Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035403.491ON44444414660.0
YPR148C3.491ON4354747301e-91
NDAI0B058503.491ON4732836182e-74
Skud_16.4433.491ON4202645411e-63
TDEL0D055903.491ON3442515271e-62
Suva_16.4773.491ON4232634982e-57
Smik_16.4013.491ON4272704931e-56
SAKL0F02794g3.491ON3972584692e-53
KLTH0F14806g3.491ON3582564532e-51
Kpol_1017.73.491ON3782564315e-48
TBLA0D029803.491ON4432674321e-47
Kwal_55.212273.491ON3762564272e-47
KLLA0E04621g3.491ON3892724272e-47
ZYRO0D10010g3.491ON3822574174e-46
KAFR0G036803.491ON4152453933e-42
Ecym_12383.491ON3932713881e-41
KNAG0A079303.491ON4522653902e-41
TPHA0D032703.491ON3882633826e-41
CAGL0L08492g3.491ON3852663273e-33
AFR309C3.491ON3641072666e-25
NCAS0A133807.221ON329921418e-09
KLLA0E04511g7.221ON302681381e-08
NDAI0A026607.221ON364941391e-08
Kwal_47.181487.221ON323941381e-08
KLTH0A03894g7.221ON3231121382e-08
SAKL0F08162g7.221ON330781382e-08
TBLA0D042007.221ON331951372e-08
TDEL0H022407.221ON338981363e-08
KAFR0I019507.221ON330921345e-08
KNAG0D017607.221ON342891346e-08
CAGL0L00891g7.221ON341961346e-08
Kpol_1070.197.221ON311921337e-08
TPHA0B027507.221ON363861311e-07
Suva_9.1597.221ON325861302e-07
Smik_9.1507.221ON326861283e-07
YIL041W (GVP36)7.221ON326861283e-07
ADL115W7.221ON333941274e-07
Ecym_43777.221ON333931274e-07
Skud_9.1287.221ON329861249e-07
TPHA0C012307.221ON305551194e-06
Kpol_478.227.221ON350561169e-06
TBLA0B015807.221ON386501105e-05
ZYRO0D16522g7.221ON358521089e-05
KAFR0B027408.266ON25678760.67
KLLA0D03058g4.291ON140175705.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03540
         (444 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   569   0.0  
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   285   1e-91
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   242   2e-74
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   213   1e-63
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   207   1e-62
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   196   2e-57
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   194   1e-56
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   185   2e-53
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   179   2e-51
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   170   5e-48
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   171   1e-47
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   169   2e-47
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   169   2e-47
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   165   4e-46
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   155   3e-42
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   154   1e-41
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   154   2e-41
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   151   6e-41
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   130   3e-33
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   107   6e-25
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    59   8e-09
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    58   1e-08
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     58   1e-08
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    58   1e-08
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    58   2e-08
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    58   2e-08
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    57   2e-08
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    57   3e-08
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    56   5e-08
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    56   6e-08
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    56   6e-08
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    56   7e-08
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    55   1e-07
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    55   2e-07
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    54   3e-07
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    54   3e-07
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    54   4e-07
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    54   4e-07
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    52   9e-07
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    50   4e-06
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    49   9e-06
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    47   5e-05
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    46   9e-05
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    34   0.67 
KLLA0D03058g Chr4 (257433..261638) [4206 bp, 1401 aa] {ON} simil...    32   5.7  

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/444 (68%), Positives = 305/444 (68%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIST 60
           MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIST
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIST 60

Query: 61  LPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXXXXXXXXXX 120
           LPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPN                     
Sbjct: 61  LPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKKKKEQEK 120

Query: 121 XXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXXXXXXXXXXXVKNL 180
               GFLPRSFAQAISNSAEDCVEIYQHV                           VKNL
Sbjct: 121 EDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDEEDEDVKNL 180

Query: 181 IKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHTLRKRVKDSRLKFDT 240
           IKTFDSWAKCYKNIDQGKAEMDSMMM                 VHTLRKRVKDSRLKFDT
Sbjct: 181 IKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFDT 240

Query: 241 VRYXXXXXXXXXXXXXXXXXXXXVTLXXXXXXXXXXXXXXXXXXXXXXXSTIKDESASKE 300
           VRY                    VTL                       STIKDESASKE
Sbjct: 241 VRYELKVKEEKAKIAEAAASNAAVTLTTTEEEKPEEEEKPTTDIKKEEDSTIKDESASKE 300

Query: 301 EPIAKTPSKEDTKTKKEGXXXXXXXXXXXXXXXXXXXXLPKVPXXXXXXXGAESATKVDE 360
           EPIAKTPSKEDTKTKKEG                    LPKVP       GAESATKVDE
Sbjct: 301 EPIAKTPSKEDTKTKKEGKPAEKSTETATEATEAKEKALPKVPTTETEETGAESATKVDE 360

Query: 361 EKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNF 420
           EKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNF
Sbjct: 361 EKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNF 420

Query: 421 QLVYYRQCVQEIEANLKTLNELEI 444
           QLVYYRQCVQEIEANLKTLNELEI
Sbjct: 421 QLVYYRQCVQEIEANLKTLNELEI 444

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  285 bits (730), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 191/474 (40%), Positives = 236/474 (49%), Gaps = 74/474 (15%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57
           FS FSL+KIT+S+ATAA KT DTL+NA+  A     DP T+LS++S+ R  QES+GTV D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTVSD 64

Query: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXX----- 112
           IS LP QY  LE ++D+LEK  +RIL+VSKTFE+EGYDYPPN                  
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124

Query: 113 -----XXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXX 167
                             FLPRSFAQAIS +A DC   +Q++                  
Sbjct: 125 SKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKESIKTA 184

Query: 168 XXXXXXXX-----------------XVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXX 210
                                     + NLIK FDSW+ CYKNID+GKAEMDSMM+    
Sbjct: 185 QTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFN 244

