Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F034305.442ON33233217450.0
YDR372C (VPS74)5.442ON34534613740.0
NDAI0B057205.442ON36537113680.0
Suva_2.5445.442ON34634713620.0
Skud_4.6415.442ON34634713620.0
Smik_4.6385.442ON34634813610.0
KAFR0D050605.442ON32633213200.0
SAKL0G02706g5.442ON33233313150.0
CAGL0A02926g5.442ON32833213000.0
KNAG0B042005.442ON34434612990.0
TDEL0D025905.442ON33033312871e-179
KLTH0F15884g5.442ON32933312871e-179
KLLA0E02355g5.442ON32433012811e-178
ZYRO0F10208g5.442ON33233312711e-176
Kwal_55.213995.442ON32933312631e-175
Kpol_1016.25.442ON32833212381e-172
TBLA0A064805.442ON33433612251e-170
Ecym_45135.442ON33333311931e-165
ACL165C5.442ON33133111581e-159
TPHA0J026105.442ON32933211351e-156
Kpol_1062.245.442ON2762769101e-122
TBLA0A027805.442ON3872978481e-111
NCAS0H020905.442ON3452865963e-74
Smik_13.4878.832ON315111850.035
TBLA0B098202.51ON55065860.036
YMR274C (RCE1)8.832ON315111800.14
Suva_13.4628.832ON315111780.31
KAFR0C051107.39ON89175780.33
Skud_5.481.485ON517109740.98
ABL078C4.372ON281109721.5
Skud_13.4468.832ON315111693.5
TDEL0C048103.339ON142059686.1
Smik_13.1802.564ON78533676.9
KAFR0B043805.81ON761114677.8
TPHA0L008608.379ON52836669.4
KLTH0C09966g3.106ON760147669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03430
         (332 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   676   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   533   0.0  
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   531   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   529   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   529   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   528   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   513   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   511   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   505   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   504   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   500   e-179
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   500   e-179
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   498   e-178
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   494   e-176
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   491   e-175
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   481   e-172
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   476   e-170
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   464   e-165
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   450   e-159
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   441   e-156
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   355   e-122
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   331   e-111
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   234   3e-74
Smik_13.487 Chr13 complement(797405..798352) [948 bp, 315 aa] {O...    37   0.035
TBLA0B09820 Chr2 complement(2339120..2340772) [1653 bp, 550 aa] ...    38   0.036
YMR274C Chr13 complement(814364..815311) [948 bp, 315 aa] {ON}  ...    35   0.14 
Suva_13.462 Chr13 complement(797041..797988) [948 bp, 315 aa] {O...    35   0.31 
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    35   0.33 
Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)    33   0.98 
ABL078C Chr2 complement(254921..255766) [846 bp, 281 aa] {ON} Sy...    32   1.5  
Skud_13.446 Chr13 complement(787728..788675) [948 bp, 315 aa] {O...    31   3.5  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    31   6.1  
Smik_13.180 Chr13 complement(294921..297278) [2358 bp, 785 aa] {...    30   6.9  
KAFR0B04380 Chr2 complement(907246..909531) [2286 bp, 761 aa] {O...    30   7.8  
TPHA0L00860 Chr12 (169610..171196) [1587 bp, 528 aa] {ON} Anc_8....    30   9.4  
KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conser...    30   9.6  

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/332 (100%), Positives = 332/332 (100%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV 60
           MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV 60

Query: 61  LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG 120
           LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG
Sbjct: 61  LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG 120

Query: 121 TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV 180
           TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV 180

Query: 181 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI 240
           LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI
Sbjct: 181 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI 240

Query: 241 ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE 300
           ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE
Sbjct: 241 ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE 300

Query: 301 VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL
Sbjct: 301 VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/346 (74%), Positives = 302/346 (87%), Gaps = 15/346 (4%)

Query: 1   MSTLQRRRVNKDDS----------DNETGSVTPNVERDSDNDN----KVAYDPEEARMRN 46
           MSTLQRRRVN+ DS          +N  G    N+  D D+DN    K+AYDPEE+++R+
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 47  VGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARK 106
               +P LTLMEEVLLMGLRD+EGYLSFWND+ISYALRGCI+IELALRGKI+ILDDSARK
Sbjct: 61  -NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 119

