Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F035103.483ON57557530380.0
NDAI0B058103.483ON57757727450.0
Kpol_480.193.483ON57457226770.0
CAGL0I10648g3.483ON57457226610.0
KNAG0A079203.483ON57857726180.0
Suva_16.4743.483ON57257326180.0
TDEL0D055203.483ON57357226060.0
Smik_6.2203.483ON57257226050.0
KAFR0G036703.483ON57257225990.0
Skud_7.4353.483ON57257225990.0
Smik_16.3963.483ON57257325990.0
YPR145W (ASN1)3.483ON57257325990.0
KLLA0B10868g3.483ON57457325890.0
Suva_7.4103.483ON57257425880.0
YGR124W (ASN2)3.483ON57257225870.0
TPHA0D042003.483ON57457225760.0
TBLA0C044303.483ON58058025750.0
Skud_16.4393.483ON57257325700.0
SAKL0F02970g3.483ON57357525670.0
KLTH0F14630g3.483ON57357325440.0
Kwal_55.211873.483ON57357225400.0
AFR303W3.483ON57157225120.0
ZYRO0B04136g3.483ON57257324960.0
Ecym_12443.483ON57357224030.0
ZYRO0A00528g8.875ON5121031412e-08
Kpol_455.78.875ON518941351e-07
KLLA0D10285g8.875ON5154201313e-07
NDAI0K001808.875ON5222171224e-06
TPHA0C049508.875ON525991224e-06
Skud_13.468.875ON5191131206e-06
KAFR0L021108.875ON514951197e-06
ADL350C8.875ON508941181e-05
KNAG0J002008.875ON5151021172e-05
YML096W8.875ON525951162e-05
NCAS0C001908.875ON5171051152e-05
Suva_13.528.875ON519991153e-05
TBLA0C063008.875ON5182701143e-05
Smik_13.398.875ON521961134e-05
TDEL0B004408.875ON516941135e-05
SAKL0D00352g8.875ON515731101e-04
KLTH0E16412g8.875ON5154451082e-04
Ecym_81558.875ON513831054e-04
CAGL0H06963g8.875ON517931038e-04
Kwal_27.97058.875ON515991020.001
Skud_7.311singletonON8188910.001
SAKL0E13200g2.59ON152121790.20
KNAG0B001601.515ON2516104800.55
KLLA0F14531g8.222ON34166741.9
NCAS0G034401.515ON2459111742.3
KNAG0G002701.515ON2453100742.5
SAKL0E11066g2.147ON96543724.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03510
         (575 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1174   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...  1061   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1035   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1029   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...  1013   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1013   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1008   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1008   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1005   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1005   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1005   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1005   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1001   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1001   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1001   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   996   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   996   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   994   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   993   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   984   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   983   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   972   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   966   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   930   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    59   2e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    57   1e-07
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    55   3e-07
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    52   4e-06
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    52   4e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    51   6e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    50   7e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    50   1e-05
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    50   2e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    49   2e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    49   2e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    49   3e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    49   3e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    48   4e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   5e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    47   1e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    46   2e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    45   4e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    44   8e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    44   0.001
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    40   0.001
SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285) ...    35   0.20 
KNAG0B00160 Chr2 complement(10663..18213) [7551 bp, 2516 aa] {ON...    35   0.55 
KLLA0F14531g Chr6 (1349155..1350180) [1026 bp, 341 aa] {ON} weak...    33   1.9  
NCAS0G03440 Chr7 (634813..642192) [7380 bp, 2459 aa] {ON} Anc_1....    33   2.3  
KNAG0G00270 Chr7 complement(35502..42863) [7362 bp, 2453 aa] {ON...    33   2.5  
SAKL0E11066g Chr5 (928800..931697) [2898 bp, 965 aa] {ON} simila...    32   4.7  

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/575 (97%), Positives = 563/575 (97%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDGN 575
           AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDGN
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDGN 575

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/577 (86%), Positives = 531/577 (92%), Gaps = 3/577 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAF+HEDV A+KP+ALQL+KRIRHRGPDWSGNV+KNTTILAHERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQIRE+  DY FKTLSDCEPIIPLYLK+D+D PKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYD+KQDRI+AARDPIGITTLYMGR SKTPQTV+FASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRYF PDWLDE RIP   +DL AIRE+LE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGE---HHKHLTGVDDEGHLHTGGWSRLHSFAIGLPN 297
             IASIAARETEKA     +++EN        HLTGVDDEGHLH GGWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 298 APDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 357
           APDLQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 417
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILW 477
           LEARVPFLD++FLQLCMNIDPK+KMI+QA G+IEKYILRKAFDT+DDPE KPYLP+EILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 478 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYP 537
           RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPK HWG D+PTTKEAYWYRLKFDALYP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 538 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDG 574
           QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV+ 
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/572 (84%), Positives = 532/572 (93%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAA++HE+ +A+KP+ALQL+KRIRHRGPDWSGNVVKN+TIL HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSPCG+Y LCVNGEIYNHIQ+RE C DY++KTLSDCEPIIPLYLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYDAK+DRI+AARDPIGITTLYMGR SK+P+TV+FASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRYF+PDW+DE RIP+ PV  KAIRE+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETEKAM+++D    + E  KHLTG+DD+G+LHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSED-KHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           L AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFLQLCMNIDP +KMI+ + G+IEKYILRKAFDT+D+P+EKPYLP+EILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAERVISD +F  PK HWG D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA+TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 AAETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1029 bits (2661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/572 (84%), Positives = 523/572 (91%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAA++H+DV A+KPKALQL+KRIRHRGPDWSGNVVKN+TI+ HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G+YTLCVNGEIYNHIQ+RE+  DY+FKTLSDCEPIIP YL++D+DAPK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYDAKQDRIVAARDP+GITTLYMGR S +P+TV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRYF PDW+DE RIP+TPV+ K IRE+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETEKA ++ D  D +    K L G+D++GHLHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLDKEFLQLCMNIDPKDKMIDQ++G+IEKYILRKAFDT+D+P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAERVISD MF NPK  WG D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA TVMRWIPKADWGCAEDPSGRYAKIHE+HV
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/577 (83%), Positives = 524/577 (90%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFA FRHEDV+A+KP+ALQL+KRIRHRGPDWSGN++KN+TI+AHERL+IVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSPCG+Y L VNGEIYNHIQ+REEC +YQ+K+LSDCEPIIP+YLKYDLDAPKHLDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYDAK+DRIVAARDPIGITTLYMGR S  P+TV+FASELKCLTDDCD+I+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+ P+WLDE +IPSTPVDLK IR TLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDV----EDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLP 296
             IA+IAARETEKA +++D     E E  E H HL G+DDEG+L +  WSRLHSFAIGLP
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGH-HLAGIDDEGNLLSATWSRLHSFAIGLP 299

