Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035303.488ON31331316840.0
TBLA0C044503.488ON3093207601e-100
Kpol_480.173.488ON3133157357e-96
YPR147C3.488ON3043167261e-94
Suva_16.4763.488ON3043167252e-94
Skud_16.4423.488ON3043167191e-93
TDEL0D055603.488ON3113157156e-93
NDAI0B058303.488ON3293347021e-90
Smik_16.4003.488ON3043166955e-90
TPHA0D042203.488ON3163246766e-87
CAGL0L08514g3.488ON3123166741e-86
ZYRO0D10076g3.488ON3053146549e-84
Kwal_55.212193.488ON3022886224e-79
SAKL0F02860g3.488ON3053156095e-77
KLTH0F14740g3.488ON3022895879e-74
AFR306C3.488ON3193065811e-72
Ecym_12413.488ON3053175435e-67
TBLA0H035408.524ON378155790.20
KNAG0A040208.492ON39451693.6
NCAS0B022608.524ON363147693.7
KLTH0F15554gna 1ON54785684.4
YLR011W (LOT6)na 2ON19189665.0
KLLA0F22341gsingletonON31941667.3
TDEL0F003301.528ON101750677.9
SAKL0F06402g3.442ON72133668.1
KLTH0H11858g1.390ON56577668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03530
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   653   0.0  
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   297   e-100
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   287   7e-96
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   284   1e-94
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   283   2e-94
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   281   1e-93
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   280   6e-93
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   275   1e-90
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   272   5e-90
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   265   6e-87
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   264   1e-86
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   256   9e-84
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   244   4e-79
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   239   5e-77
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   230   9e-74
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   228   1e-72
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   213   5e-67
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    35   0.20 
KNAG0A04020 Chr1 complement(540691..541875) [1185 bp, 394 aa] {O...    31   3.6  
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    31   3.7  
KLTH0F15554g Chr6 complement(1271266..1272909) [1644 bp, 547 aa]...    31   4.4  
YLR011W Chr12 (169103..169678) [576 bp, 191 aa] {ON}  LOT6FMN-de...    30   5.0  
KLLA0F22341g Chr6 complement(2088007..2088966) [960 bp, 319 aa] ...    30   7.3  
TDEL0F00330 Chr6 (50658..53711) [3054 bp, 1017 aa] {ON} Anc_1.52...    30   7.9  
SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} simila...    30   8.1  
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    30   8.4  

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/313 (100%), Positives = 313/313 (100%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEIL 60
           MSVEAYDDDEFPTCVVHILPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEIL
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEIL 60

Query: 61  AISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVGAY 120
           AISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVGAY
Sbjct: 61  AISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVGAY 120

Query: 121 MVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIVF 180
           MVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIVF
Sbjct: 121 MVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIVF 180

Query: 181 GWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQ 240
           GWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQ
Sbjct: 181 GWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQ 240

Query: 241 AELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPHSF 300
           AELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPHSF
Sbjct: 241 AELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPHSF 300

Query: 301 VVRRSKYVVEHYF 313
           VVRRSKYVVEHYF
Sbjct: 301 VVRRSKYVVEHYF 313

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/320 (46%), Positives = 206/320 (64%), Gaps = 18/320 (5%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTAEIN---PVFVWIPGNPGILEYYQEMLINLHEKHPTW 57
           M+++ Y D  +PT +VH  P K  +I    P+F+WIPGNPG+LEYY +ML +LH+K+PTW
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 58  EILAISHIGMNTKTTSLFKGSHQDN---SRVFTLKEQIQHKIKIINNFVKDSNVPIYISG 114
           EIL +SH GM+        G+   N   ++V+TL EQ+ HK+++INNF       I I G
Sbjct: 61  EILGVSHAGMS-------NGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKR-NIIIMG 112

Query: 115 HSVGAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSF 174
           HSVGAYM Q+++    LIG V+K+GL+TPT++DIH S KG  MTR A    R+LP  L  
Sbjct: 113 HSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTR-AFNLFRELPIFLGL 171

