I+  +   N L     R  ++
Sbjct: 153 QRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDL 212

Query: 270 NKNKALVKRFQINKLIGEEKILLMKNRNYLQT 301
           N+N+ L K F    L+  ++    KN+ Y +T
Sbjct: 213 NENR-LTKTF----LLQTQQFTAEKNKIYKET 239

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 173 NPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYN 232
           N  +P  P+ATP+ PE++V+  E+    +SK  YD++   +  H AWL    A   A Y+
Sbjct: 414 NTAAPSNPVATPEKPELIVKTKEH--GYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYD 471

Query: 233 QRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILL 292
            +++ Y++++  L  +I   ++    +  +     E++KN+ + +   +N     +K+++
Sbjct: 472 AKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMI 531

Query: 293 MKN 295
            K+
Sbjct: 532 FKD 534

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 23/111 (20%)

Query: 171 GMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMAN 230
           G+  P   + +A+P+NPE LV+   N+  IVSK  YD++   Q  H  WLK++NA     
Sbjct: 306 GVAVPET-HAVASPENPEYLVRT--NEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEK 362

Query: 231 YNQRHQWY-------QKQIDVLDEK-------------IRYYQEMSNVLEA 261
           YN + Q Y       QKQ+D ++EK             I  YQ + NVL+ 
Sbjct: 363 YNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDV 413

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 21/102 (20%)

Query: 52  TPNARFVSTFREPLMNNRYYANYLYHMKQQRHP-------------------SLRKYESR 92
           + N  ++S FR P   +   +NY   +K+++ P                   SL K + R
Sbjct: 32  SENTEYISPFRNP--QDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKR 89

Query: 93  NPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRIIT 134
             +I  P++L   E++Q   L  LQ+KE  L  L+ S R++ 
Sbjct: 90  AKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLV 131

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 65/134 (48%), Gaps = 4/134 (2%)

Query: 162 PTEQEQFHRGMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLK 221
           PT       G+  PS   P+ATP+NPE++V+  E+    +SK  YD++   +  H AWL 
Sbjct: 373 PTSSSAQKGGVTAPS--NPVATPENPELIVKTKEH--GYLSKAVYDKINYDEKVHQAWLA 428

Query: 222 SYNAENMANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQI 281
              A+  A Y+     Y +++  L  +I   +     +  +     E++KN+ + +   +
Sbjct: 429 DLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDV 488

Query: 282 NKLIGEEKILLMKN 295
           N     +K+++ K+
Sbjct: 489 NTAHNNKKLMIFKD 502

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 64/120 (53%), Gaps = 2/120 (1%)

Query: 176 SPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRH 235
           +P  P+ATP+NPE++V+  E+    +SK  YD++   +  H AWL    A   A Y+ ++
Sbjct: 408 APLNPVATPENPELIVKTKEH--GYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKN 465

Query: 236 QWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKN 295
             Y++++  L  +I   +     L  +  +  E+NKN+ + +   IN     +K+++ K+
Sbjct: 466 TEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKD 525

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 65/120 (54%), Gaps = 2/120 (1%)

Query: 176 SPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRH 235
           +P  P+ATP+NPE++V+  E+    +SK  YD++   +  H AWL    A+    Y+ ++
Sbjct: 394 APSNPVATPENPELIVKTKEH--GYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKN 451

Query: 236 QWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKN 295
           + Y++++  L  +I   +     +  +     E++KN+ + K   +N     +K++++K+
Sbjct: 452 KEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKD 511

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 67/124 (54%), Gaps = 18/124 (14%)

Query: 179 YPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQR---- 234
           +PIATP+NPE++ +  E     +SK  YD++V  ++ H  WLK +     A Y+ +    
Sbjct: 417 FPIATPENPELIAKTEEY--GYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEY 474

Query: 235 ---HQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKR-FQINKLIGEEKI 290
               +  QK+ID+++E +   ++ +    AD + VSE N    LVK+ F+ N L  E+K 
Sbjct: 475 NNELEELQKEIDMINESMENLKKET----ADKIEVSENN----LVKKIFERNTLHNEQKN 526

Query: 291 LLMK 294
            + K
Sbjct: 527 KIFK 530

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 85  SLRKYESRNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII 133
           +L K   R  +I  P +L   E +Q+  L  L++KE  LQ LK+SQ+II
Sbjct: 144 TLDKSTKRAKDIKFPVYLTENEFRQQTILKELELKEGKLQYLKDSQKII 192

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 171 GMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMAN 230
           G   P    P+ATP++PE++V+    Q   VSK  YD+L   + +H A L  Y+ E    
Sbjct: 435 GTVVPGDDAPVATPEDPELIVR---TQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDER 491

Query: 231 YNQRHQWYQKQIDVLDEKIRYYQ-EMSNV-LE-ADYLRVSEINKNKALV 276
           Y  + Q Y+++I  +  +I     +M  V LE  + L++ ++ K++AL+
Sbjct: 492 YETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALL 540