Query: 107 RFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQ 166
           RF+LSERL++VID +KTGEVLLDETLQLMKNDEPLSI++WIDLLSGETWN++KINYQLKQ
Sbjct: 120 RFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQ 179

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNN 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRRVLS+LVSRNMELSYN 
Sbjct: 180 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 239

Query: 227 YFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLE 286
           YFPETT FKIIRT+ALICG+YGANVLEN+L +L++E  D AI+RA+E++AQFS++PFDLE
Sbjct: 240 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLE 299

Query: 287 TPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
             T LG+SVNLN+EV++E+ + PG+DLQLEVIAGV EVFSRMD LL
Sbjct: 300 KETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/371 (74%), Positives = 296/371 (79%), Gaps = 45/371 (12%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDN-----------------------KVAY 37
           MSTLQRRR  +D      GS    V+ DSDN++                       K+AY
Sbjct: 1   MSTLQRRRRPQD------GSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAY 54

Query: 38  DPEEARM----------------RNVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISY 81
           DPEEA++                       P LTLMEEVLLMGLRDKEGYLSFWNDNISY
Sbjct: 55  DPEEAKLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISY 114

Query: 82  ALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPL 141
           ALRGCILIELALRGKI+ILDDSARKRF+LSERL++V DG+KTGEVLLDETLQLMKNDEPL
Sbjct: 115 ALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPL 174

Query: 142 SIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDS 201
           +IA+WIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDS
Sbjct: 175 TIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDS 234

Query: 202 SCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLGSLDF 261
           SCKEAIKRRVLS+LVSRNME +YN YFP+ T FKIIRTIALICGAYGANVLEN+L SLD+
Sbjct: 235 SCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDY 294

Query: 262 EMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQLEVIAGV 321
           E SDNAIARADELIAQFSKFPFDLE  T   +SVNLNR VQQEL + PGYDLQLEVIAGV
Sbjct: 295 EKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGV 354

Query: 322 IEVFSRMDTLL 332
           IEVFSRMDTLL
Sbjct: 355 IEVFSRMDTLL 365

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/347 (74%), Positives = 302/347 (87%), Gaps = 16/347 (4%)

Query: 1   MSTLQRRRVNKDDS------------DNETGSVTPNVERDSDNDN---KVAYDPEEARMR 45
           MSTLQRRRVN+ DS             N +G  T N   D D++    K+AYDPEE+++R
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60

Query: 46  NVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSAR 105
           +   ++P LTLMEEVLLMGLRD+EGYLSFWND+ISYALRGCILIELALRGKI+ILDDSAR
Sbjct: 61  D-NIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119

Query: 106 KRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLK 165
           KRF+LSERLV+VIDG+KTGEVLLDETLQLMKNDEPL+I++WIDLLSGETWN++KINYQLK
Sbjct: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179

Query: 166 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYN 225
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRRVLS+LVSRNMELSYN
Sbjct: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239

Query: 226 NYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDL 285
            YFPETT FKIIRT+ALICG+YGANVLEN+L +L++E  D AI+RA+E+++ FS++PFDL
Sbjct: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299

Query: 286 ETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           E  T LG+SVNLN+EV++E+ + PG+DLQLEVIAGV EVFSRMD LL
Sbjct: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/347 (74%), Positives = 301/347 (86%), Gaps = 16/347 (4%)

Query: 1   MSTLQRRRVNKDDS------------DNETGSVTPNVERDSDN---DNKVAYDPEEARMR 45
           MSTLQRRRVN+ DS            DN  G    N+  D D+   + K+AYDPEE+++R
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 46  NVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSAR 105
           +   ++P LTLMEEVLLMGLRD+EGYLSFWND+ISYALRGCILIELALRGKI+ILDDSAR
Sbjct: 61  D-NIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119

Query: 106 KRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLK 165
           KRF+LSERLV+V+DG+KTGEVLLDETLQLMKNDEPL+I++WIDLLSGETWN++KINYQLK
Sbjct: 120 KRFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179