Query: 211 XXXXXXXXXXXXXVHTLRKRVKDSRLKFDTVRYXXXXXXXXXXXXXXXXXXXXVTLXXXX 270
                        VH LRK+V++SRLKFDT+RY                     +     
Sbjct: 245 KKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEAHS----- 299

Query: 271 XXXXXXXXXXXXXXXXXXXSTIKDESASKEEPIAKTPSKEDTKTKKEGXXXXXXXXXXXX 330
                               + KD SA+      +TPS ED K K EG            
Sbjct: 300 -----------------KDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANE- 341

Query: 331 XXXXXXXXLPKVPXXXXXXXGAESATKVDEEKASEDKKTDKAIEDDSEEHKLLEQLEDTF 390
                    P V          +S  KV++E   E          +SE++KLLE+LED F
Sbjct: 342 ---------PTVDDVADRKEDLKS-NKVNDEPPIE----------ESEDNKLLEKLEDEF 381

Query: 391 VSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELEI 444
           VS+T +AVE MEEITDSSEI+GL+KLFQNFQLVY+RQCVQE+EANLK LN LEI
Sbjct: 382 VSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEI 435

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  242 bits (618), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 154/283 (54%), Gaps = 40/283 (14%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIST 60
           MFS+FSLDKITNS+  AAQK ++TL+NAI TATDP TKLS++SQ RLFQE +GT+HDIS 
Sbjct: 1   MFSSFSLDKITNSIGNAAQKATNTLNNAINTATDPQTKLSIKSQTRLFQEQLGTIHDISK 60

Query: 61  LPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXXXXXXXXXX 120
           LP+QY +LE +TD+LEK ++RIL+VSKTFEMEGYDYPPN                     
Sbjct: 61  LPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKK 120

Query: 121 X----------------------------XXXGFLPRSFAQAISNSAEDCVEIYQH---- 148
                                            FLPRSFAQAIS SA DC +IYQ     
Sbjct: 121 QISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQ 180

Query: 149 --------VXXXXXXXXXXXXXXXXXXXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAE 200
                   +                           ++NLIK F+SW+ CYKNIDQGK+E
Sbjct: 181 ETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGKSE 240

Query: 201 MDSMMMXXXXXXXXXXXXXXXXXVHTLRKRVKDSRLKFDTVRY 243
           MDSMM                  V+TLRK+V DSRLKFDTVR+
Sbjct: 241 MDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRH 283

 Score =  133 bits (335), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 71/96 (73%), Positives = 78/96 (81%), Gaps = 4/96 (4%)

Query: 352 AESATKVDEEKASEDKKTDKAI----EDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDS 407
           AE   KV++    + KK D A     +DDSEEHKLLEQLED FVSSTASAVEMM EIT+S
Sbjct: 376 AEVEAKVNDTSKDQLKKEDDAEKQDEQDDSEEHKLLEQLEDEFVSSTASAVEMMTEITES 435

Query: 408 SEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
           S IIGL+KLFQNFQLVYYRQCVQEIEANLKTLNEL+
Sbjct: 436 SSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  213 bits (541), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/264 (44%), Positives = 144/264 (54%), Gaps = 22/264 (8%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57
           FS FSL+KIT+S+ATAA KT DTL+NA+ +A     DP T+LS++S+ R  QES+GTV D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLGTVSD 64

Query: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXX----------X 107
           IS LP QY  LE ++D+LEK  RRIL+VSKTFE+EGYDYPPN                  
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGWFG 124

Query: 108 XXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXX- 166
                             FLPRSFAQAIS +A DC   +Q +                  
Sbjct: 125 SRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSESNETA 184

Query: 167 -------XXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXX 219
                            + NLIK FDSW+ CYKNID+GKAEMDS M+             
Sbjct: 185 QDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEKLINK 244

Query: 220 XXXXVHTLRKRVKDSRLKFDTVRY 243
               VH LRK+V+DSRLKFDT+RY
Sbjct: 245 DFKKVHELRKKVEDSRLKFDTMRY 268

 Score =  117 bits (293), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 70/82 (85%), Gaps = 3/82 (3%)

Query: 365 EDKKTDKAIE---DDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQ 421
           ED K ++  E   +D EE+KLLE+LED FVS+T +AVE+MEEITDSS+I+GLVKLFQNFQ
Sbjct: 338 EDSKANQGDEPTIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQ 397

Query: 422 LVYYRQCVQEIEANLKTLNELE 443
           LVY+RQCVQE+EANLK LN LE
Sbjct: 398 LVYFRQCVQEVEANLKVLNSLE 419

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  207 bits (527), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 141/251 (56%), Gaps = 24/251 (9%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTL 61
            SNFSL+KIT++LA AA KT DTL++AI   +DP  KLSL+++ R  QE++GT+ D S L
Sbjct: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKL 64

Query: 62  PEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXX--------- 112
           P QY +LE ++DALEKC +RIL+V++TFE+EGYDYPPN                      
Sbjct: 65  PPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKP 124

Query: 113 XXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXXXXXXX 172
                        FLPRSF+QAIS +A DC  ++ ++                       
Sbjct: 125 EKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL---------------QEHGDEDE 169

Query: 173 XXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHTLRKRVK 232
               V N+ K FDSW+KCYKNID+GK EMDSM+                  VH  RK+V+
Sbjct: 170 EDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVE 229

Query: 233 DSRLKFDTVRY 243
           +SRLKFDTVRY
Sbjct: 230 ESRLKFDTVRY 240

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (88%)

Query: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
           FVS+T +AVE+M E+T+S+EI+GL KLFQNFQLVY+RQCVQE+EA+LK L  LE
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  196 bits (498), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 140/263 (53%), Gaps = 26/263 (9%)

Query: 7   LDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHDISTLP 62
            +KIT+S+ATAA KT DTL++A+  A     DP T+LS++S+ R  QES+GTV DIS LP
Sbjct: 5   WNKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLGTVSDISKLP 64