Query: 175 LCYIVFGWLVPGILRSYIIGYVMGC-HHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTI 233
           L  + F  L P I   +++  +MGC ++D+ AA ++ +FLT  +FV+Q LGLA  EM  I
Sbjct: 172 LSTLAFSKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHI 231

Query: 234 HDDWQFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVS 293
            DDW FQ  LI+YC K ++   FLFS+TDHWV + TR E+I FY+  CK    +L + VS
Sbjct: 232 RDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKS--DILDVSVS 289

Query: 294 DQFPHSFVVRRSKYVVEHYF 313
           +  PHSFV+  S + V  YF
Sbjct: 290 NIIPHSFVINFSDFTVNSYF 309

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  287 bits (735), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 138/315 (43%), Positives = 207/315 (65%), Gaps = 9/315 (2%)

Query: 3   VEAYDDDEFPTCVVHILPIK---TAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEI 59
           V+ ++D  +PT +VH+ P+    + E +P+FVWIPGNPG+LEYY + L  +H+K+PTWE+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 60  LAISHIGMN-TKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118
           L ISH GM+        K S  D  +VF L+EQ+QHK+ IIN F    N P+ I GHSVG
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKF-SSKNRPLIIMGHSVG 122

Query: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178
           AY+ Q+++ +++L G+++K+G +TPT++DIHLS+KG  MT+   W+   LPH + ++   
Sbjct: 123 AYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTS-NLPHHVGWISQF 181

Query: 179 VFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQ 238
           +F  L+P     + I  ++ C  DS A +++   L   N + Q+LGLA  EM+ IHDDW 
Sbjct: 182 IFHKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWG 241

Query: 239 FQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPH 298
           F  +LI+YC +  +K  FLF+  DHWV  +TRKE+I FYQ   K     ++ID+ D  PH
Sbjct: 242 FHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPEN--IRIDI-DTIPH 298

Query: 299 SFVVRRSKYVVEHYF 313
           +FV+++SKY+V+ YF
Sbjct: 299 AFVIKKSKYIVDQYF 313

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  284 bits (726), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 202/316 (63%), Gaps = 15/316 (4%)

Query: 1   MSVEAYDDDEFPTCVVHILPI--KTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58
           M+V+ Y   + P  +++I P   K+ E  P+ VWIPGNPG+L YYQEML +LH KHP WE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118
           IL ISH GM     S        N+ +F+L++Q+ H++++INNF    N  I I GHSVG
Sbjct: 61  ILGISHAGMTLNAHS--------NTPIFSLQDQVDHQVEVINNF-SCKNRKIIIMGHSVG 111

Query: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178
           AY+VQK+  S++L+G V K+GL+TPT++DIH SE G  MT   R+    L H++S   YI
Sbjct: 112 AYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRY-IPPLAHVVSLFSYI 170

Query: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237
            F W++      +II   MGC     QA +ST +FLT   FVRQSLGLA +EM+ I  +W
Sbjct: 171 FFYWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNW 230

Query: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297
           +FQ   I YC +N I I FLFS+ DHWV   TR  +  +Y+++ K  +  LKIDV+D+ P
Sbjct: 231 EFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQER--LKIDVTDKIP 288

Query: 298 HSFVVRRSKYVVEHYF 313
           HSFVV+ ++Y +  +F
Sbjct: 289 HSFVVKHAEYAINAFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  283 bits (725), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 203/316 (64%), Gaps = 15/316 (4%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTA--EINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58
           MS++ Y   + P  +++I P  T   E  P+ VWIPGNPG+L YYQEM+ +LH KHP WE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118
           IL ISH GM++   S        N+ +F+L++Q+ H++K+INNF  D N  I I GHSVG
Sbjct: 61  ILGISHAGMSSNARS--------NTPIFSLQDQVDHQVKVINNFSHD-NRKIIIMGHSVG 111

Query: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178
           AY+VQK+  S+EL+G V K+GLITPT++DIH SE G  MT    +    L H+LSF+ Y+
Sbjct: 112 AYIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHY-VPALAHVLSFISYV 170