Query: 166 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYN 225
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRRVLS+LVSRNMELSYN
Sbjct: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239

Query: 226 NYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDL 285
            YFPETT FKIIRT+ALICG+YGANVLEN+L +L++E  D AI RA+E++AQFS++PFDL
Sbjct: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDL 299

Query: 286 ETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           E  T LG+SVNLN+EV++E+ +  G+DLQLEVIAGV EVFSRMD LL
Sbjct: 300 EKETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/348 (74%), Positives = 304/348 (87%), Gaps = 18/348 (5%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTP-----NVERDS-------DNDN----KVAYDPEEARM 44
           MSTLQRRRVN+ DS  +T S+ P     N + D        D+DN    K+AYDPEE+++
Sbjct: 1   MSTLQRRRVNRADS-GDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKL 59

Query: 45  RNVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSA 104
           R+    +P LTLMEEVLLMGLRD+EGYLSFWND+ISYALRGCI+IELALRGKI+ILDDSA
Sbjct: 60  RD-NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSA 118

Query: 105 RKRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQL 164
           RKRF+LSERL++VIDG+KTGEVLLDETLQLMKNDEPL+I++WIDLLSGETWN++KINYQL
Sbjct: 119 RKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQL 178

Query: 165 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSY 224
           KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRRVLS+LVSRNMELSY
Sbjct: 179 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSY 238

Query: 225 NNYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFD 284
           N YFPETT FKIIRT+ALICG+YGANVLEN+L +L++E  D AI+RA+E++AQFS+FPFD
Sbjct: 239 NEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFD 298

Query: 285 LETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           LE  T LGISVNLN+EV++E+   PG++LQLEVIAGV EVFSRMD LL
Sbjct: 299 LEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/332 (75%), Positives = 290/332 (87%), Gaps = 6/332 (1%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV 60
           MSTLQRRR N+ DS+ +    + NV      D KVAYDPEEA++R+    +P LTLMEEV
Sbjct: 1   MSTLQRRRKNRSDSNADD---SENV--SESQDRKVAYDPEEAKLRD-NVSIPKLTLMEEV 54

Query: 61  LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG 120
           LLMGLRD+EGYLSFWNDNISYALRGCILIELALR KI+ILDDSARKRF++SERLV+VIDG
Sbjct: 55  LLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDG 114

Query: 121 TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDE LQLMKNDEPL+IA+WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGV
Sbjct: 115 SKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 174

Query: 181 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI 240
           LRTEMKNFFLFDMATHPVTD+SCKEAIKRR+LS LVSRNMEL+YN+YF ETT FK IR +
Sbjct: 175 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIV 234

Query: 241 ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE 300
           AL+C +YGANVLEN+L SLD+E  D AI+RA+E++AQF+++PFDL   T LGISVNLN+E
Sbjct: 235 ALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKE 294

Query: 301 VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           V+ E+ + P + LQLEVIAGVIEVFSRMD LL
Sbjct: 295 VENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  511 bits (1315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/333 (74%), Positives = 287/333 (86%), Gaps = 2/333 (0%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSD-NDNKVAYDPEEARMRNVGGQVPVLTLMEE 59
           MS LQRRRVN+ +SD     +T +   D +  D KVAYDPEEA+++     VP LTLMEE
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKE-NTTVPKLTLMEE 59

Query: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119
           VLLMGL+DKEGYLSFWNDNISYALRGCILIELALR KI++LDD ARKRF++S+RL++VID
Sbjct: 60  VLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVID 119

Query: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179
           G+KTGEVLLDE L L+KNDEPL IA+WIDLLSGETWN++KINYQLKQVRERLAKGLVDKG
Sbjct: 120 GSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKG 179

Query: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239
           VLRTEMKNFFLFDMATHP+TD+SCKEAIKRRVLS+LVSRNMEL+YN YF E   FKIIRT
Sbjct: 180 VLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRT 239

Query: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299
           ++LICGAYGANVLEN+L SLD++  D A +RADE++AQFS+FPF L+  T  GISVNLN+
Sbjct: 240 LSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNK 299