Query: 297 NAPDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRK 356
            APDL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRK
Sbjct: 300 GAPDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRK 359

Query: 357 IKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAW 416
           IKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAW
Sbjct: 360 IKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAW 419

Query: 417 GLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEIL 476
           GLEARVPFLDKEFL LCMNIDPKDK+I+Q  G+IEKYILRKAFDT D+P+ KPYLP+EIL
Sbjct: 420 GLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEIL 479

Query: 477 WRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALY 536
           WRQKEQFSDGVGYSWIDGLKDTAE VISD MF  PK HWG DVPTTKEA+WYRLKFDAL+
Sbjct: 480 WRQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALF 539

Query: 537 PQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
           PQ TAA+TVMRWIPKADWGCAEDPSGR+AKIHE+HV+
Sbjct: 540 PQPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/573 (83%), Positives = 514/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAF+HEDV  YKPKALQL+KRIRHRGPDWSGN VKN+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+REEC DYQFKTLSDCEPIIP+YLK+D+DAPK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYDAKQDRI+AARDPIGITTLYMGR S +P+TVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTP+D  AIR +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARET KA  DV+    + +  +HL GVDDEG+LHT GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKA-RHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFLQLCMNIDP +KMI    G+IEKYILRKAFDTTD+PE KPYLP+EILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWID LKDTAE VISD MF NPK  WGND+PTTKEAYWYRLKFD L+PQKT
Sbjct: 480 EQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
            ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+D
Sbjct: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/572 (82%), Positives = 522/572 (91%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAA +HEDV+AYK KALQL+KRIRHRGPDWSGNV++N T+L HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHI++REE +DY+F TLSDCEPIIPLY KYD+D PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYDAKQDRI+AARDP+GITTLYMGR S +P+TV+FASELKCLTDDCD+IVAFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPS PVD KAIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETEKA  ++D +  + E  KHL G+DD G+LH+ GWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSED-KHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           L+AA KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFLQLCMNIDPKDKMI++  G++EKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAERVISD +F  PK  WG+DVPTTKEA+WYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AADTVMRW+PKADWGCAEDPSGR+A+IH++HV
Sbjct: 540 AADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/572 (83%), Positives = 519/572 (90%), Gaps = 2/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAF+H+D+ ++KPKALQL+KRIRHRGPDWSGN V N+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G Y L VNGEIYNHIQ+REEC+DY+F+T SDCEPIIPLYL++D+DAPK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           A+C+YDAK+DRIVAARDPIG+ TLYMGR SK+P+TVYFASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTPVD  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARETEKA  + DV +E+    K L G+DD+GHLHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKA--NADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLDK+FLQLCMNIDPKDKMI    GKIEKYILRKAFDTT++P+ KPYLP+EILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGL+DTAERVISD MF NPK  WG+D+PTTKEAYWYRLKFDA +PQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA+TVMRW+PKADWGCAEDPSGRYAKIHEKHV
Sbjct: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/572 (82%), Positives = 515/572 (90%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAFRHEDV ++K KALQL+KRIRHRGPDWSGNVVKN+TI+ HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQ+RE+  DY+FKTLSDCEPIIPLYL+ D+DAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYD+K+DRI+AARDPIG+TTLYMGR S +P+TV+FASELKCL DDCDSIVAFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF P+W+DE++IP+TPVD  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETE A +++D   +  E   HL G+DDEGHL T GWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEAANRELDAS-QYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           L AA+KVAKFIGS+HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFL LCMNIDP DK+I+Q  G+IEKYILRKAFDT DDP  KPYLP EILWRQK
Sbjct: 420 RVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWID LKDTAE+VISD MF NPK HWG D+PTTKEAYWYRLKFDAL+PQ T
Sbjct: 480 EQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA+TVMRWIPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 AAETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/572 (82%), Positives = 516/572 (90%), Gaps = 2/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAF+HED+ ++KPKALQL+KRIRHRGPDWSGN V N+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PI S  G Y L VNGEIYNHIQ+RE+C+ Y+F+T SDCEPIIPLYL++D+DAPKHLDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           A+CLYDAK+DR+VAARDPIG+ TLYMGR SK+P+TVYFASELKCLTD CDSI++FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF P+WLDE RIPS PVD  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARETEKA  D D   +   ++K L G+DD+GHLHT GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIAAIAARETEKANADAD--GDASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPD 298

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD++FLQLCMNIDPKDKMI+   G+IEKYILRKAFDTTD+PE KPYLP+EILWRQK
Sbjct: 419 RVPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQK 478