Query: 179 VFGWLVPGILRSYIIGYVMGCH-HDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237
            F W++   L   II   MGC     +A +ST LFLT   FVRQSLGLA +E+  I  +W
Sbjct: 171 FFYWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNW 230

Query: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297
           +FQ + I +C +  I   FLFS  DHWV + TRK +  +Y ++ K  +  L+IDV+D+ P
Sbjct: 231 EFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVK--QEHLRIDVTDKMP 288

Query: 298 HSFVVRRSKYVVEHYF 313
           HSFVV+ ++Y +  +F
Sbjct: 289 HSFVVKHAEYAINAFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  281 bits (719), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 199/316 (62%), Gaps = 15/316 (4%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTAEIN--PVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58
           M V+ Y     P  +++I P    E    P+ VWIPGNPG+L YYQEML +LH KHP WE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118
           IL +SH GM     S        N+ +F+L++Q+ H++++INNF  + N  I I GHSVG
Sbjct: 61  ILGVSHAGMTLNAHS--------NTPIFSLQDQVDHQVEVINNFSHE-NRKIIIMGHSVG 111

Query: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178
           AY++QK+  SD+L+G V K+GLITPT++DIH SE G  MT    +    L H++S L Y+
Sbjct: 112 AYILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHY-IPPLAHVVSLLSYV 170

Query: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237
            F W++   L  ++I   MGC     QA +ST + LT   FVRQSLGLA +EM  I  +W
Sbjct: 171 FFYWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNW 230

Query: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297
           +FQ E I YC +N I I FLFS  DHWV + TR  +  +Y+++ K  +  LKIDV+D+ P
Sbjct: 231 EFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQER--LKIDVTDKIP 288

Query: 298 HSFVVRRSKYVVEHYF 313
           HSFVV+ ++Y V  +F
Sbjct: 289 HSFVVKHAEYAVNTFF 304

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  280 bits (715), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 204/315 (64%), Gaps = 9/315 (2%)

Query: 1   MSVEAYDDDEFPTCVVHI--LPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58
           M+   Y    +PT +VH   + I+     P+FVWIPGNPG++EYY+E L+ +H +HP WE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118
           +L ISH GM+T + S  K    + + V++LK+QI HK++II +F   +N P+ I GHSVG
Sbjct: 61  VLGISHAGMSTASVS--KSEKSERNDVYSLKQQIDHKLEIIKDF-SSTNRPLIIMGHSVG 117

Query: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178
           AYMVQ IV SD+L+G+V KMGL+TPTI+DIH S+KG  +T+   W  + LP +  +   +
Sbjct: 118 AYMVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYW-LKDLPQLAGWFSSL 176

Query: 179 VFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQ 238
           +FG+ +P  +   ++ + MGCH +S   ++T + L    FV+Q+LGL+  EM+ I  DW 
Sbjct: 177 LFGFFLPSFILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWA 236

Query: 239 FQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPH 298
           FQ  LI +C +  I    LFS +DHWV + TR+++I+FY++  +  K  +KI    + PH
Sbjct: 237 FQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADK--IKIHTC-KIPH 293

Query: 299 SFVVRRSKYVVEHYF 313
           SFV+  SKY++  YF
Sbjct: 294 SFVLNHSKYLISEYF 308

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  275 bits (702), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 150/334 (44%), Positives = 207/334 (61%), Gaps = 26/334 (7%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTAE----INPVFVWIPGNPGILEYYQEMLINLHEKHPT 56
           M V++Y + ++PT ++HI   K  E    +NP+F+WIPGNPGIL+YYQ+ L +LH+KHP 
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 57  WEILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNV-------- 108
           WEILAI H GM+T   SL    H  N R++ L EQI+HKI++I  F+  +N         
Sbjct: 61  WEILAIPHAGMDT---SLPVYRH-PNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKR 116