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 10/96 (10%)

Query: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNA-------ENMANYN 232
           P+ATP+NPEILV+   ++   +SK  YD++     +H  WL  + +       E   +Y+
Sbjct: 488 PLATPENPEILVKT--DREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYD 545

Query: 233 QRHQWYQKQIDVLDEKIRYYQEMSN-VLEADYLRVS 267
            R +  +K+++ L+E ++  ++ +N ++E  + R+S
Sbjct: 546 NRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLS 581

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 123/291 (42%), Gaps = 65/291 (22%)

Query: 57  FVSTFREPLMNNRYYANYLYHMKQQRHPSLRK---YESRNP----------------NIV 97
           ++S FR  L+ N     Y+ + K +R P++     Y +R                  +I 
Sbjct: 68  YLSPFRSNLVTNN--KAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIF 125

Query: 98  TPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRIIT----------------SSTARTY 141
            P +L   E++Q+ +L  L   E++LQ  K+SQ II                 S+ A   
Sbjct: 126 FPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKQPSQSQSPSPLDDSANAEKP 185

Query: 142 PQQQNIYPK----VYYEHSKKRTPPTEQEQFHRGMNPP---SPKYPIATPQNPEILVQLT 194
           P ++ I PK    V ++ S   TPP   +     + P      + P ATP + E +V+  
Sbjct: 186 PLEKPIDPKLTPMVSFQLS---TPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKT- 241

Query: 195 ENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQKQIDVLDEKIRYYQE 254
             +  I+SK  YD+L   Q +H+ +L SY AE    Y+ + Q Y+ ++  LDEKI    E
Sbjct: 242 -KKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE 300

Query: 255 MSNVLEADYLRVSEINKNKALVKR---------------FQINKLIGEEKI 290
           +    + D     +I  N  LVKR               F   KLI  EKI
Sbjct: 301 LIEQCKKDTDAKLDI-MNAELVKRMFDERSVQTDDKMKIFSETKLIKREKI 350

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 21/106 (19%)

Query: 54  NARFVSTFREPLMNNRYYANYLYHMKQQRHPS-------------------LRKYESRNP 94
           N  +VS FR+P  +N   ANY    K +R P+                   + K   R  
Sbjct: 35  NVEYVSPFRDP--SNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAK 92

Query: 95  NIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRIITSSTART 140
           +I  P FL   E +Q   + +L++KE NL+ L+NSQ ++  +   T
Sbjct: 93  DISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENGTST 138

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 175 PSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQR 234
           P  K P+++P+NPE +++    Q+  +SK  YD++   QS H  WL +        Y  +
Sbjct: 351 PVSKNPMSSPENPEYVIKT--KQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNK 408

Query: 235 HQWYQKQIDVLDEKIRYYQEMSNVL 259
              Y+  +  +  KI    ++ + L
Sbjct: 409 KTEYEDNLADIQSKIDNIHDLMDEL 433

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 174 PPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQ 233
           P  P  P+A+P N E +V+    Q   +SK  YD++   + +H  WL  Y  +    Y  
Sbjct: 262 PEKPSNPVASPTNQEEIVKTA--QFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEA 319

Query: 234 RHQWYQKQIDVLDEKIRYYQEMSNVLEAD 262
           + Q Y+K +  +D ++    ++    E D
Sbjct: 320 KMQEYKKSLQDMDNQMSELNDLIEKCELD 348

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 61/117 (52%), Gaps = 7/117 (5%)

Query: 180 PIATPQNPEILVQLTENQNKIV-SKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWY 238
           P ATP+NPE+LV+   N N I+ SK  YD +      H+  +K Y  ++   Y ++++ +
Sbjct: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEF 436

Query: 239 QKQIDVLDEKIRYYQEMSNVLE----ADYLRVSEINKNKALVKRFQINKLIGEEKIL 291
              I+ LD KI+  ++  ++++     D L    + KN   ++ +    LI + +I+
Sbjct: 437 NNSINELDLKIKSIEK--DIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQII 491

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 82/189 (43%), Gaps = 33/189 (17%)

Query: 84  PSLRKYESRNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII---------- 133
           P+ RK      +I  P  L+  EE Q N L  L+ KE NL+ LK+SQ ++          
Sbjct: 86  PTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDISYE 145

Query: 134 TSSTARTYPQQQNIY--PKV-YYEHSKKRTPPTEQEQFHRGMNPPSPKYPIATPQNPEIL 190
             S  +   +  NIY  PK+  Y  +K   P  ++++          K  +ATPQN E +
Sbjct: 146 GDSKYKIIEKPINIYSVPKIPSYVFTK--VPGNKKKEL---------KNSLATPQNKEQV 194

Query: 191 VQLTENQNKI--VSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQKQ------- 241
           + L +    +   SKE +D +      H   LK  NA+    +  +   Y  Q       
Sbjct: 195 IVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTK 254