Query: 63  EQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXX----------XXXXXX 112
            QY  LE ++D+LEK  +RIL+VSKTFE+EGYDYPPN                       
Sbjct: 65  PQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKKTE 124

Query: 113 XXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXX------- 165
                        FLPRSFAQAIS +A DC   ++++                       
Sbjct: 125 HASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEAKKTTQETAE 184

Query: 166 -----XXXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXX 220
                           + NLIK FDSW+ CYKNID+GKAEMDSMM+              
Sbjct: 185 QEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKLINED 244

Query: 221 XXXVHTLRKRVKDSRLKFDTVRY 243
              VH LR++V++SRLKFDT+RY
Sbjct: 245 FKKVHELRRKVEESRLKFDTMRY 267

 Score =  113 bits (282), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 53/69 (76%), Positives = 62/69 (89%)

Query: 375 DDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEA 434
           +DSEE+KLLE+LED FVS+T +AVE MEEITDSSEI+ LVKLFQNFQLVY+RQC QE+EA
Sbjct: 354 EDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEA 413

Query: 435 NLKTLNELE 443
           NLK LN +E
Sbjct: 414 NLKVLNGME 422

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  194 bits (493), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 115/270 (42%), Positives = 144/270 (53%), Gaps = 28/270 (10%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57
           FS+FSL+KIT+S+ATAA KT DTL+NA+  A     DP T+LS++S+ R  QES+GT+ D
Sbjct: 5   FSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTISD 64

Query: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXX----------X 107
           IS LP QY  LE ++D+LEK  +RIL+VSKTFE+EGYDYPPN                  
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124

Query: 108 XXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXX 167
                             FLPRSFAQAIS +A DC   +Q++                  
Sbjct: 125 SKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRESTKNA 184

Query: 168 XXXXXX--------------XXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXX 213
                                  + NLIK FDSW+ CYKNID+GK EMDSMM+       
Sbjct: 185 QTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEFNKKL 244

Query: 214 XXXXXXXXXXVHTLRKRVKDSRLKFDTVRY 243
                     VH LRK+V+ SRLKFDT+RY
Sbjct: 245 EKLINQDFKRVHELRKKVEISRLKFDTMRY 274

 Score =  114 bits (285), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 53/69 (76%), Positives = 63/69 (91%)

Query: 375 DDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEA 434
           ++SEE+KLLE+LED FVS+T +AVE MEEI DSSEI+GL+KLFQNFQLVY+RQCVQE+EA
Sbjct: 358 EESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEA 417

Query: 435 NLKTLNELE 443
           NLK LN LE
Sbjct: 418 NLKVLNGLE 426

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  185 bits (469), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 137/258 (53%), Gaps = 25/258 (9%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59
           FS+FSLDK+TNS+++AA KT D LS AI      DP  KLSL+ +K   QE++G + DIS
Sbjct: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDIS 64

Query: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXX-------------- 105
            LP QY  LE + D+LEK  RR+L+V+KTFE+EGYDYPPN                    
Sbjct: 65  KLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFM 124

Query: 106 XXXXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXX 165
                              GFLPRSFAQA+S +A+D  ++ + +                
Sbjct: 125 DGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTL---------KDEQKEP 175

Query: 166 XXXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVH 225
                      + +LI  F++W+KC + IDQ KAEMDS+M                  VH
Sbjct: 176 PQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVH 235

Query: 226 TLRKRVKDSRLKFDTVRY 243
           +LRK+V++SRLKFDT+RY
Sbjct: 236 SLRKKVEESRLKFDTLRY 253

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 71/100 (71%), Gaps = 8/100 (8%)

Query: 351 GAESATKVDEEKASEDKKT-------DKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEE 403
           G E   K DE K SED  +       ++ ++++  EHKLLE+LED FVSST  AVE+M E
Sbjct: 297 GKEHDLKADE-KLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIMGE 355

Query: 404 ITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
           ITDSSEI+ LVKLF  FQL+Y+RQCVQE+EA+ K L+ L+
Sbjct: 356 ITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLD 395

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  179 bits (453), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 131/256 (51%), Gaps = 24/256 (9%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59
           F  FSL+K+TNS+   A KT DTLS AI      DP  KLSL+++K   QE++GT+ DIS
Sbjct: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDIS 64

Query: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXX------------X 107
            LP QY  LE + D+LEK  RR+L+V+KT+E+EGYDYPPN                    
Sbjct: 65  KLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFGFV 124

Query: 108 XXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXX 167
                              +PRSFAQAIS +A+D  E+   +                  
Sbjct: 125 SSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTAL----------KTEEQKAS 174

Query: 168 XXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHTL 227
                    + +LIK F++W+ C  N+DQ KAEMD++M+                   TL
Sbjct: 175 AEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234

Query: 228 RKRVKDSRLKFDTVRY 243
           RK+V+DSRLKFDT+RY
Sbjct: 235 RKKVEDSRLKFDTMRY 250

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 67/92 (72%), Gaps = 1/92 (1%)

Query: 353 ESATKVDEEKASEDKKTDKAIEDDSEE-HKLLEQLEDTFVSSTASAVEMMEEITDSSEII 411
           E+A + + +K  ED+       D S+E  KLLE+LED FVS+T  AVE M EITDS+EII
Sbjct: 263 EAAQQTESQKPQEDEAEASKDSDSSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEII 322

Query: 412 GLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
            LVKLF NFQL+YY+QCVQ +E ++ +LNELE
Sbjct: 323 NLVKLFHNFQLIYYKQCVQNLETSINSLNELE 354

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  170 bits (431), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 130/256 (50%), Gaps = 20/256 (7%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTAT--------DPATKLSLRSQKRLFQESI 52
           MFS FS+DK+T+S++  A KT + L+NA++           DP TKLS++S+ R  QE +
Sbjct: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60

Query: 53  GTVHD-ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXX----XXXX 107
           GT++D  S LP  YT LE +TDA+EK L+R+L V+KT+E EGYDYPPN            
Sbjct: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTND 120