Query: 109 PIYISGHSVGAYMVQKIVASDELIGQVL-------KMGLITPTIIDIHLSEKGKSMTRYA 161
           P+ I GHSVG YM+Q++V + E    +L       K+G ITPTIIDI+LS KG  ++   
Sbjct: 117 PLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGL 176

Query: 162 RWSCRQLPHILSFLCYIVFGWLVPGI--LRSYIIGYVMGCHHDSQAAISTELFLTGPNFV 219
           + +   LP+ILS+L Y VF  ++     +R  +I Y+MGC     AAI TE+ LT    V
Sbjct: 177 QLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLV 236

Query: 220 RQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQE 279
           +QSLGLA  EM  I  +W  Q + +E C  N I++  LF  TDHWV   TR ++I+FYQ 
Sbjct: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296

Query: 280 RCKGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF 313
             K   + L+I+VS +FPHSFVV  S +VVE +F
Sbjct: 297 NYKDI-SRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  272 bits (695), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 198/316 (62%), Gaps = 15/316 (4%)

Query: 1   MSVEAYDDDEFPTCVVHILPI--KTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58
           M ++ Y   +FP  +++I P   ++ E   + VWIPGNPG+L YYQEML  LH KHP WE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118
           IL ISH GM     S        N+ V++L++Q+ H++++INNF  + N  I I GHSVG
Sbjct: 61  ILGISHAGMTLNAHS--------NTPVYSLQDQVDHQVEVINNFSHE-NRKIIIMGHSVG 111

Query: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178
           AY++QK+  S  L+G V K+GL+TPT++DIH SE G  +T    +    L H++S   YI
Sbjct: 112 AYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHY-IPPLAHVVSLFSYI 170

Query: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237
            F W++      +II   MGC   S QA +ST +FLT   FVRQSLGLA +EM+ I  +W
Sbjct: 171 FFYWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNW 230

Query: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297
           +FQ + I YC +N   I FLFS+ DHWV   TR  +  +Y+++    +  L+IDV+D+ P
Sbjct: 231 EFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNR--LEIDVTDKIP 288

Query: 298 HSFVVRRSKYVVEHYF 313
           HSFVV+ +KY +  +F
Sbjct: 289 HSFVVKHAKYAINTFF 304

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  265 bits (676), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 204/324 (62%), Gaps = 19/324 (5%)

Query: 1   MSVEAYDDDEFPTCVVHI--------LPI---KTAEINPVFVWIPGNPGILEYYQEMLIN 49
           M++  + D +FPT ++ I        L +   KT +++P+FVWIPGNPG+LEYY+E L  
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 50  LHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVP 109
           LH K+P W+IL ISH GM++  ++L     ++   V+TL EQI HKI+IIN F       
Sbjct: 61  LHVKNPEWDILGISHAGMSSGNSNL----KENECSVYTLDEQIHHKIEIINKFAAYGR-E 115

Query: 110 IYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLP 169
           + + GHSVGA+M QK+V S++L G+V K+GL+ PT+IDIHLSEKG  ++    W    LP
Sbjct: 116 LIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNW-IPNLP 174

Query: 170 HILSFLCYIVFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEE 229
            +  ++   +FG  +P  L  +II + M  +++++AA +T  FL   NFV QSLGLA+ E
Sbjct: 175 QLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYE 234

Query: 230 MDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLK 289
           M  I  DW+FQ EL++ C  N I++  LF+ +DHWV   TR E+I+ Y+           
Sbjct: 235 MQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNS--DYYS 292

Query: 290 IDVSDQFPHSFVVRRSKYVVEHYF 313
             ++DQ PH+FV++ S +VV++YF
Sbjct: 293 YSITDQVPHAFVIKNSCHVVDNYF 316

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  264 bits (674), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 142/316 (44%), Positives = 188/316 (59%), Gaps = 7/316 (2%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTA--EINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58
           MSV+ Y D   PTC++HI P  T   E +P+FVWIPGNPG+LEYYQE L  +H+K+PTWE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118
           IL ISH G   +++ L K   ++   ++ LK+Q QHKI IIN    D N  + I GHSVG
Sbjct: 61  ILGISHAGTVIESSQL-KKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVG 119