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGL+DTAERVISD MF NPK  WGND+PTTKEAYWYRLKFDA +PQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AADTVMRW+PKADWGCAEDPSGRYAKIHEKHV
Sbjct: 539 AADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/573 (82%), Positives = 513/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAF+HEDV  YKPKALQL+KRIRHRGPDWSGN +KN+TI  HERL+IVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+REEC +YQFKTLSDCEPIIP+YLK+D+DAPK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYDAKQDRIVAARDPIGITTLYMGR S +P+TVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTP+D  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARET  A  DVD    + +  +HL GVDD+G LHT GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKA-RHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLDKEFLQLCMNIDP +KMI    G+IEKYILRKAFDTT +P+ KPYLP+EILWRQK
Sbjct: 420 RVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAE VISD MF +PK  WG+D+P+TKEA+WYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
            ADTVMRWIPKADWGCAEDPSGRYA+IHEKH+D
Sbjct: 540 VADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/573 (82%), Positives = 514/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAFRHEDV  YKPKALQL+KRIRHRGPDWSGN +KN+TI  HERL+IVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G Y LCVNGEIYNHIQ+REECADY+F TLSDCEPIIP+YLK+D+DAPK+LDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYDAKQDRIVAARDPIGITTLYMGR S +P+TVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTP+D  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARET KA  DV+    + +  +HL G+DD+G LHT GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKA-RHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFLQLCMNIDP +KMI    G+IEKYILRKAFDTT +P+ KPYLP+EILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAE VISD MF +PK  WG+D+PTTKEA+WYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
            ADTVMRWIPKADWGCAEDPSGRYA+IHEKH++
Sbjct: 540 VADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/573 (82%), Positives = 515/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFA+FR+ DV+AYKPKALQL+KRIRHRGPDWSGN+VKN+TIL HERL+IVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G+YTL VNGEIYNHI +REECA Y FKTLSDCEPIIPLY KYD+DAPKHLDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMGR S +P++V+F+SELKCLTDDCD I+AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD++TRYF PDWLDE RIP+TPVD KA+RE+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARETEK   ++D    + + H+ L G+D++GHLH  GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQ-LAGLDEQGHLHAAGWSRLHSFAVGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVA FIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD++FLQLCMNIDP DKMI  A GKIEKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 420 RVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKD AE  ISD  F  PK  WG+D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
           AA TVMRWIPKADWGCAEDPSGRYAKIHE+HVD
Sbjct: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/574 (81%), Positives = 520/574 (90%), Gaps = 2/574 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAF+HED++ +KPKALQL+KRIRHRGPDWSGN + N+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G+Y L VNGEIYNHIQ+RE+C+DY+F+T SDCEPIIPLYL++D+DAPK+LDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           A+CLYD+K+DR++AARDPIG+ TLYMGR SK+P+TVYFASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE R+P+TPVD +AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARETE A  +V+  +E       L G+DD+GHLHT GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIAAIAARETETA--NVEANEEASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPD 298

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEA 418

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLDK+FLQLCMNIDPKDKMI+   G+IEKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWID L+DTAERVISDAMF NPK  WG+D+PTTKEAYWYRLKFDA +PQKT
Sbjct: 479 EQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDG 574
           AADTVMRW+PKADWGCAEDPSGRYA+IHEKHV+ 
Sbjct: 539 AADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/572 (82%), Positives = 515/572 (90%), Gaps = 2/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAF+HED+  +KPKALQL+K+IRHRGPDWSGN V N+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G Y L VNGEIYNHIQ+RE C+DY+F+T SDCEPIIPLYL++D+DAPK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           A+CLYD+K+DRIVAARDPIG+ TLYMGR S++P+TVYFASELKCLTD CDSI++FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTPVD  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARETEKA  + D  ++N    K L G+DD+GHLHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKA--NADANEDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLDK+FLQLCMNIDP +KMI    G+IEKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGL+DTAER ISDAMF NPK  WG+D+PTTKEAYWYRLKFDA +PQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV
Sbjct: 539 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 516/572 (90%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIF  ++HE+ +A+KP+ALQL+KRIRHRGPDWSGNVVKN+TI+AHERL+IVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G++ LCVNGEIYNHIQIRE+  DYQFKTLSDCEPIIPLY+KY  +APKHLDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYDAKQDRI+AARDPIGITTLYMGR SK+P+TVYFASELKCLTDDCDSIVAFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRY+ PDW+DE+RI + P+DL  IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETEKAM+    +  +   ++ LTG+DD G+L + GWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQ-LTGIDDNGNLRSSGWSRLHSFAIGLPGAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           L AA+KVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LIAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFL LCMNIDP +KMI+Q  G+IEKYILRKAFDTTD+P EKPYLP EILWRQK
Sbjct: 420 RVPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAERVISD +FENP+ HWG+D+PTTKEAYWYRLKFDAL+PQ T
Sbjct: 480 EQFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/580 (80%), Positives = 514/580 (88%), Gaps = 6/580 (1%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAA++H +V A+KP+ALQLTKRIRHRGPDWSGNVVKNTT+ AHERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSPCGNY L VNGEIYNHIQ+REE  DY++KTL DCEPIIP+YLKYD+DAP HLDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           A+ LYD+++DR++AARDP+GITTLYMGR SKTP+TVYFASELKCL DDCDSI+AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+I RYF P+W+DE  IP+TPVDLK +RETLE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDV------EDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIG 294
             IASIAARETEK M + +        D+  +  K LTG+DD G+L T  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 295 LPNAPDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 354
           LP APDL+AARKVA FIGS+HHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 355 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 414
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 415 AWGLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQE 474
           AWGLEARVPFLD++FL LCMNIDP DKMI    GKIEKY+LRKAFDT+D+P+ KPYLP+E
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 475 ILWRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDA 534
           ILWRQKEQFSDGVGYSWID LKDTAERVISD MF NPK HWG+D+PTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 535 LYPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDG 574
           L+PQKTAADTVMRWIPKADWGCAEDPSGRYAKIHE+H+DG
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHIDG 580

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/573 (81%), Positives = 511/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAA++HEDV  YK KALQL+KRIRHRGPDWSGN  KN+TI  HERL+IVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+REEC DYQFKTLSDCEPIIP+YLK+D++APK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYDAKQDRIVAARDPIGITTLYMGR S +P+TVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTP+D  AIR +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARET  A  DV+    + +  +HL GVDD+G+LHT GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKA-RHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFLQLCMNIDPK+KMI    G+IEKYILRKAFDTT +P+ KPYLP+EILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWID LKD AE VISD MF +PK  WG+D+PTTKEA+WYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
            ADTVMRW+PKADWGCAEDPSGRYA+IHEKH++
Sbjct: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/575 (81%), Positives = 512/575 (89%), Gaps = 7/575 (1%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFA ++HE V+ +KPKALQL+KRIRHRGPDWSGNVVKNTTILAHERL+IVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PITS  G+YTLCVNGEIYNHI++REE   Y FKTLSDCEPIIPLY KYD+D PK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYDAK+DRI+AARDPIGITTLYMGR S +P TV+FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+ PDWLDE+RIP TP+D K IR +LE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVD---VEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPN 297
             IA+IAARETEKA +D+D    +DE+    KHL GVDD+G+LH  GWSRLHSFAIGLPN
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDED----KHLAGVDDKGNLHAAGWSRLHSFAIGLPN 296

Query: 298 APDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 357
           APDLQAARKVAKFI S+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 417
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416

Query: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILW 477
           LEARVPFLD++FL +CMNIDP +KMI+Q+ G+IEKYILRKAFDTTD+P+ KPYLP+EILW
Sbjct: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 476