Query: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           EVQ E+A  PG DLQLEV+AGV EVFSRMDTLL
Sbjct: 300 EVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  505 bits (1300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/332 (73%), Positives = 291/332 (87%), Gaps = 4/332 (1%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV 60
           MSTLQRRRVNK  S+N +  +  + E D  +  K+AYDPEE++++N   Q P LTLMEEV
Sbjct: 1   MSTLQRRRVNK--SENASNGI-EDREDDGTSSGKIAYDPEESKLQNDSKQ-PTLTLMEEV 56

Query: 61  LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG 120
           LLMGLRD+EGYLSFWND+ISYALRGCILIELALR KI+ILD  AR RF++SERL++VID 
Sbjct: 57  LLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDS 116

Query: 121 TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDETLQLM NDEPLSIA+WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGV
Sbjct: 117 SKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 176

Query: 181 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI 240
           LRTEMKNFFLFDMATHPV+DSSCKEAIKRR+LS+LVSRNME+SYN+YFPE+T FK+IRT+
Sbjct: 177 LRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTV 236

Query: 241 ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE 300
           +LI GAYGANVLEN++ SL+++  D AI RA+E++AQFS++PFDL+  +  GISVNLN+E
Sbjct: 237 SLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKE 296

Query: 301 VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           +Q+EL   PG DL+LEVIAGV EVFSRMD LL
Sbjct: 297 LQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/346 (71%), Positives = 292/346 (84%), Gaps = 16/346 (4%)

Query: 1   MSTLQRRRVNKDDSDNETGSVT-------PNVERDSDN-------DNKVAYDPEEARMRN 46
           MSTLQRRRVN+ DS NE  +V+       P+   D++          KVAYDPEEA++R+
Sbjct: 1   MSTLQRRRVNRSDS-NEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRD 59

Query: 47  VGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARK 106
               VP LTLMEEVLLMGLRD+EGYLSFWNDNISYALRGCI+IELALR KI+ILDDSARK
Sbjct: 60  -NYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARK 118

Query: 107 RFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQ 166
           RF++SERLV+V+DG+KTGEVLLDETLQLMKNDEPL+IA+WIDLLSGETWN+MKINYQLKQ
Sbjct: 119 RFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQ 178

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNN 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRR+LS +VSRNMELS+N+
Sbjct: 179 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNS 238

Query: 227 YFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLE 286
           YFPE+T FK IRT+AL+C  YGA+VLEN+L SLD+E  D A++RA+EL+ +F ++PFDLE
Sbjct: 239 YFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLE 298

Query: 287 TPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
                GIS NLN+E Q+E+ ++P   L LEV+AGVIEVFSRMD LL
Sbjct: 299 KQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  500 bits (1287), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 243/333 (72%), Positives = 291/333 (87%), Gaps = 4/333 (1%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARM-RNVGGQVPVLTLMEE 59
           MS LQRRRVN+ DS +E+ S+  +   ++    +VAYDPEEA++  NV    P LTLMEE
Sbjct: 1   MSNLQRRRVNRVDSGDES-SLQASEFNETTTSKRVAYDPEEAKITENVKN--PKLTLMEE 57

Query: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119
           VLL+GLRDKEGYLSFWNDNISYALRGCI+IELALRGKI+I+DDSARKRF++SERL++V+D
Sbjct: 58  VLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVD 117

Query: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179
            +KTGEVLLDETLQLMK DEPL+IA+WIDLLSGETWN++KINYQLKQVRERLAKGLVDKG
Sbjct: 118 ASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKG 177

Query: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239
           VLRTEMKNFFLFDMATHPVTD+SCKEA+KRRVLS+LVSRNMELSYN YFP+TT FK+IRT
Sbjct: 178 VLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRT 237

Query: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299
           IALICG+Y ANVLEN+L SLD+E  D A++RADE++ Q++++PFDL+  T  G+S+NLN+
Sbjct: 238 IALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNK 297