Query: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178
           AY+ Q +V+S +L+G+V K+GLITPTI DIH S  G   TR   +    +   LSF+   
Sbjct: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNY-ISNVNEYLSFISSN 178

Query: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237
           +F  L+P      +I + MGC  D     + T L LT    +RQ LGLA  EM  I DDW
Sbjct: 179 IFNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDW 238

Query: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297
            FQ  L+  C  N  K+  LFS  DHWV + T+ E+I+F ++R    + LL++DV     
Sbjct: 239 AFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRY--PELLLRVDVDKDIK 296

Query: 298 HSFVVRRSKYVVEHYF 313
           HSFVV+    V   YF
Sbjct: 297 HSFVVKDVDLVTRRYF 312

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  256 bits (654), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 135/314 (42%), Positives = 199/314 (63%), Gaps = 10/314 (3%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEIL 60
           MS+        PT V+HI P   +  +P+FVWIPGNPGI++YY+E L  LHEK+ ++EIL
Sbjct: 1   MSIRYLAGARLPTSVLHIKPKSPSPSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEIL 60

Query: 61  AISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNF-VKDSNVPIYISGHSVGA 119
           AISH GM T+   L     +  + ++TL +QIQHK++IIN F  KD   P+ + GHSVGA
Sbjct: 61  AISHAGMATEDPDL----QKRKATIYTLDDQIQHKVEIINQFSAKDR--PLIVMGHSVGA 114

Query: 120 YMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIV 179
           YM Q +V +++L+G+V+K+GLITPT++DIH S+KG  +TR   W  + LP I +++  ++
Sbjct: 115 YMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYW-VKYLPDIAAWVSDML 173

Query: 180 FGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQF 239
           F  L   +    +I   MG   +S    +++  +  P  +RQ+LGLA  EM  I   W F
Sbjct: 174 FNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPF 233

Query: 240 QAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPHS 299
           Q +LI++C  N I+ +F+FSA D WV  ATR+ ++ FY+E  +     L+I VS    HS
Sbjct: 234 QKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRN--LEISVSQDLAHS 291

Query: 300 FVVRRSKYVVEHYF 313
           F+V+ SKY+V+ YF
Sbjct: 292 FIVKHSKYIVDEYF 305

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  244 bits (622), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 129/288 (44%), Positives = 184/288 (63%), Gaps = 17/288 (5%)

Query: 28  PVFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFT 87
           P+FV+IPGNPG++E+Y+  L  +HEK+P WEIL ISH GMN+ +        ++ S V++
Sbjct: 30  PLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCS--------EEVSPVYS 81

Query: 88  LKEQIQHKIKIINNFVKDSNVPIYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIID 147
           L++QI HKI+IIN +  D   PI I GHSVGA+MVQKI  S  L  +V+++GL+TPT+ID
Sbjct: 82  LEQQIDHKIEIINRYCLDGK-PIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVID 140

Query: 148 IHLSEKGKSMTRYARWSCRQLPHILSFLCYIVFGWLVPGILRSYIIGYVMGCHHDSQAAI 207
           IH SEKG  +T   RW C    +++S L + +F  L+P  +   II  ++    D Q+ +
Sbjct: 141 IHKSEKGVKLTSITRW-CPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD---DPQSCL 196

Query: 208 --STELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHWV 265
             +TEL +T   FV+Q+LGLA EE+  I  DW +Q E +  C +N  KI +LFS  DHWV
Sbjct: 197 GATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWV 256

Query: 266 REATRKEIIQFYQERCKGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF 313
              TR +II FY++    + AL +IDVS    H+FV R +  V++ YF
Sbjct: 257 SPTTRNDIIDFYRQH--SSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  239 bits (609), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 191/315 (60%), Gaps = 14/315 (4%)