Query: 478 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYP 537
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F  PKP WG+D+PTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 538 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/573 (81%), Positives = 507/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIF  FRH+ V+ +KP AL+L KRIRHRGPDWSGN++KN+T++AHERL+IVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           P  S   NY L VNGE+YNHIQ+REE + Y FKTLSDCEPIIPLY KY +DAPK+LDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGR SK+P+TVYFASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRYFNPDW+DEDRIPS P+DL  IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETEKA   +D    + E  KHL GVDD G+L + GWS LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSED-KHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFLQLCMN+DPK+KMI+ A G+IEKYILRKAFDT+D+P  KPYLP+EILWRQK
Sbjct: 420 RVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKD AE  ISD  F+ PK  WG+D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
           AA TVMRWIPKADWGCAEDPSGRYAKIHE+H+D
Sbjct: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/572 (80%), Positives = 511/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIF  FRHEDV  +KP ALQL KRIRHRGPDWSGNV++N+T+LAHERL+IVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           P+ S   +Y L VNGEIYNHIQ+REE +DY FKTLSDCEPIIPLY KY +DAPK+LDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AW LYD K+DR++AARDPIGITTLYMGR SK+P+TVYFASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRY+ P+WLDE+RIPS P+DL  IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARETEKA  +++  + + E  KHL GVDD G LH+ GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSED-KHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           L+AARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFL LCMN+DPK+KMI+QA G+IEKYILRKAFDT+D+P  KPYLP+EILWRQK
Sbjct: 420 RVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKDTAE  ISD  F+ PK  WG+D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA TVMRWIPKADWGCAEDPSGRYAKIH++H+
Sbjct: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/572 (79%), Positives = 505/572 (88%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFA +R +D++++KP AL+L+KR+RHRGPDWSGNV+KN TIL HERL+IVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PI SP GNY LCVNGEIYNHI +REEC+DY+F +LSDCEPIIPLYLKYD++ P+HLDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYD ++DRIVAARDPIG+TTLYMG+ S +P+T YFASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYF PDW+DE RIPS PVD KA+R TLEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETE+A ++      +G   KHL G+DD G LHTGGWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETERANREAGDVYADG---KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPD 297

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 298 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQ 357

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEA
Sbjct: 358 GVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEA 417

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD+EFLQLCMNIDP +KMI    G+IEKYILRKAFDT+D+P   PYLP+EILWRQK
Sbjct: 418 RVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQK 477

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKD AER ISD  F NP P WG+D+PTTKEA+WYRLKFDAL+PQ T
Sbjct: 478 EQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPT 537

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA TVMRW+PKADWGCAEDPSGRYAKIH++H+
Sbjct: 538 AAATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/573 (79%), Positives = 502/573 (87%), Gaps = 2/573 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFAAFRH DV+ Y+P ALQL+KRIRHRGPDWSGNVVKN+TIL HERL+IVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PI SPCGNYTLCVNGEIYNHIQ+REEC+DY F++LSDCEPIIPLYLKY LDAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYD+K+DRIVAARDPIGITTLYMG+ SK+P+T +FASELKCL DDCD IVAFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS +DQITRYFNP WLDE  +PSTP+D K +R +LEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IASIAARETE+A +++D  + + E  KHL G+D +G+LHTGGWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEE-KHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           L AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD++FL LCM +DP +KMI    G+IEKYILRKAFDTTD+P  KPYLP++ILWRQK
Sbjct: 420 RVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWIDGLKD AE  ISD M   P+P WG+D PTTKEAYWYRLKFD  +P K+
Sbjct: 480 EQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KS 538

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573
           AA+TVMRWIPKADWGC  DPSGR+AKIHE+H+D
Sbjct: 539 AANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/572 (75%), Positives = 495/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60
           MCGIFA +R + ++++KP ALQL+KRIRHRGPDWSGNVVKN TI  HERL+IVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120
           PI S  GNY LCVNGEIYNHI +R+ CADY F TLSDCEPIIPL+ KY ++ P +LDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180
           AWCLYDAK DRIVAARDPIG+TTLYMG+ SK+P+T YFASELKCL ++CD I++FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRYF P WL +   P+ PVD K +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300
             IA+IAARETEKA +++DV   + +  ++L GVDDE HLH  GWS+LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQV-RNLVGVDDELHLHASGWSKLHSFAIGLPNAPD 299

Query: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360
           LQAARKVAKFIGS+HHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQ 359

Query: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420
           G+KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GIKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEA 419

Query: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480
           RVPFLD++FL+LCMNIDP++KMI    GKIEKYILRKAFDT+D+P+ +PYLPQEILWRQK
Sbjct: 420 RVPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQK 479

Query: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540
           EQFSDGVGYSWID LKD AE  ISD  F  PKP WG+D+P+TKEAYWYR+KFDAL+PQ T
Sbjct: 480 EQFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPT 539

Query: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572
           AA TVMRW+PKA+WGC+EDPSGR+AKIHEKH+
Sbjct: 540 AASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 355 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 414
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 415 AWGLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRK 457
           A G+E R PFLD+  ++  M   P        + KI K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIP-------INWKINKLILRK 471

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 8/94 (8%)

Query: 364 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 423
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 424 FLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRK 457
           FLD+E +Q  ++  P        S K+ K ILRK
Sbjct: 450 FLDEEVIQYSVSQIP-------ISYKVNKGILRK 476

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 69/165 (41%), Gaps = 14/165 (8%)

Query: 69  YTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAK 128
           Y L  NGE+YN  +I      Y    L  C+  +       +   + LDG FA+ +YD K
Sbjct: 92  YVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLK 143

Query: 129 QDRIVAARDPIGITTL-YMGRQSKTPQTVYFASELKCLTDDCDSIVAF---PPGHVYDSN 184
           +  I   RD IG  +L Y   ++     +   +  +    DC   V +      H  D  
Sbjct: 144 EGNIYFGRDTIGKRSLCYSIDENSGELFISSVTGTRGTFVDCLGGVIYTYDTKTHTLDDT 203

Query: 185 TDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVP 229
                +Y   D  DE    S  ++L  +  TL ++V+KR+++  P
Sbjct: 204 KVIRDKYVVTDMTDELENESQYMEL--LYGTLYESVKKRVLSIHP 246

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 96/420 (22%), Positives = 162/420 (38%), Gaps = 68/420 (16%)

Query: 69  YTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLD-APKHLDGMFAWCLYDA 127
           Y L  NGE+YN   + E C        SD E I  L  K+ ++   +   G FA+ + D 
Sbjct: 90  YLLQYNGELYNDDTV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDL 142