Query: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           EV++EL+      LQLEV+AGV EVFSRMD LL
Sbjct: 298 EVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  500 bits (1287), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 245/333 (73%), Positives = 283/333 (84%), Gaps = 5/333 (1%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNK-VAYDPEEARMRNVGGQVPVLTLMEE 59
           MS LQRRRVNK +S     S  P V  ++D + K VAYDPEEA++R+     P L LMEE
Sbjct: 1   MSGLQRRRVNKSES---ISSQDPVVNDETDGEGKRVAYDPEEAKLRD-DTTTPKLNLMEE 56

Query: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119
           VLLMGL+DKEGYLSFWNDNISYALRGCILIELALRGKIQ+L+D ARKRF++SERLV+VI+
Sbjct: 57  VLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVIN 116

Query: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179
            TKTGEVLLDE L LMKNDEPL+IA+WIDLLSGETWN MKI+YQLKQVRERLAKGLVDKG
Sbjct: 117 ATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKG 176

Query: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239
           VLRTEMKNFFLFDM THP+TD+SCKEAIKRR+LS+LVSRNM+L+YN YFP + RFK+IRT
Sbjct: 177 VLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRT 236

Query: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299
           ++LICGAYGANVLEN+L SLD+E  D A +RADE++AQFS+FPF L+  T  GISVNLN+
Sbjct: 237 LSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNK 296

Query: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           EVQ+E+       LQLE +AGV EVFSRMDTLL
Sbjct: 297 EVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  498 bits (1281), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 237/330 (71%), Positives = 284/330 (86%), Gaps = 7/330 (2%)

Query: 3   TLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEVLL 62
           +LQRRRVNK D    T    P +  D+++D+K+ YD +EA++R+    VP LTLMEEVLL
Sbjct: 2   SLQRRRVNKGD----TTESIPQI--DNEHDHKIVYDEQEAKLRD-NTSVPKLTLMEEVLL 54

Query: 63  MGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDGTK 122
           MGL+DK+GYLSFWNDNISYALRGCILIELALRGKI+ +DD ARKR+++SERL++VIDG+K
Sbjct: 55  MGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSK 114

Query: 123 TGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLR 182
           TGEVLLDE+L LMKND P SI  WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLR
Sbjct: 115 TGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 174

Query: 183 TEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTIAL 242
           TEMKNFFLFDMATHP+TD++CKE+IKRR+LSILVSRN EL+YN YFP+   FK IRT++L
Sbjct: 175 TEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSL 234

Query: 243 ICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQ 302
           ICGAYGANVLEN+L +LD+E+ D   ARADE++AQFS+FPF L+  T+ G+SVNLN+E+ 
Sbjct: 235 ICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEIS 294

Query: 303 QELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           QEL + PG DLQLEV+AGV EVFSRMDTLL
Sbjct: 295 QELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  494 bits (1271), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 244/333 (73%), Positives = 281/333 (84%), Gaps = 2/333 (0%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNK-VAYDPEEARMRNVGGQVPVLTLMEE 59
           MS LQRRRVN+ DS       T  +E   D+ +K VAYDPEE ++ +   +VP LTLMEE
Sbjct: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTD-NVEVPKLTLMEE 59

Query: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119
           VLL+GLRDKEGYLSFWNDNISYALRGCI+IELALRGKI+++DDSARKRF++SERL++V D
Sbjct: 60  VLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTD 119

Query: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179
            +KTGEVLLDE LQLMK DEPLSI +WIDLLSGETWN +KINYQLKQVRERLAKGLVDKG
Sbjct: 120 SSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKG 179

Query: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239
           VLRTEMKNFFLFDMATHPVTD+SCKEAIKRR+LS+LV RN+EL+YN+YF E   FK+IRT
Sbjct: 180 VLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRT 239

Query: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299
           IALICGAY ANVLEN+L SL +E  DNAI RADE++ QFS++PFDL+T T  GIS+NLN+
Sbjct: 240 IALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNK 299

Query: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           EV QEL   P   LQLEV+AGV EVFSRMD LL
Sbjct: 300 EVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  491 bits (1263), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 287/333 (86%), Gaps = 5/333 (1%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNK-VAYDPEEARMRNVGGQVPVLTLMEE 59
           MS LQRRRVNK +S+ ++    P +  +++ ++K VAYDPEEA +++    +P L LMEE
Sbjct: 1   MSGLQRRRVNKSESNYDS---EPVISEEAEGESKRVAYDPEEAMLKD-NATIPKLNLMEE 56