Query: 108 XXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXX 167
                             FLPRSFAQAISN++ D       V                  
Sbjct: 121 DNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKDDEEEEEDD 180

Query: 168 XXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHTL 227
                      +L K F+S   CY+NID GK EMD +++                 VH L
Sbjct: 181 EEWS-------DLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQL 233

Query: 228 RKRVKDSRLKFDTVRY 243
           RK V++SRLKFDT+RY
Sbjct: 234 RKSVENSRLKFDTMRY 249

 Score =  104 bits (260), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/92 (59%), Positives = 72/92 (78%), Gaps = 3/92 (3%)

Query: 355 ATKVDEEKASEDKKTDKAIEDDSE---EHKLLEQLEDTFVSSTASAVEMMEEITDSSEII 411
           A+K +  K   +KK D   E ++E   ++KLLE+LED FVS+T +AVE MEE+TD+S+II
Sbjct: 286 ASKKETPKKEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKII 345

Query: 412 GLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
            LVKL+QNFQLVYY+QC+QEIE+NLK LN LE
Sbjct: 346 NLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  171 bits (432), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 132/267 (49%), Gaps = 29/267 (10%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57
           FSNFSLDK+ +SL +AAQKT DTLSNAI        DP T+L+L S++   QESIG +++
Sbjct: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINE 89

Query: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPN------------------ 99
           IS LP QY  LE +TDALEK ++RILIV+ TFE+EGYDYPPN                  
Sbjct: 90  ISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAFLR 149

Query: 100 ---XXXXXXXXXXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXX 156
                                        FLPRSF  AIS ++ D   I  ++       
Sbjct: 150 DNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNL----NNN 205

Query: 157 XXXXXXXXXXXXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXX 216
                               ++ LIK FDSW+ C KNID+ K + D +++          
Sbjct: 206 EKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265

Query: 217 XXXXXXXVHTLRKRVKDSRLKFDTVRY 243
                  V  LR +V+D+RLKFDT+RY
Sbjct: 266 LDVEFKNVKALRLKVQDARLKFDTMRY 292

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 57/66 (86%)

Query: 377 SEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANL 436
           +E+ KLLE LED FVS T++AVE MEEIT+SS+I+ L+KLFQNFQL++Y+QC++E+E N+
Sbjct: 375 NEDEKLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNM 434

Query: 437 KTLNEL 442
           K L +L
Sbjct: 435 KLLTDL 440

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  169 bits (427), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 127/256 (49%), Gaps = 24/256 (9%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59
           F  FS +K+T++L  AA KT DTLS AI      DP   LSL+++K   QE++GT+ DIS
Sbjct: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDIS 64

Query: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXX------------XX 107
            LP QY  LE + D+LEK  RR+L+V+KTFE+EGYDYPPN                    
Sbjct: 65  KLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLM 124

Query: 108 XXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXX 167
                              +PRSFAQAI+ +A+D  ++   +                  
Sbjct: 125 SSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAAL----------KDQEQQAS 174

Query: 168 XXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHTL 227
                    +  LIK F +W++C   IDQGKAEMD++M                     L
Sbjct: 175 ADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVL 234

Query: 228 RKRVKDSRLKFDTVRY 243
           R++V+DSRLKFDT+RY
Sbjct: 235 RRKVEDSRLKFDTMRY 250

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 65/92 (70%), Gaps = 11/92 (11%)

Query: 352 AESATKVDEEKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEII 411
            +S TK  EE+A+ D              +LLE+LED FVS+T  AVE M EITDS+E++
Sbjct: 292 GKSVTKTKEEQATNDAA-----------QELLEKLEDEFVSNTTEAVETMGEITDSAELL 340

Query: 412 GLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
            LVKLF NFQLVY+RQCVQ++EA+L TLNELE
Sbjct: 341 NLVKLFHNFQLVYHRQCVQDLEASLSTLNELE 372

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  169 bits (427), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 132/272 (48%), Gaps = 29/272 (10%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAI--TTATDPATKLSLRSQKRLFQESIGTVHDI 58
           MFS  SL+ IT+S++ AAQ+T +  S+AI      DP T+LS+  ++   QE++GTVHDI
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60

Query: 59  STLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXX-----------XX 107
           S LP QY  LE ++DALEK  +R+L+V+KTFE+EGYDYPPN                   
Sbjct: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120

Query: 108 XXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXX 167
                            G LPRSFAQA+S +A D   I + +                  
Sbjct: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180

Query: 168 XXXXXXXXX----------------VKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXX 211
                                    V NLIK F+SW KC  +IDQ KAEMDS+M+     
Sbjct: 181 KPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240

Query: 212 XXXXXXXXXXXXVHTLRKRVKDSRLKFDTVRY 243
                        H LR +V+D+RL FDT+R+
Sbjct: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRH 272

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 61/83 (73%)

Query: 361 EKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNF 420
           EK + ++  D A  ++  + KL E+LED FVS+T+  VE + E+TDSSEII LVKLF NF
Sbjct: 303 EKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNF 362

Query: 421 QLVYYRQCVQEIEANLKTLNELE 443
           QL++Y+QCV+ +E +L+ LN L+
Sbjct: 363 QLIHYKQCVKSLEEDLEVLNSLD 385

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  165 bits (417), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 131/257 (50%), Gaps = 29/257 (11%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59
           FS+FS   + +S+A AA +T D LSNA+      DP T+LS++++ R  +E++G V +IS
Sbjct: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 64

Query: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXXXXXXXXX 119
            LP QY  LE ++DALEK  +R+L+V++TFE+EGYDYPPN                    
Sbjct: 65  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 124

Query: 120 XXXXXG-------------FLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXX 166
                G              +PRSFAQAI+ ++ +C E YQ+                  
Sbjct: 125 KQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDV-- 182