Query: 242 IDVLDEKIR 250
           ID+ +EKIR
Sbjct: 255 IDIENEKIR 263

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%)

Query: 92  RNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII 133
           R  +I  P +LK  +EKQ+  L  L+ KE +LQ LK+SQ+I+
Sbjct: 92  RAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIV 133

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239
           P+ATPQ+PE +V+  +     +SK  YD+L   +  H   L ++N E    Y+   + Y 
Sbjct: 350 PLATPQDPEYIVRTDKG---YMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYN 406

Query: 240 KQIDVLDEKIRYYQEMSNVLEADY---LRVSEINKNKALV 276
            ++ +L  +I   Q     L  D    ++VSE   +K ++
Sbjct: 407 DKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKML 446

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 92  RNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII-------TSSTARTYPQQ 144
           R  +I  P +L+G +E+Q+  L  L+ KE +LQ  K+SQ+I+        SST  T P+ 
Sbjct: 87  RAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKVKGEVGKSSTVETEPEA 146

Query: 145 -QNIYPKVYYEHSKKRTPPTEQEQFHRGMNPPSPKYPIAT 183
            ++  P        + T P E ++  + +    P  PI T
Sbjct: 147 VESTKPVETEPEEAETTKPVETDEPVKPIETGEPVKPIET 186

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239
           P+A+P +PE +V+  +     +SK  YD L   ++ H   +  Y  EN   Y+ + Q Y+
Sbjct: 348 PVASPDDPEFIVKFDKG---YMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYE 404

Query: 240 KQIDVLDEKI 249
             +  L  +I
Sbjct: 405 DHLTSLKSQI 414

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 162 PTEQEQFHRGMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLK 221
           P  ++ + +  +    K+P+A+P+N E +V+LT    K +SK  YD++      +D ++ 
Sbjct: 229 PIHRKDYPKVQSTTESKFPVASPENKETVVKLT--SGKKISKYVYDKIEHDTKVNDQYIV 286

Query: 222 SYNAENMANYNQRHQWYQKQIDVLD-EKIRYYQEMSNV 258
            Y  + +   N+    Y ++I  +  EK +   E+ N+
Sbjct: 287 KYQNDQLNKLNKLKSEYNEKIKSIQLEKFKTLNEIENL 324

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 92  RNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII 133
           R  +I  P +L+G +E+Q+  L  L+ KE  L+  K+SQRI+
Sbjct: 88  RAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIV 129

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239
           P+A+P +PE +V+  +     +SK  YD L   ++ H   +  Y  E+ A Y  +   Y+
Sbjct: 376 PVASPNDPEFIVKFDKG---YMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYE 432

Query: 240 KQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQIN 282
            ++  L  +I   +     L+ D     EI++ K   +   +N
Sbjct: 433 DRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLN 475

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

Query: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239
           P  TP+ PE++  L  N+   +SK  YDRL   +  H   L + + +   +Y    Q Y+
Sbjct: 279 PNGTPEEPEVV--LLTNRG-YMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYE 335

Query: 240 KQIDVLDEKIRYYQEMSNVLEAD 262
           K+I  LD +I   +     L+A+
Sbjct: 336 KEIADLDAEISKLRADITALQAE 358

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 92  RNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII 133
           R P+I  P+ L   +E+Q+  L  L++KE  L+  K SQ+I+
Sbjct: 91  RVPDIDEPKRLSTVDERQRQQLQELELKEGQLRLYKESQKIV 132

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 17/103 (16%)

Query: 160 TPPTEQEQFHRG-------------MNPPSPKYPIATPQNPEILVQLTENQNKIVSKETY 206
            PPT+Q + HRG                  P+   ATP++PE +V LTE     +SK  Y
Sbjct: 289 VPPTKQ-KGHRGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIV-LTEK--GYMSKNIY 344

Query: 207 DRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQKQIDVLDEKI 249
           DRL   +  H   L S +  + A Y    + Y++++  L+ +I
Sbjct: 345 DRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEI 387

>ZYRO0D08954g Chr4 (767612..770215) [2604 bp, 867 aa] {ON} some
           similarities with uniprot|P47179 Saccharomyces
           cerevisiae YJR151C
          Length = 867

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 4/47 (8%)

Query: 364 EPIVE---KSTIEPAEEKNVTEPIVEPTKGNDKEPAIEMNEESNVET 407
           EPI E    +++EP EE N +  +VEPT+ ++    +E  +ESNV+ 
Sbjct: 753 EPIKEHNANASVEPTEESNASS-VVEPTEKSNASSVMEPTKESNVDA 798

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,010,790
Number of extensions: 2125906
Number of successful extensions: 10054
Number of sequences better than 10.0: 194
Number of HSP's gapped: 10417
Number of HSP's successfully gapped: 209
Length of query: 441
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 328
Effective length of database: 40,524,141
Effective search space: 13291918248
Effective search space used: 13291918248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)