Query: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119
           VLLMGL+DKEGYLSFWNDNISYALRGCILIELALRGKIQ+++DSARKRF++SERLV+VI+
Sbjct: 57  VLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVIN 116

Query: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179
            TKTGEVLLDE L LMKNDEPL+IA+WIDLLSGETWN MKI+YQLKQVRERLAKGLVDKG
Sbjct: 117 ATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKG 176

Query: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239
           VLRTEMKNFFLFDM THP+TD+SCKEAIKRR+LS+LVSRNM+L+YN YFP +  FK++RT
Sbjct: 177 VLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRT 236

Query: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299
           ++LICGAYGANVLEN+L SLD+E  D A +RADE++AQFS+FPF L+  T  GISVN+N+
Sbjct: 237 LSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINK 296

Query: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           E+Q+E+       L+LEV+AGV EVFSRMDTLL
Sbjct: 297 EMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  481 bits (1238), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 227/332 (68%), Positives = 282/332 (84%), Gaps = 4/332 (1%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV 60
           MS+LQRRR+N+ +SD    S   N + +     K+AYDPEEA++++    VP LTLMEEV
Sbjct: 1   MSSLQRRRLNRINSDTAESS---NDDEERSKSTKIAYDPEEAKLKD-DVTVPTLTLMEEV 56

Query: 61  LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG 120
           +L+GL DK+GYLSFWNDNISY LRGCI+IELALR KI+ILDD ARKRF+LSERLV+V+DG
Sbjct: 57  VLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDG 116

Query: 121 TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDE LQLMKNDEPLSIA+WIDLLSGETWN  KINYQLKQVRER++KGLVDKGV
Sbjct: 117 SKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGV 176

Query: 181 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI 240
           LRTEMKNFFLFDMATHPVTD+SCKEAIKRR+LS LVSR MEL+YN YFPETT++K+IRTI
Sbjct: 177 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTI 236

Query: 241 ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE 300
           ALIC +Y ANVLEN+L SL++E  DNAIAR++ ++++F+++PF L+  + + +S+NL++ 
Sbjct: 237 ALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKL 296

Query: 301 VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           V+ E+A  PG  LQLE +AGV +VFS+MD +L
Sbjct: 297 VEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  476 bits (1225), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 235/336 (69%), Positives = 282/336 (83%), Gaps = 6/336 (1%)

Query: 1   MSTLQRRRVN-KDDSDNETGSVTPNVE---RDSDNDNKVAYDPEEARMRNVGGQVPVLTL 56
           MSTLQRRR   + DS   +G+ + + E   R +++  +VAYDPEE ++RN    VP LTL
Sbjct: 1   MSTLQRRRKQARSDSVGSSGTDSNDNEPTNRQAES-RRVAYDPEEDKIRN-NMSVPQLTL 58

Query: 57  MEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQ 116
           MEEV+L+GLRDKEGYLSFWNDNISYALRGCI+IELALRGKI+ILDD ARKRFELSERLV+
Sbjct: 59  MEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVE 118

Query: 117 VIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLV 176
           V+D +KTGEVLLDE LQ+M+NDEPL+I++W+DLLSGETWN+ KINYQLKQVRER++KGLV
Sbjct: 119 VVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLV 178

Query: 177 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKI 236
           DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRR+LSILV+R  E +YN+YFPETT FK 
Sbjct: 179 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKY 238

Query: 237 IRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVN 296
           IRTI+LIC AYGANVLEN+L SL+++  DN + RA+EL+ QFS++PFDLE  T  G S+N
Sbjct: 239 IRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSIN 298

Query: 297 LNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           LN  V++E+   P   L LEV+AGV EVFS+MD LL
Sbjct: 299 LNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  464 bits (1193), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/333 (66%), Positives = 274/333 (82%), Gaps = 4/333 (1%)