Query: 167 XXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHT 226
                       NL++ F++ + CY+NID+GK EMD  +                  +H 
Sbjct: 183 ------------NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 230

Query: 227 LRKRVKDSRLKFDTVRY 243
           LR +V++SRLKFDT+RY
Sbjct: 231 LRNKVENSRLKFDTMRY 247

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 56/66 (84%)

Query: 378 EEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLK 437
           E++KLLEQLED FVS+T+ AVE M  I + SEI+ L+KLFQN QLVYYRQCVQE+EA+LK
Sbjct: 316 EDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLK 375

Query: 438 TLNELE 443
            LN+LE
Sbjct: 376 GLNDLE 381

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  155 bits (393), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 124/245 (50%), Gaps = 7/245 (2%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHD--I 58
           MFSNF+ DKITNS++TAAQ     +++ I T  D  TKL  +   R +QE +G + D  I
Sbjct: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTP-DVQTKLHFKKTARFWQEKVGQIPDKEI 59

Query: 59  STLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXXXXXXXX 118
           S LPE Y  LE + DALEK L+R+LIV+KT+E+EGYDYPPN                   
Sbjct: 60  SKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN--LSESLNDWWWSDLKKSK 117

Query: 119 XXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXXXXXXXXXXXVK 178
                  F+  SF  AIS +A D   I   +                             
Sbjct: 118 KHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEEEVEEEDDDEFL-- 175

Query: 179 NLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHTLRKRVKDSRLKF 238
           NL++ F+S + CYKNID+ KAEMD+M++                 V  LR +V+DSRL+F
Sbjct: 176 NLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEF 235

Query: 239 DTVRY 243
           DT+R+
Sbjct: 236 DTLRH 240

 Score =  108 bits (269), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 71/84 (84%)

Query: 360 EEKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQN 419
           EE   ED K + + E+++EE+KLLE+LED FVS+T +AVE+M E+T++SE+I LVKLFQN
Sbjct: 332 EEAPKEDVKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQN 391

Query: 420 FQLVYYRQCVQEIEANLKTLNELE 443
           FQL++Y+QCVQEIE N+K L++LE
Sbjct: 392 FQLIHYKQCVQEIENNMKFLDQLE 415

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  154 bits (388), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 130/271 (47%), Gaps = 38/271 (14%)

Query: 2   FSNFSLDKITNSLATAAQKTS-------DTLSNAITTAT--DPATKLSLRSQKRLFQESI 52
           FSNFSLDKI +++ TAA KT        + L++AI +    DP T LSLR++K   QE++
Sbjct: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64

Query: 53  GTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXX--------- 103
           GT+ DIS LP +Y  LE + DA EK   RIL+VSKTFE++GYDYPPN             
Sbjct: 65  GTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSS 124

Query: 104 -----------XXXXXXXXXXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXX 152
                                           G++P SFAQAIS +A+D + I + +   
Sbjct: 125 KKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKEL--- 181

Query: 153 XXXXXXXXXXXXXXXXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXX 212
                                   V +L+   ++WA+   NID+ K +MD  M+      
Sbjct: 182 ------NEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKK 235

Query: 213 XXXXXXXXXXXVHTLRKRVKDSRLKFDTVRY 243
                      V  LRK+V++SRLKFDT+RY
Sbjct: 236 LDSLVNNDFLKVRALRKKVEESRLKFDTLRY 266

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 51/71 (71%)

Query: 374 EDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIE 433
           E+D +   LLE+ ED FVS+T  AV  M +ITDS  +  LVKLF NFQL+Y+++CVQE++
Sbjct: 317 EEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQ 376

Query: 434 ANLKTLNELEI 444
           A+L  +N L +
Sbjct: 377 ASLNVINTLTV 387

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  154 bits (390), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/265 (34%), Positives = 123/265 (46%), Gaps = 23/265 (8%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHD--I 58
           MFSNFSLDK+T+++  AAQ   DT+ N I +  D  TKL      R FQE +GT+ +  I
Sbjct: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSP-DAQTKLQFLKTTRYFQEKVGTISEDEI 59

Query: 59  STLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXXXXXXXX 118
           + LPE Y  L+ +++A+EK L+R+L+V+KTFE+EGYDYPPN                   
Sbjct: 60  AKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKKT 119

Query: 119 XXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXX-------------------- 158
                   L RSFA AI  +  D   I   +                             
Sbjct: 120 QDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKREEEAEAAEEEDEA 179

Query: 159 XXXXXXXXXXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXX 218
                             + N+I  F  W+ CYKNIDQ KAEMDSM++            
Sbjct: 180 DDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLE 239

Query: 219 XXXXXVHTLRKRVKDSRLKFDTVRY 243
                VH L  RV+DSRL+FDT+R+
Sbjct: 240 IDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/56 (69%), Positives = 49/56 (87%)

Query: 388 DTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
           D FVS+  +AVE M E+TDSSE+I LVKLFQN QLV+YRQCVQE+EA++K+L+ELE
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  151 bits (382), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 126/263 (47%), Gaps = 27/263 (10%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAIT--------TATDPATKLSLRSQKRLFQESI 52
           MFSNFSLDK+T+S++  A KT +  +NAIT           DP TKLS+R++ R  QE +
Sbjct: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60

Query: 53  GTVHD-ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXX 111
           GT+ D IS LP+QY  LE +TD++EK L+R+L+V+ TF  EGYDYPPN            
Sbjct: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPN-------LTESI 113

Query: 112 XXXXXXXXXXXXXGFLPRSFAQAISNSAEDCVEIYQHVXXXXXXXXXXXXXXXXXXX--- 168
                         FLPRSFAQA++ +  D   I                          
Sbjct: 114 SDWWAEDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKDENPEA 173

Query: 169 --------XXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXX 220
                           +  L K F + +  + NID GK EMD+M++              
Sbjct: 174 GAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVE 233