Query: 128 KQDRIVAARDPIGITTLYMGRQSKTPQTVYFASEL--KCLTDDCDSIVAFPPG--HVYDS 183
           ++ ++   RD IG          ++   +    EL    ++  CD       G  +++D 
Sbjct: 143 QERKVYFGRDSIG---------KRSLSYILLDDELYITSVSGRCDGFQNCLAGVIYIFDI 193

Query: 184 NTDQITR--------YFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYXXXXX 235
           NT Q+T         Y   D +D D        +K + E L ++V +R++   P      
Sbjct: 194 NTKQLTGSVKIHDEPYIVSDQIDNDFQLLEEYKIK-LYECLRRSVYQRIVTIHPMHLENG 252

Query: 236 XXXXXXXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGL 295
                       +  T    + +   + N E    L  V  E    TG            
Sbjct: 253 NISILFSGGLDCSVITALLCEQLIKINRNSETIIELLNVGFENP-RTGKMP--------- 302

Query: 296 PNAPDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLET-----YDVTT---IRAS 347
            ++PD   A K A+ +  ++ +    L E      D + H +T     Y   T   +  +
Sbjct: 303 SDSPDRILAIKSAQLLSELYPQVNIKLIEVDVPYTDYLSHKDTVIDLMYPKNTEMDLSIA 362

Query: 348 TPMFLLSR---KIKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVK 396
              +  SR   K+   G          ++ SG G+DE++GGY  F+   S  E   E  K
Sbjct: 363 IAFYFASRGRGKVTENGESKPYNRSGIVMFSGLGADELYGGYHKFSNK-SNEELVIELQK 421

Query: 397 RVKNLHLADCLRANKSTMAWGLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILR 456
           ++  +H  +  R +K     G+E R PFLD+  +Q  +++          + K+ K+ILR
Sbjct: 422 QIAQIHDRNLNRDDKVISNHGIEVRYPFLDERVVQFSVDL--------PLNYKVNKHILR 473

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 99/217 (45%), Gaps = 33/217 (15%)

Query: 27  IRHRGPDWSG-NVVKNTTILAHERLSIVGLDSGAQPITSPC----GNYTLCVNGEIYNHI 81
           I  RGP++S   V K  +I      S++ L    +P T  C      Y +  NGE+YN  
Sbjct: 49  IAARGPNYSSFKVSKQYSITWFS--SVLSL---REPFTKQCVEIKDRYVVQFNGELYND- 102

Query: 82  QIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDPIGI 141
           +I+     Y  + L + + II        D  + LDG FA+ +YD +       RDPIG 
Sbjct: 103 EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPIGR 154

Query: 142 TTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHVY-------DSNTD-QITR-YF 192
             L     ++T + +Y +S   C T   D I     G +Y       + NTD +I++ ++
Sbjct: 155 RCLSFSIDNETGE-LYISSVTGCKTGFQDCIA----GTIYKYDCQLKELNTDSKISKPFY 209

Query: 193 NPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVP 229
             + LD++ +     +++ +   L  +V KR+++  P
Sbjct: 210 VSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 364 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 423
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 424 FLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRK 457
           FLD + ++      P        + KI K ILRK
Sbjct: 455 FLDIDVIKFSTEELP-------INYKINKLILRK 481

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (54%), Gaps = 9/99 (9%)

Query: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 417
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILR 456
           +E R PFLD    +  +N   K+  I+    KI K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINY---KINKKILR 477

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 58/113 (51%), Gaps = 12/113 (10%)

Query: 360 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 419
           QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 420 ARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKA---FDTTDDPEEKP 469
            R PFLD+  + L     P +        K+ K ILRK    F   D+  E+P
Sbjct: 448 VRYPFLDEYVINLSTLEIPINY-------KVNKLILRKVASLFLKLDEIAEEP 493

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 55/131 (41%), Gaps = 30/131 (22%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQPITSPCGN----YTLCVNGEIYNHIQ 82
           I  RGP++S   V    I AH+      + S  +P T    N    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  IREECADYQ---------FKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIV 133
             +E +D+           + L D   ++        D  + L+G +A+ +YD K     
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVV--------DVIRSLEGEYAYTVYDVKSSIFY 149

Query: 134 AARDPIGITTL 144
             RDPIG  +L
Sbjct: 150 FGRDPIGKRSL 160

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 364 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 423
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 424 FLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKA 458
           FLD   +Q      P +        K+ K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINY-------KVNKLILRKV 474

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 69  YTLCVNGEIYNHIQIREECADYQF--KTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYD 126
           Y L  NGE+YN  +I+++  D QF    LS    +I             LDG FA+ +YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSSTDVI--------HTLTQLDGEFAYTIYD 138

Query: 127 AKQDRIVAARDPIGITTLYMGRQSKTPQTVYFAS 160
            ++ +I   RD IG  +L    +  T   +Y AS
Sbjct: 139 LRETKIYFGRDSIGKRSLCF--KMDTTNGLYVAS 170

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 364 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 423
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 424 FLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRK 457
           FLD++ ++  + +          S K +K ILRK
Sbjct: 441 FLDEKVIKASVAL--------PISYKNDKMILRK 466

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 356 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 414
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 415 AWGLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILR 456
           + G+E R PFLD   ++      P +        KI K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFSTEDLPINY-------KINKLILR 473

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 53/125 (42%), Gaps = 22/125 (17%)

Query: 27  IRHRGPD---WSGNVVKNTTILAHERLSIVGLDSGAQPITSPC----GNYTLCVNGEIYN 79
           I  RGP+   W G+   +T   +    S++ L    QP T       G Y L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSAEYSTAWFS----SVLSL---RQPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  HIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDPI 139
             +I      Y    L+  E  IP       D    LDG FA+ +YD +  +    RD I
Sbjct: 100 D-EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAI 151

Query: 140 GITTL 144
           G  +L
Sbjct: 152 GKRSL 156

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 364 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 423
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 424 FLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKA 458
           FLD+  ++L     P        + K+ K ILRK 
Sbjct: 452 FLDEYVIKLSTAEIP-------INFKVNKLILRKV 479

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 63/141 (44%), Gaps = 20/141 (14%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLS-IVGLDSGAQPITSPCGN----YTLCVNGEIYN-H 80
           I  RGP++S     +   +   R+S    + S  QP T    N    Y L  NGE+YN  
Sbjct: 47  IAARGPNYS-----SLRAVKAYRISWFSSVLSLRQPFTKQSINVDDRYFLQFNGELYNKE 101