Query: 1   MSVEAYDDDEFPTCVVHILPIKTAEIN---PVFVWIPGNPGILEYYQEMLINLHEKHPTW 57
           M ++ Y  + F + + H+ P+   E+N   P+FV+IPGNPG++E+Y+  L  + +KH  W
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPL-NQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNW 59

Query: 58  EILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSV 117
           EIL ISH GM TK   L K +     +V++LK+Q+QHKI +IN+F   SN P+ I+GHS+
Sbjct: 60  EILGISHAGMITKCKGLKKPT-----KVYSLKDQVQHKIYVINDFC-SSNRPLIIAGHSI 113

Query: 118 GAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCY 177
           GAY+VQKI     L+G V K+ L+TPT+IDIHLSEKG+ +     W C      ++   +
Sbjct: 114 GAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEW-CPNFHSYVATASW 172

Query: 178 IVFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237
           +VF  ++P  +   I+   +G    +    + +L +T   FV+QSLGLA+EEM  + DDW
Sbjct: 173 LVFEKMLPQTITEKILSLFVGSEQ-TCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDW 231

Query: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297
            FQ   +++C    +++QFLF+  DHWV   TR ++ +FY       K  L ID  ++  
Sbjct: 232 NFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNY--YKDFLTIDEDEKIS 289

Query: 298 HSFVVRRSKYVVEHY 312
           HSFV+  +K VV+ Y
Sbjct: 290 HSFVLNDTKSVVDRY 304

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  230 bits (587), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 176/289 (60%), Gaps = 21/289 (7%)

Query: 29  VFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFTL 88
           +FV+IPGNPG++EYY   L  +HEK+P WEIL ISH GMN+         +     V+TL
Sbjct: 31  LFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS--------CNDIACPVYTL 82

Query: 89  KEQIQHKIKIINNFVKDSNVPIYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIIDI 148
           +EQI HK+ +IN++ +  N  I I GHSVGA++ QK+V S  L  +V ++GL+TPT+IDI
Sbjct: 83  QEQINHKVDVINSYAQ-GNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTPTVIDI 141

Query: 149 HLSEKGKSMT----RYARWSCRQLPHILSFLCYIVFGWLVPGILRSYIIGYVMGCHHDSQ 204
           H SEKG  +T    R+ R+       ++S L +I F  L P  L S+II +         
Sbjct: 142 HKSEKGLKLTAITERFPRFH-----QLVSALDWIAFEKLFPDFLTSWIISHFADDPKTCL 196

Query: 205 AAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHW 264
            A +T L LT   FV+Q+LGLA EEM  I  DW++Q + + YC     KI +LFS  DHW
Sbjct: 197 GA-ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLFSDNDHW 255

Query: 265 VREATRKEIIQFYQERCKGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF 313
           V   TRK++IQFY+     +  L+ IDVS    H+FV R ++ VV+HYF
Sbjct: 256 VSSETRKDLIQFYERH--SSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  228 bits (581), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 185/306 (60%), Gaps = 12/306 (3%)

Query: 12  PTCVVHILPIKTAEINP--VFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNT 69
           P     +L I +  I P  + +++PGNPG++ +Y+E L ++HEK+PTWEI+ ISH GM+ 
Sbjct: 22  PDIDADMLHIWSEWIQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSA 81

Query: 70  KTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKD-SNVPIYISGHSVGAYMVQKIVAS 128
           KT        +D  RV+TL EQ++HK+K IN+FV++  N+ + + GHS+GAYM QK+V  
Sbjct: 82  KTGP------EDLKRVYTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVH 135

Query: 129 DELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIVFGWLVPGIL 188
             L   V  +GL+TPTIIDIH S KG  +TR + W  R   ++ S +  ++  WL+P   
Sbjct: 136 PALRVNVEMVGLLTPTIIDIHRSPKGVQLTRISEWFPRFYEYV-SIVDRVLLEWLLPATW 194

Query: 189 RSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCL 248
            S++   ++G   D     S E  +  P++VRQ+LG+AQ EM  + + W FQ E I+ C 
Sbjct: 195 ISWLARKIIGGS-DECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQ 253