Query: 3   TLQRRRVNKDDSDNETGSVTPNVERDSDND---NKVAYDPEEARMRNVGGQVPVLTLMEE 59
           +LQRRRVNK +    +  +T     + ++D   +KVAYDPE+ ++R    + P LTLMEE
Sbjct: 2   SLQRRRVNKAEVGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRE-NTKEPTLTLMEE 60

Query: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119
           VLLMGL+DKEGYLSFWND+ISY+LRGCILIELALRGKI++++D+ARKRF+LSERLV+VI+
Sbjct: 61  VLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIE 120

Query: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179
            +KTGE LLDETL LMK++EPLSI +WIDLLSGETWN++KI+YQLKQVRERLAKGLVDKG
Sbjct: 121 TSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKG 180

Query: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239
           VLRTEMKNFFLFDMATHPV DSSCKE+IKRR+LS+LV RN+ L Y  YFPE+  FK +RT
Sbjct: 181 VLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRT 240

Query: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299
           IALICGAYGANVLEN+L SLD+E  +   +RA+E++ QFS++PF L+     GISVNL  
Sbjct: 241 IALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYN 300

Query: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           +V++E+   PG  LQLEV+AGV EVFSRMD  L
Sbjct: 301 QVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  450 bits (1158), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/331 (65%), Positives = 265/331 (80%), Gaps = 2/331 (0%)

Query: 3   TLQRRRVNKDDSDNETGSVTPNVERDSDN-DNKVAYDPEEARMRNVGGQVPVLTLMEEVL 61
           +LQRRRVNK   +   G  + N   + +   +KVAYDPEE ++R    + P LTLMEEVL
Sbjct: 2   SLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRE-NTREPTLTLMEEVL 60

Query: 62  LMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDGT 121
           LMGL+DKEGYLSF N+NISYALRGCILIELALRG+IQ++DD+ R+RF+ SERL++V+DG+
Sbjct: 61  LMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGS 120

Query: 122 KTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVL 181
           KTGE LLDE L LMK  EPL+I +W+DLLSGETWN +KINYQL+QVRERLAKGLVDKGVL
Sbjct: 121 KTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVL 180

Query: 182 RTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTIA 241
           RTEMKNFFLFDM THPV D+SCKE+IKRR+LS+LV RN+EL Y   FPET  FK +RTIA
Sbjct: 181 RTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIA 240

Query: 242 LICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNREV 301
           LIC A+GANVLE +L +LD+E  D   +RA+EL+ QFS++PF L+     GISVNLNR V
Sbjct: 241 LICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLV 300

Query: 302 QQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           Q+EL   PG  L LEV+AGV++V+SRMD LL
Sbjct: 301 QEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  441 bits (1135), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/332 (64%), Positives = 266/332 (80%), Gaps = 3/332 (0%)

Query: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV 60
           MS +QRRR+N+  +++E+     +  R   N +KVA+DPEEA++++    VP LTLMEEV
Sbjct: 1   MSGVQRRRINRISNEDESDHSDNDQSRS--NVSKVAFDPEEAKIKD-DVSVPKLTLMEEV 57

Query: 61  LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG 120
           +L+GL D EGYLSFWNDNISY LRGCILIELALRGKI+I+DDSARK F+LSERL++VID 
Sbjct: 58  VLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDA 117

Query: 121 TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDETLQLMKNDEP SI SWIDLLSGETWN  K+NYQLKQVRERL+KGLVDKGV
Sbjct: 118 SKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGV 177

Query: 181 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI 240
           LRTEMKNFFLFDMATHPV DSSCKE++KRR++S LV R + L YN YFPE+T FK+IRT+
Sbjct: 178 LRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTV 237

Query: 241 ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE 300
           +LI  AY ANVLEN+L +L++E  D A++RA+ L+  F  +PF L       IS+NLN+ 
Sbjct: 238 SLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQL 297

Query: 301 VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           V+ E+   P   LQLEV+AGV +VF++MD ++
Sbjct: 298 VEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 218/276 (78%)