Query: 81  IQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDPIG 140
           I   +  + Y    L + +  + +     +D  K L+G +A+ +YD    ++   RDPIG
Sbjct: 102 ISQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEGEYAYTIYDVNSSKLYFGRDPIG 156

Query: 141 ITTLYMGRQSKTPQT-VYFAS 160
             +L     S TP   +Y AS
Sbjct: 157 RRSL---SYSVTPDNELYVAS 174

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 353 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKS 412
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 413 TMAWGLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRK 457
               G+E R PFLD+E ++      P +        K+ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIPINY-------KVNKMILRK 475

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 88/220 (40%), Gaps = 39/220 (17%)

Query: 27  IRHRGPDWSGNVV--KNTTILAHERLSIVGLDSGAQPITSPC----GNYTLCVNGEIYNH 80
           I  RGP++S   V  K  T      LS+       QP T         Y L  NGE+YNH
Sbjct: 48  ISARGPNYSSLRVSKKYKTAWYSSVLSL------RQPFTCQSIEIEERYVLQFNGELYNH 101

Query: 81  IQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDPIG 140
            +I      Y    L +  P IP  +K        L+G FA+ +YD +       RD +G
Sbjct: 102 -EIVHNDTQYIVGLLKESAPSIPAIIK-------KLNGEFAYSIYDIQNGTFYFGRDTVG 153

Query: 141 ITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHVYDSNTDQITRYFNPDW---- 196
             +L       T +  Y AS    +T    + +    G +Y  +T   ++  N D     
Sbjct: 154 KRSLSYFLDENTGE-FYLAS----VTGSQPNFIDCTAGIIYQYSTR--SKKLNSDLSISS 206

Query: 197 -------LDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVP 229
                  +D+ ++   P  +  + E L KAV +R+++  P
Sbjct: 207 PYEIATTMDQ-QLTKLPNCIDGLFEHLNKAVHRRIVSIHP 245

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 360 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 419
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 420 ARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKA 458
            R PFLD+  ++      P        + KI K ILR  
Sbjct: 448 VRYPFLDEHVIKFSAVDIP-------INFKINKLILRNV 479

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 73/169 (43%), Gaps = 30/169 (17%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQPIT----SPCGNYTLCVNGEIYNHIQ 82
           I  RGP++S   V      A++      + S  QP T    S    Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSLRVSK----AYQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYNK-E 101

Query: 83  IREECADYQF-----KTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARD 137
           I ++  D Q+     + L+    +I        D  + L+G +A+ +YD K  +    RD
Sbjct: 102 ISDDDNDSQYIASLLQNLTGDGDVI--------DVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGITTLYMGRQSKTPQT-VYFASELKCLTDDCDSIVAFPPGHVYDSNT 185
           PIG  +L     S TP   +Y AS    +    D I     G VY+ +T
Sbjct: 154 PIGRRSL---SYSVTPNNELYVASATGAIEGFQDCI----GGIVYEYDT 195

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 109/270 (40%), Gaps = 62/270 (22%)

Query: 1   MCGIFA--------AFRHEDVKAYK---PKAL----------QLTKRIRHRGPDWSGNVV 39
           MCGI           F   + K +K   P AL           L K I  RGP+++    
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFAS--- 57

Query: 40  KNTTILAHERLSIVG-LDSGAQPITSPC----GNYTLCVNGEIYNHIQIREECADYQFKT 94
                L   R+S+   + S  +P           Y L  NGE+YN   I           
Sbjct: 58  --LRTLKDHRISLFSSVLSLREPFCKQSVLVEDRYVLQFNGELYNDEIIH---------- 105

Query: 95  LSDCEPIIPLYLKYD------LDAPKHLDGMFAWCLYDAKQDRIVAARDPIGITTL-YMG 147
            +D + I+ L L  +      +   K+LDG FA+ +YD K  R+   RDPIG  +L Y  
Sbjct: 106 -NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSLCYYL 164

Query: 148 RQSKTPQTVYFASELKCLTDDCDSIVAFPPGHVYD-SNTDQITRYFNPDWLDEDRIPSTP 206
             +        +  +K    +CD+ V +     YD +N +     FN  + D      + 
Sbjct: 165 TDANELYVSSVSGSIKGFK-NCDAGVIYE----YDATNKNSPLTIFNNIFEDFTINDKSD 219

Query: 207 VDLKAIRETLEK-------AVRKRLMAEVP 229
           ++ K++++ +E+       AVRKR+++  P
Sbjct: 220 LEFKSLQKHIEELYKVLYNAVRKRVLSIHP 249

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 364 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 423
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 424 FLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRK 457
           FLD+  ++   +  P        + KI K ILRK
Sbjct: 451 FLDEHVIKYSTHDIP-------INYKINKLILRK 477

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 364 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARV 422
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 423 PFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKA 458
           PFLD+  ++      P +        K+ K ILRK 
Sbjct: 451 PFLDEYVIKFSTVEIPINY-------KVNKLILRKV 479

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 89/214 (41%), Gaps = 34/214 (15%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQPITSPCGN----YTLCVNGEIYNHIQ 82
           I  RGP++S       T+ A+       + S  +P T    N    Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNK-E 101

Query: 83  IREECAD--YQFKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDPIG 140
           +     D  Y    L D E    +     +D  K L+G +A+ +YD K  +    RDPIG
Sbjct: 102 VSHWGNDSLYIASLLKDLEDDGSV-----IDVIKSLEGEYAYTVYDVKSAKFYFGRDPIG 156

Query: 141 ITTLYMGRQSKTPQTVYFAS---ELKCLTDDCDSIVAFPPGHVYDSNTDQI--TRYFNPD 195
             +L     +     +Y AS    ++C  D     V     + YD+ T  +   +   P 
Sbjct: 157 RRSLSYSVTAN--NELYVASVTGAVECFHDCIGGTV-----YEYDTQTKSLHDNQRLRPP 209

Query: 196 W-----LDEDRIPSTPVDLKAIRETLEKAVRKRL 224
           +     LD + +  + V  K +   L ++V+KR+
Sbjct: 210 YEVTPKLDMEFVSLSIVS-KNLYSVLRESVKKRI 242

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 364 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 423
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 424 FLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRK 457
           FLD + ++      P +        K+ K ILR+
Sbjct: 449 FLDHDVIKFSTEEIPINY-------KVNKMILRR 475