Query: 221 XXXVHTLRKRVKDSRLKFDTVRY 243
              V  LR+ V++SRLKFDT+RY
Sbjct: 234 FKEVAQLRRNVENSRLKFDTMRY 256

 Score =  108 bits (271), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 61/65 (93%)

Query: 380 HKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTL 439
           +KLLEQLED FVS+T+SAVE MEE+TDS++I+ LVKLFQNFQLVYYRQCVQEIE NLKT+
Sbjct: 322 YKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTI 381

Query: 440 NELEI 444
           ++LEI
Sbjct: 382 SDLEI 386

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  130 bits (327), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 116/266 (43%), Gaps = 48/266 (18%)

Query: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIST 60
           MF  F+L+ IT S++   Q       + +    DP TKLS++++ R  QE+IG   DIS 
Sbjct: 1   MFK-FNLESITQSISEGTQ-------SLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISK 52

Query: 61  LPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNXXXXXXXXXXXXXXXXXXXXX 120
           LP QY  LE + D++EK L+RILIV+KT+E+EGYDYPPN                     
Sbjct: 53  LPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELT 112

Query: 121 XX---XXGFL--------------------PRSFAQAISNSAEDCVEIYQHVXXXXXXXX 157
                  G +                    P SFA AI+ + +D   I++ +        
Sbjct: 113 KNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEK 172

Query: 158 XXXXXXXXXXXXXXXXXXXVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXX 217
                                 L+K F  W+ C+  I   K EMD MM+           
Sbjct: 173 EDIDE-----------------LVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYL 215

Query: 218 XXXXXXVHTLRKRVKDSRLKFDTVRY 243
                 +HTLR +V++SRL FDT+RY
Sbjct: 216 QKNFQKIHTLRAKVEESRLNFDTMRY 241

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 69/93 (74%), Gaps = 3/93 (3%)

Query: 354 SATKVDEEKASEDKKTDKAIEDDSE---EHKLLEQLEDTFVSSTASAVEMMEEITDSSEI 410
           +AT  DE K ++D K  + +++DS+   + +LLEQLED FVS+T  AVE+M E++++SE+
Sbjct: 292 NATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSEL 351

Query: 411 IGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443
           + L+KLFQ FQL Y++ CV+ +E +LK LN ++
Sbjct: 352 LSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAID 384

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  107 bits (266), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 9/107 (8%)

Query: 2   FSNFSLDKITNSLATAAQKTSDTLSNA---ITTAT------DPATKLSLRSQKRLFQESI 52
           F   SLDK+ N+L  AAQKT   LS     +T A       DP T LSL+++KR  QE++
Sbjct: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64

Query: 53  GTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPN 99
           G+  DIS LP QY  LE + DA+E+  ++IL+VSKTFE+EGYDYPPN
Sbjct: 65  GSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPN 111

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (78%)

Query: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNEL 442
           LE  ED FVS+TA AVE M  I D++++I LVKLFQNFQLVY+R+CVQE+E +L +L  L
Sbjct: 301 LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSL 360

Query: 443 E 443
           E
Sbjct: 361 E 361

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 37/67 (55%)

Query: 177 VKNLIKTFDSWAKCYKNIDQGKAEMDSMMMXXXXXXXXXXXXXXXXXVHTLRKRVKDSRL 236
           V++LIK F +WA    N+D  K EMD  M+                  HTLR++V++SRL
Sbjct: 193 VESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRL 252

Query: 237 KFDTVRY 243
            FDT++Y
Sbjct: 253 TFDTLKY 259

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa]
          {ON} Anc_7.221
          Length = 329

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 6  SLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQY 65
          S +  TNS +    + S T+S      +     L+ +S +R+ QE +G V DIS LPE+Y
Sbjct: 3  SFNSFTNSFSKTLSELSSTVSQKTQELSTNLPNLA-QSTQRMVQERLGQVTDISQLPEEY 61

Query: 66 TTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
            LE + D++++     L VS  +E + YDYP
Sbjct: 62 LELEMKLDSIKQIYDNFLAVSSVYEQQSYDYP 93

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYY 425
           +E LED F  +T  A  +M+++ D+S+I+  V      QL Y+
Sbjct: 247 METLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYF 289

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 34  DPATKLSL--RSQKRLFQESIGTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEM 91
           D  T L L   S +R+ QE +G V DIS LP++Y  LE R + ++      L V+K +E 
Sbjct: 34  DLKTNLPLLANSTQRMLQEKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYEN 93

Query: 92  EGYDYPPN 99
           E YDYP N
Sbjct: 94  ESYDYPSN 101

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON}
          Anc_7.221
          Length = 364

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 6  SLDKITNSLATAAQKTSDTLSNAIT--TATDPATKLSLRSQKRLFQESIGTVHDISTLPE 63
          + +  TNS     Q+ S T+S      +   P      +S +R+ QE +G V DIS LPE
Sbjct: 3  TFNSFTNSFNKRLQELSTTVSQKTQEFSTNMPDINSLAQSTQRMVQERLGQVTDISQLPE 62

Query: 64 QYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
          +Y  LE + D ++      L V+ TFE + YDYP
Sbjct: 63 EYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYP 96

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 10/94 (10%)

Query: 7   LDKITNSLATA-AQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQY 65
           LDK    L+TA +QKT D  +   + A         +S +RL QE +G V DIS LP+ Y
Sbjct: 30  LDKKFKDLSTAVSQKTQDFTTQLPSLA---------QSTQRLMQEKLGQVTDISQLPQDY 80

Query: 66  TTLEARTDALEKCLRRILIVSKTFEMEGYDYPPN 99
             LE + D ++      L V++ +E E YDYP N
Sbjct: 81  VELENKIDRMKLVYENFLKVTQVYENESYDYPNN 114

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQ 430
           +E LED F  +T  AV +M+++ +SSE++  ++     Q  YY+Q  +
Sbjct: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 61/112 (54%), Gaps = 14/112 (12%)