Query: 249 KNSIKIQFLFSATDHWVREATRKEIIQFYQER-CKGAKALLKIDVSDQFPHSFVVRRSKY 307
           +    +  LFS  DHWV   T K+I++FY+ +    A +LL+I + +   HSFVV+ +  
Sbjct: 254 ERRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTK 313

Query: 308 VVEHYF 313
           VV  YF
Sbjct: 314 VVNIYF 319

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  213 bits (543), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 182/317 (57%), Gaps = 18/317 (5%)

Query: 3   VEAYDDDEFPTCVVHILPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEILAI 62
           +E Y  ++    ++HI    T    P+ ++IPGNPG++ +Y+E L  +HE++PTWE++ I
Sbjct: 1   METYLREDIFADILHIYSQSTPP-GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGI 59

Query: 63  SHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVK-DSNVPIYISGHSVGAYM 121
            H GM++      + ++  + RV TL EQI+ K+K+IN FV    +  I + GHS+GAYM
Sbjct: 60  GHTGMSS-----LRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYM 114

Query: 122 VQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIV-- 179
           VQKI     L G++  + L+TPTIIDIH S KG  +TR + W     P    +  Y+V  
Sbjct: 115 VQKIALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDW----FPKFYEY-AYVVDR 169

Query: 180 --FGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237
             F W++P     +I   ++G   D     S +  ++ P FV+Q+LGLAQ EM  + + W
Sbjct: 170 VLFKWILPTSWIEWIARKLIGGS-DECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQW 228

Query: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQER-CKGAKALLKIDVSDQF 296
            FQ E I +C  N IK++FLFS  DHWV   T K+II+ Y+ +     K LL I +    
Sbjct: 229 DFQDEFISFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHI 288

Query: 297 PHSFVVRRSKYVVEHYF 313
            HSFVV+ +  VV  YF
Sbjct: 289 NHSFVVKDTTKVVNIYF 305

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 65/155 (41%), Gaps = 18/155 (11%)

Query: 28  PVFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFT 87
           P++V++PG  G L+ Y+ +L          +IL    IG +      F GS +D S    
Sbjct: 95  PIYVFLPGLGGSLDQYEPLL-------RLMDILNEKFIGFDLPG---FGGSEEDTSEGGY 144

Query: 88  LKEQIQHKIK------IINNFVKDSNVPIYISGHSVGAYMVQKIVASDELIGQ--VLKMG 139
              ++ H I       I  N+     + + + GHS+G Y+V     S +   +  + ++ 
Sbjct: 145 NMIKVCHIINEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLI 204

Query: 140 LITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSF 174
           L +P    I   +K   + ++      +LP I  F
Sbjct: 205 LTSPPKKKIEPLDKNNRLNQFGLQLLYKLPIIQDF 239

>KNAG0A04020 Chr1 complement(540691..541875) [1185 bp, 394 aa] {ON}
           Anc_8.492 YDR254W
          Length = 394

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 102 FVKDSNVPIYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSE 152
           F++DS VPI I     G Y          LI Q +K  L T T+I +H +E
Sbjct: 185 FMEDSEVPIIIHTAETGVYAT--------LIQQAVKRALSTRTVIHLHDNE 227

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/147 (19%), Positives = 62/147 (42%), Gaps = 5/147 (3%)

Query: 28  PVFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFT 87
           P+ ++I G  G L  ++ +L   H K   +  L +   G + +  S     +   S + T
Sbjct: 82  PLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELES-----YSMKSVIET 136

Query: 88  LKEQIQHKIKIINNFVKDSNVPIYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIID 147
           ++  +        +  +++ + + ++GHS+G Y+      +      + K+ L++P    
Sbjct: 137 IRSVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSPPKPI 196

Query: 148 IHLSEKGKSMTRYARWSCRQLPHILSF 174
           +    K    T++A W   +LP I   
Sbjct: 197 MTSLSKRNYWTQWALWGVFKLPFIFDL 223