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 93/220 (42%), Gaps = 37/220 (16%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQPITS---PCGN-YTLCVNGEIYNHIQ 82
           I+ RGPD+S   V +     H       + S  +P TS     GN + L  NGE+YN  +
Sbjct: 47  IKSRGPDYSSLRVSS----EHSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQ-E 101

Query: 83  IREECADYQF------KTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAAR 136
           I     D QF      +   D   II           + L G FA+ LYD +Q +    R
Sbjct: 102 ITAHDNDTQFIVSKLQEGYHDVCQII-----------RQLSGEFAYTLYDLQQRKFYYGR 150

Query: 137 DPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHVYDSNTDQI-------T 189
           D +G  +L     + T + +Y +S    +    D I      +VYD+ +  +       +
Sbjct: 151 DNVGKRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLES 207

Query: 190 RYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVP 229
           +YF    LDE+ +      ++ +   L  AVRKR+++  P
Sbjct: 208 QYFITKKLDEE-LTCLDSTVEQLYGMLSLAVRKRVLSIHP 246

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 360 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 419
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 420 ARVPFLDKEFLQL 432
            R PFLD++ +Q 
Sbjct: 445 VRYPFLDEKVVQF 457

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 78/178 (43%), Gaps = 33/178 (18%)

Query: 22  QLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQPITSPC----GNYTLCVNGEI 77
           +L   I +RGP+++   ++N++       S   + S   P+T         + L  NGE+
Sbjct: 44  RLIPYIINRGPNYAS--IRNSSKYGISWFS--SILSLRDPLTRQSVKINDRFVLQYNGEL 99

Query: 78  YNH-IQIREECADYQFKTLSDCEPIIPLYLKYDLDAPK---HLDGMFAWCLYDAKQDRIV 133
           YN  IQ             +D   I  L  +Y  D PK    ++G FA+ ++D + +++ 
Sbjct: 100 YNSSIQ------------HNDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLY 147

Query: 134 AARDPIGITTLYMGRQSKTPQTVYFASELKCLT---DDCDSIVAFPPGHVYDSNTDQI 188
             RD IG  +L     S+T +   F S +   +   +DC+    +    +YDS T  +
Sbjct: 148 FGRDTIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNL 199

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 95/445 (21%), Positives = 166/445 (37%), Gaps = 94/445 (21%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKH 115
           +P T  C      + L  NGEIYN   I      Y  + L + + I  +         + 
Sbjct: 78  EPFTKQCIEVEDRFVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDIPSVI--------RT 128

Query: 116 LDGMFAWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLT-DDCDSIVA 174
           L G FA+ +YD     +   RDPIG  +L     +   +    +   K     DC + V 
Sbjct: 129 LSGEFAYTIYDKLTGEVFFGRDPIGRRSLSFKLDTGDSKICISSVSGKIEGFQDCQAGVI 188

Query: 175 FPPGHVYDSNTDQIT--------RYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMA 226
           +    V+  NT ++         R+   + +D D         K + E +  AVRKR   
Sbjct: 189 Y----VFQKNTGELKSNLRINSERFAVSNKVDHDLSQIVEQSCK-LYEHISAAVRKR--- 240

Query: 227 EVPYXXXXXXXXXXXXIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWS 286
                           + +I    TE   + + +    G     +T +  +  L  GG  
Sbjct: 241 ----------------VTTIHPMHTEN--RPISILFSGGLDCSVITSLICQQILDLGGNI 282

Query: 287 RLHSFAIGLPN---------APDLQAARKVAKFIGSVHHEHTFTLQEGLDA--------- 328
            L    +G  N          PD    ++ A  + +++ +      E +D          
Sbjct: 283 VLELLNVGFENPRTGLSPSQVPDRILGQRSASILRALYPQVQIMFVE-VDVPYSEFLKYK 341

Query: 329 --LDDVIYHLETYDVTTIRASTPMFLLSR-------------KIKAQGVKMVLSGEGSDE 373
             + ++IY  +T    +I A+   +  SR               K +G+ ++ SG G+DE
Sbjct: 342 AHIMNMIYPKQTEMDLSIAAA--FYFASRGEGFVNEPSGTRISYKRKGL-VLFSGLGADE 398

Query: 374 IFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVPFLDKEFLQLC 433
           ++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R PFLD + +   
Sbjct: 399 LYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYPFLDDQVVAFS 457

Query: 434 MNIDPKDKMIDQASGKIEKYILRKA 458
             +          + K+ K ILRK 
Sbjct: 458 TQLP--------INYKVNKMILRKV 474

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 355 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKST 413
           + I  Q   +VL SG G+DE++GGY  F    S      E  K++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 414 MAWGLEARVPFLDKEFLQLCMNI 436
              G+E R PFLD+E + L  ++
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL 457

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 355 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 414
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 415 AWGLEARVPFLDKEFLQLCMNIDP----KDKMI 443
           + G+E R PFL +E ++      P    +DKMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 70/167 (41%), Gaps = 34/167 (20%)

Query: 1   MCGIFA----AFRHEDVK------------AYKPKALQLTKRIRHRGPDW-SGNVVKNTT 43
           MCGI      +F+ E+ +             Y      + K +R RGP++ S   +K+  
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 44  ILAHERLSIVGLDSGAQPITSPC---GN-YTLCVNGEIYNHIQIREECADYQFKT--LSD 97
                 + I  + S  QP T      GN Y L  NGE+YN  +I E   D QF +  L  
Sbjct: 61  -----SIWISSVLSLRQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLKK 114

Query: 98  CEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDPIGITTL 144
           C     ++     +    LDG FA+ + D + + I   RD IG  +L
Sbjct: 115 CISEDDIF-----NILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 10/99 (10%)

Query: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 417
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILR 456
           +E R PFLD   ++    +          + K+ K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQL--------PINYKVNKMILR 472

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 53/126 (42%), Gaps = 17/126 (13%)

Query: 23  LTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQPITSPC----GNYTLCVNGEIY 78
           L   I  RGP+++ ++  + T  A    SI+ L    +P+T  C      + L  NGEIY
Sbjct: 45  LIPHIVDRGPNYA-SLKSSATDAAVWFTSILSL---REPLTKQCIDINDRFVLQYNGEIY 100