Query: 2   FSNF--SLDKITNSLAT-AAQKTSDT--------LSNAITTAT-DPATKLS--LRSQKRL 47
           F+NF  S++K    L++  +Q+  D         LS+A++  T D  T+L    +S +RL
Sbjct: 3   FNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQRL 62

Query: 48  FQESIGTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPN 99
            QE +G V DIS LP++Y  LE + D +       L V++ +E E YDYP N
Sbjct: 63  VQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNN 114

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 25  LSNAITTAT-DPATKL-SL-RSQKRLFQESIGTVHDISTLPEQYTTLEARTDALEKCLRR 81
           LS A++  T D  T L SL +S +RL QE +G V DIS LP++Y  LE R D +      
Sbjct: 37  LSQAVSQRTQDLTTSLPSLAQSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYEN 96

Query: 82  ILIVSKTFEMEGYDYPPN 99
            L V++ +E E YDYP N
Sbjct: 97  FLKVTQVYEHESYDYPNN 114

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYR 426
           +E LED F  +T  A  +M+++  SSE +  +    + QL YY+
Sbjct: 263 MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON}
          Anc_7.221 YIL041W
          Length = 331

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 5/95 (5%)

Query: 5  FSLDKITNSLATAAQKTSDTLSNAI--TTATDPATKLSLRSQKRLFQESIGTVHDISTLP 62
           S + + +S+  A Q  S+++S       +T PA     + Q+RL QE +G + DIS +P
Sbjct: 1  MSFNNLKSSIGQALQGLSESVSQKTQEMASTWPAYA---QVQQRLAQEKLGQITDISQMP 57

Query: 63 EQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
           +Y  LE R D L+  ++ +L V++ +E   YD+P
Sbjct: 58 REYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWP 92

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON}
          Anc_7.221 YIL041W
          Length = 338

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 10/98 (10%)

Query: 2  FSNF--SLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIS 59
          F+NF  SL++    L+TA  + +  +S  + + T        +S +RL QE +G V DIS
Sbjct: 4  FNNFTNSLNQKFQELSTAVSQRTQEISTNLPSLT--------QSTQRLVQERLGQVTDIS 55

Query: 60 TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
           LP +Y  LE + D ++      L V+  +E E YDYP
Sbjct: 56 QLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYP 93

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIE 433
           +E LED F  +T  A  +M+E+  +++    +K   N QL Y++     IE
Sbjct: 245 METLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQTSASLIE 295

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
          YIL041W
          Length = 330

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 6  SLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQY 65
          S ++ TNS     Q+ S ++S      ++    L+ +S +RL QE +G V DIS LP++Y
Sbjct: 3  SFNEFTNSFTKRFQELSTSVSQRTQELSNNLPTLA-QSTQRLVQEKLGQVTDISQLPQEY 61

Query: 66 TTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
            LE + D+++      L V+  +E E YDYP
Sbjct: 62 LELEKKVDSIKLIHEHFLQVTSIYENESYDYP 93

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON}
          Anc_7.221 YIL041W
          Length = 342

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 3/89 (3%)

Query: 12 NSLATAAQKTSDTLSNAITTATDPATK--LSL-RSQKRLFQESIGTVHDISTLPEQYTTL 68
          NS A++  KT     ++++  T   ++   SL ++ +RL QE +G V DIS LP++Y  L
Sbjct: 5  NSFASSLNKTLYDFGSSVSQKTQEFSRDLPSLAQTTQRLVQEKLGQVTDISQLPQEYLEL 64

Query: 69 EARTDALEKCLRRILIVSKTFEMEGYDYP 97
          E R DAL+      L V+  +E E YDYP
Sbjct: 65 EKRVDALKLVHEHFLQVTAIYENESYDYP 93

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%)

Query: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANL 436
           +E LED F   T  A  +M+E+   ++++G V+     Q  Y+ +    +E  L
Sbjct: 248 METLEDEFAQCTEHATIVMQEVLSQADLLGAVRRLAAAQHAYHERSAAILEGFL 301

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON}
          similar to uniprot|P40531 Saccharomyces cerevisiae
          YIL041w
          Length = 341

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 2  FSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTL 61
           SNF  +   NSL    Q  S+T+S      +     L+ +S +R+ QE +G V DIS L
Sbjct: 1  MSNF--NSFANSLRENLQSFSNTVSQKTHELSTNIPTLA-QSTQRMVQEKLGQVTDISQL 57

Query: 62 PEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
          P++Y  LE + D ++      L V+  +E E YDYP
Sbjct: 58 PQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYP 93

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQ 430
           +E LED F  +T  A  +M+E+  S+  +  +K     QL YY Q  +
Sbjct: 246 METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAK 293

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
          (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 6  SLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQY 65
          S +  TNSL+   Q+ S  +S      +     L+  S +RL QE +G V DIS LP++Y
Sbjct: 2  SFNSFTNSLSQKFQELSTAVSEKTQEFSTSIPTLA-ESTQRLVQEKLGNVTDISQLPQEY 60

Query: 66 TTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
            LE + D ++      L ++  +E E YDYP
Sbjct: 61 IELERQVDTIKLVYEHFLQITAIYENESYDYP 92

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON}
          Anc_7.221 YIL041W
          Length = 363

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 12 NSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEAR 71
          NS +++  K    LS      T     ++  +Q RL +E +G   DISTLP++Y  LE +
Sbjct: 4  NSFSSSFNKKFQELSEKTQEMTSTIPHVAQNTQ-RLMKEKLGQAKDISTLPQEYVELETK 62

Query: 72 TDALEKCLRRILIVSKTFEMEGYDYP 97
           D +++     L V+  +E E YDYP
Sbjct: 63 IDTMKEIYEHFLKVTMVYEKESYDYP 88

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
          (REAL)
          Length = 325

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 12 NSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEAR 71
          N+ A++  K    LS +++  T     L+ +S +R+ QE +G V DIS LP +YT LE +
Sbjct: 4  NAFASSLSKKLQELSTSVSERTQDLPNLA-QSTQRMVQERLGQVTDISQLPREYTELEDK 62