>KLTH0F15554g Chr6 complement(1271266..1272909) [1644 bp, 547 aa]
           {ON} conserved hypothetical protein
          Length = 547

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 9/85 (10%)

Query: 61  AISHIGMNTKTTSLFKGSH-QDNSRVFTLKE---QIQHKIK-----IINNFVKDSNVPIY 111
           A+ ++G  T+ T LF+    Q ++R+  LK    Q  H +      ++ N ++  +VP  
Sbjct: 292 AVEYVGQATRRTDLFRDPQIQQDARMIALKNKASQDDHHLPFTEYVVVANKLQSRDVPAE 351

Query: 112 ISGHSVGAYMVQKIVASDELIGQVL 136
              H  G       +  D +IG  L
Sbjct: 352 EQQHHHGIEFFSTYIGEDNMIGTAL 376

>YLR011W Chr12 (169103..169678) [576 bp, 191 aa] {ON}
           LOT6FMN-dependent NAD(P)H:quinone reductase, may be
           involved in quinone detoxification; expression elevated
           at low temperature; sequesters the Cin5p transcription
           factor in the cytoplasm in complex with the proteasome
           under reducing conditions
          Length = 191

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 13/89 (14%)

Query: 117 VGAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKG--------KSMTRYARWSCRQL 168
           + AY+ + I  S+ELI Q LK+ ++    I + L E          KS+  YA    R  
Sbjct: 19  IAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIKSVDEYADSKTRSW 78

Query: 169 PHILSFLCYIVF-----GWLVPGILRSYI 192
             I++ L  IVF      W  P  L++ I
Sbjct: 79  SRIVNALDIIVFVTPQYNWGYPAALKNAI 107

>KLLA0F22341g Chr6 complement(2088007..2088966) [960 bp, 319 aa]
           {ON} no similarity
          Length = 319

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 245 EYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAK 285
           E C K   K++F ++AT +WV    R+E  +  +E  K AK
Sbjct: 189 EVCQK---KLKFTYAATSNWVSTTVRRENFESVKEWTKNAK 226

>TDEL0F00330 Chr6 (50658..53711) [3054 bp, 1017 aa] {ON} Anc_1.528
           YKL210W
          Length = 1017

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 203 SQAAISTELFLTGPNFVRQSL---GLAQEEMDTIHDDWQFQAELIEYCLK 249
           + AA +  L+LT PNFV Q+L   G  +  ++T+ +    + +  + C+K
Sbjct: 620 TDAAENVNLYLTNPNFVEQTLKQSGDVKSILETVEESLTEKPQTFDDCIK 669

>SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} similar
          to uniprot|P53038 Saccharomyces cerevisiae YGR099W TEL2
          Essential DNA-binding protein specific to
          single-stranded yeast telomeric DNA repeats required
          for telomere length regulation and telomere position
          effect
          Length = 721

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 32 WIPGNPGILEYYQEMLINLHEKHPTWEILAISH 64
          +IPG+ G LE ++E+L ++HE   TW + +I++
Sbjct: 15 FIPGH-GNLELFEEVLFHIHEFKKTWSVNSINY 46

>KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some
           similarities with uniprot|P38623 Saccharomyces
           cerevisiae YLR248W RCK2 Protein kinase involved in the
           response to oxidative stress identified as suppressor of
           S. pombe cell cycle checkpoint mutations
          Length = 565

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 64  HIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVGAY--M 121
           H+ +          S +D+    T +EQ+  ++ I        NV  ++  H   +Y  +
Sbjct: 171 HVAIKVINKKHLTSSQKDSKSKATSREQVLKEVAIHRTVSASENVVSFVDFHESPSYYFI 230

Query: 122 VQKIVASDELIGQVLKM 138
           VQ+++A  E+ G+++++
Sbjct: 231 VQELLAGGEIFGEIVRL 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,433,331
Number of extensions: 1403574
Number of successful extensions: 5052
Number of sequences better than 10.0: 33
Number of HSP's gapped: 5155
Number of HSP's successfully gapped: 33
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)