Query: 79  NHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDP 138
           N   I      Y    LS  + +  +  K        L G FA+ +YD     I   RD 
Sbjct: 101 NS-SIAHNDTQYIATELSIVQNVPTVIRK--------LSGEFAYTVYDRATGEIFFGRDG 151

Query: 139 IGITTL 144
           +G  +L
Sbjct: 152 VGKRSL 157

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 39.7 bits (91), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 14/88 (15%)

Query: 102 IPLYLKYDLDAPKHLDGMFAWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASE 161
           +P YL+ D+DAPKHL+ MFA+     ++              ++ G      +T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCC--------CKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDSIVAFPPGHVYDS 183
             L C    LT  CD+  +F PG V+DS
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDS 80

>SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285)
           [459 bp, 152 aa] {ON} highly similar to uniprot|Q07648
           Saccharomyces cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr)
           deacylase functions in protein translation may affect
           nonsense suppression via alteration of the protein
           synthesis machinery ubiquitous among eukaryotes
          Length = 152

 Score = 35.0 bits (79), Expect = 0.20,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 45/121 (37%), Gaps = 23/121 (19%)

Query: 443 IDQASGKIEK---------YILRKAFDTTDDPEEKPYLPQEILWRQKEQFSDGVGYSWID 493
           + QAS  +E          Y+L     T D+ E+   L ++I     + F D  GY W  
Sbjct: 8   VSQASVTVESKVISSIKHGYMLLVGISTEDNTEDAEKLSKKI--ASLKVFDDDTGYGWKK 65

Query: 494 GLKDTAERVISDAMF---------ENPKPHWGNDVPTTKEAYWYRLKFDALYPQKTAADT 544
            +KD    ++S + F           P  H     PT KE Y    KF  L  Q    D 
Sbjct: 66  SIKDVEGEILSVSQFTLMARTKKGTKPDFHMAQKGPTAKELY---EKFLDLLKQDLGEDR 122

Query: 545 V 545
           V
Sbjct: 123 V 123

>KNAG0B00160 Chr2 complement(10663..18213) [7551 bp, 2516 aa] {ON}
            Anc_1.515 YKL203C
          Length = 2516

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 25/104 (24%)

Query: 438  PKDKMIDQASGKI---------EKYILRKAFDTTDDPEEKPYLPQEILWRQKEQFSDGVG 488
            P + M+D+ +GK+         E  ILR+ F     PE+ P+    +L +  E    G+ 
Sbjct: 2324 PSNLMLDRITGKVIHIDFGDCFEAAILREKF-----PEKVPFRLTRMLIKAME--VSGIE 2376

Query: 489  YSW-------IDGLKDTAERVIS--DAMFENPKPHWGNDVPTTK 523
             S+       +  L+D  E +I+  +A   +P  HWG D+PT K
Sbjct: 2377 GSFRIVCENVMRVLRDNKESLIAILEAFAFDPLIHWGFDLPTEK 2420

>KLLA0F14531g Chr6 (1349155..1350180) [1026 bp, 341 aa] {ON} weakly
           similar to uniprot|Q02775 Saccharomyces cerevisiae
           YDR088C SLU7 Protein involved in 3' splice site choices
           acts in concert with Prp18p during the 2nd step of
           splicing
          Length = 341

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 14/66 (21%)

Query: 29  HRGPDWSGNVVKNTTILAHERLSI----VGLDSGAQPITSPCGNYTLCVNGEIYNHIQIR 84
           H+GPD S   +    I   ERL +    VG D+  QP++ P          E YN +++R
Sbjct: 151 HKGPDTSHREMDEVQIQEMERLGLKPEDVGFDA-TQPLSGPK---------EKYNPVRLR 200

Query: 85  EECADY 90
           E+ A Y
Sbjct: 201 EDKAAY 206

>NCAS0G03440 Chr7 (634813..642192) [7380 bp, 2459 aa] {ON} Anc_1.515
          Length = 2459

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 35/111 (31%)

Query: 438  PKDKMIDQASGKI---------EKYILRKAFDTTDDPEEKPYLPQEILWRQKEQFSDGVG 488
            P + M+D+ +GK+         E  ILR+ F     PE+ P+       R     +  + 
Sbjct: 2267 PSNLMLDRLTGKVIHIDFGDCFEAAILREKF-----PEKVPF-------RLTRMLTYAME 2314

Query: 489  YSWIDG------------LKDTAERVIS--DAMFENPKPHWGNDVPTTKEA 525
             S I+G            L+D  E +++  +A   +P  HWG D+PT K A
Sbjct: 2315 VSGIEGSFRITCENVMRVLRDNKESLMAILEAFAFDPLIHWGFDLPTEKIA 2365

>KNAG0G00270 Chr7 complement(35502..42863) [7362 bp, 2453 aa] {ON}
            Anc_1.515 YKL203C
          Length = 2453

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 17/100 (17%)

Query: 438  PKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQKEQFSDGVGYSWIDG-LK 496
            P + M+D+ +GK+        F+TT   E+    P+++ +R      + +  S I+G  +
Sbjct: 2261 PSNLMLDRTTGKVVHIDFGDCFETTILREK---FPEKVPFRLTRMLREAMEVSGIEGSFR 2317

Query: 497  DTAERV-------------ISDAMFENPKPHWGNDVPTTK 523
             T E V             I +A   +P  +WG D+PT K
Sbjct: 2318 ITCEHVMRVLRENKESLMAILEAFAFDPLIYWGIDLPTEK 2357

>SAKL0E11066g Chr5 (928800..931697) [2898 bp, 965 aa] {ON} similar
          to uniprot|P25846 Saccharomyces cerevisiae YHR120W MSH1
          DNA-binding protein of the mitochondria involved in
          repair of mitochondrial DNA has ATPase activity and
          binds to DNA mismatches has homology to E. coli MutS
          transcription is induced during meiosis
          Length = 965

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 5  FAAFRHEDVKAYKPKALQLTKRIRHRG---PDWSGNVVKNTTI 44
          F  F HE     KP+ ++LT  +   G   PD +G++V NT I
Sbjct: 16 FRRFNHETTSVVKPEVVKLTLVLNELGSITPDIAGSIVANTPI 58

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,666,248
Number of extensions: 2741714
Number of successful extensions: 6314
Number of sequences better than 10.0: 53
Number of HSP's gapped: 6400
Number of HSP's successfully gapped: 69
Length of query: 575
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 460
Effective length of database: 40,294,809
Effective search space: 18535612140
Effective search space used: 18535612140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)