Query: 72 TDALEKCLRRILIVSKTFEMEGYDYP 97
           D ++      L V+  +E   YDYP
Sbjct: 63 VDTIKLIYNHFLGVTAIYENGSYDYP 88

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
          (REAL)
          Length = 326

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 12 NSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEAR 71
          N+ A++  K    +S +++  T     L+ +S +R+ QE +G V DIS LP +YT LE +
Sbjct: 4  NAFASSLSKKLQEISTSVSEKTQELPSLA-QSTQRMVQERLGQVTDISQLPREYTELEEK 62

Query: 72 TDALEKCLRRILIVSKTFEMEGYDYP 97
           D ++      L V+  +E   YDYP
Sbjct: 63 VDTIKLIYNHFLGVTAIYENGSYDYP 88

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
          domain-containing protein that localizes to both early
          and late Golgi vesicles; required for adaptation to
          varying nutrient concentrations, fluid-phase
          endocytosis, polarization of the actin cytoskeleton,
          and vacuole biogenesis
          Length = 326

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 12 NSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEAR 71
          N+ A++  K    +S +++  T     L+ +S +R+ QE +G V DIS LP +YT LE +
Sbjct: 4  NAFASSLSKKLQEISTSVSEKTQELPSLA-QSTQRMVQERLGQVTDISQLPREYTELEDK 62

Query: 72 TDALEKCLRRILIVSKTFEMEGYDYP 97
           D ++      L V+  +E   YDYP
Sbjct: 63 VDTIKLIYNHFLGVTAIYENGSYDYP 88

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 10/94 (10%)

Query: 7   LDKITNSLA-TAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQY 65
           LDK    L+ + +Q+T D  SN       P+  L+  +Q+R+ QE +G V DIS +PE+Y
Sbjct: 30  LDKKLKDLSLSVSQRTQDLTSNL------PS--LAQTTQRRV-QERLGQVTDISQMPEEY 80

Query: 66  TTLEARTDALEKCLRRILIVSKTFEMEGYDYPPN 99
             LE R D  +      L VS+ +E E YDYP +
Sbjct: 81  VELEQRVDRTKLIYDNFLKVSQIYESESYDYPQH 114

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (52%), Gaps = 10/93 (10%)

Query: 6   SLDKITNSLA-TAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQ 64
           +LDK    L+ T  QKT D       T+T P+     ++  R+ QE +G + DIS +PE+
Sbjct: 29  NLDKRFKDLSMTVTQKTQDL------TSTLPSIA---QTTHRMVQEKLGQITDISQMPEE 79

Query: 65  YTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
           Y  +E R D +       L V++ +E E YDYP
Sbjct: 80  YVHMEKRVDKIRLIYENFLKVTQIYESETYDYP 112

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
          (REAL)
          Length = 329

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 12 NSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEAR 71
          N+ A++  K    +S +++  T      + +S +R+ QE +G V DIS LP +YT LE +
Sbjct: 4  NAFASSLSKKLQEISTSVSERTQELPNFA-QSTQRMVQERLGQVTDISQLPREYTELEDK 62

Query: 72 TDALEKCLRRILIVSKTFEMEGYDYP 97
           D ++      L V+  +E   YDYP
Sbjct: 63 VDTIKLIYNHFLGVTAIYENGSYDYP 88

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
          YIL041W
          Length = 305

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%)

Query: 43 SQKRLFQESIGTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
          S +RL QE +G V DIS LP++Y  LE   D ++      L ++  ++ E YDYP
Sbjct: 38 STQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYP 92

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
          (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 42 RSQKRLFQESIGTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
          +S  R+ +E +G V DIS LP++Y  LE + D  +      L ++  +E E YDYP
Sbjct: 33 QSTHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYP 88

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON}
          Anc_7.221 YIL041W
          Length = 386

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 48 FQESIGTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
           QE  G V DIS LP++Y  LE + D+++      L ++  +E E YDYP
Sbjct: 1  MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYP 50

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
          {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
          YIL041W GVP36 Golgi-vesicle protein of unknown function
          green fluorescent protein (GFP)-fusion protein
          localizes to the cytoplasm
          Length = 358

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 46 RLFQESIGTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYP 97
          R  QE +G   DIS +P++Y  L  + DA++      L V++ ++ E YDYP
Sbjct: 37 RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYP 88

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 362 KASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQ 421
           K   DK T+ AIE      K L QL+DT   + A A+ ++ ++  S E  G  K  ++  
Sbjct: 14  KEVRDKITN-AIEGLPLHQKTLLQLQDTLKRNDALAIPLLRDVV-SYETTGKSKFLESII 71

Query: 422 LVYYRQCVQEIEANLKTL 439
              Y Q + E+ ++LK L
Sbjct: 72  YRLYFQWLNEVPSHLKPL 89

>KLLA0D03058g Chr4 (257433..261638) [4206 bp, 1401 aa] {ON} similar
           to uniprot|Q06698 Saccharomyces cerevisiae YLR419W
           Hypothetical ORF
          Length = 1401

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 12/75 (16%)

Query: 25  LSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEARTDALEKCLRRILI 84
           +S A+ + TDP TK +L  +  L ++ I        +P Q T  EAR  A    L RI  
Sbjct: 89  VSTALISCTDPKTKETLVLRMSLEKKEI--------VPPQSTPAEARHYAATVALHRIAF 140

Query: 85  VSKTFEMEGYDYPPN 99
            SK + M     PPN
Sbjct: 141 NSKLYLM----LPPN 151

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,275,863
Number of extensions: 856319
Number of successful extensions: 6216
Number of sequences better than 10.0: 66
Number of HSP's gapped: 6335
Number of HSP's successfully gapped: 122
Length of query: 444
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 331
Effective length of database: 40,524,141
Effective search space: 13413490671
Effective search space used: 13413490671
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)