Query: 57  MEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQ 116
           MEEV+L+G+RDKEGYLSFWN+N+S+ LRGCILIELA RG IQ++DD +RKRF+LS+RL++
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 117 VIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLV 176
           V++  KTGE LLDETLQ+MK++E  SI++WIDLLSGETWNI KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 177 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKI 236
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+R+LS+L+ +   +  + YFPET + + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 237 IRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVN 296
           +RTIALI  AY  +VLEN+   LD++  D+   R  E++ Q S +PF+ +  ++  I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 297 LNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
           LN+ V+ EL+     +L+LE IAGV EVF +MD+++
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 218/297 (73%), Gaps = 2/297 (0%)

Query: 37  YDPEEARMRNVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGK 96
           +DPEE+ + N    +P L LMEE++L+GL+DK+GYLSFWNDNISY LRGCILIELALR K
Sbjct: 92  FDPEES-ISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKK 150

Query: 97  IQILDDSARKRFELSERLVQVI-DGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETW 155
           I+++DD  R  +++S R+++V+   TKTG  LLDE L +M  + P SI +WIDLLSGETW
Sbjct: 151 IKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETW 210

Query: 156 NIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSIL 215
           N+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+R+ SIL
Sbjct: 211 NVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSIL 270

Query: 216 VSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELI 275
           V ++  L YNNYFPE   FKIIR++ LIC AYGA+VL++ L +++++ SDNA  +A++L 
Sbjct: 271 VPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLF 330

Query: 276 AQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
              S FP +L+     G+ V++ +++Q EL    G  L LEV+AGV++V  RMD+LL
Sbjct: 331 ETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  234 bits (596), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 183/286 (63%), Gaps = 13/286 (4%)

Query: 52  PVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKR-FEL 110
           P LTLM+E+ L+ L+DKEGY+S W+  +SY LR C++IELALRGKIQ + +  +K+    
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122

Query: 111 SERLVQVIDGTKTGEVLLDETLQLMKNDEP-LSIASWIDLLSGETWNIMKINYQLKQVRE 169
            E  ++VIDG+ TG+ LLD+TL LMK ++   S++ WI LLSGE+ N +K +YQL  VR+
Sbjct: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182

Query: 170 RLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFP 229
           R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+  IL +  ++L    YFP
Sbjct: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242

Query: 230 ETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAI---ARADELIAQFSKFPFDLE 286
           +T  ++++RTI L C AYGA++L+       F+  +  +    RA  L++ FSKFPF+L 
Sbjct: 243 DTVSYRVLRTIVLACAAYGADILDKGF----FQTENETVIGKGRARVLLSLFSKFPFELN 298

Query: 287 TPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332
                 +  +LN +V +EL + P    QLEV+AG I+V + +DT+L
Sbjct: 299 Q----AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>Smik_13.487 Chr13 complement(797405..798352) [948 bp, 315 aa] {ON}
           YMR274C (REAL)
          Length = 315

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 12/111 (10%)

Query: 212 LSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLG-------SLDFEMS 264
           +SIL++   ++ Y   F   T+F  +RT   +      + L NL+G       +L F + 
Sbjct: 210 ISILLTTCFQILYTTLFGALTKFVFVRTGGNLWCCIILHALCNLMGFPGPSRLNLHFTVI 269

Query: 265 DNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQL 315
           D    R  +LI+ ++K  + L     L + V   ++  Q L  TPGY + L
Sbjct: 270 DKKTGRTSKLISIWNKCYYAL-----LFVGVISLKDTLQNLVGTPGYRITL 315

>TBLA0B09820 Chr2 complement(2339120..2340772) [1653 bp, 550 aa]
           {ON} Anc_2.51 YDL225W
          Length = 550

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 3   TLQRRRVNKDDSDNETGSVTPNVERDSD-----NDNKVAYDPEEARMRNVGGQVPVLTLM 57
           T+     N  +  NET   TP + +DS+     N N +A  PE  ++RN+   +P +   
Sbjct: 400 TMNEEFSNDQNVSNETPQATPKISQDSEINENINPNTIASSPERIKLRNISETIPYVLRH 459

Query: 58  EEVLL 62
           E +L+
Sbjct: 460 ERILV 464

>YMR274C Chr13 complement(814364..815311) [948 bp, 315 aa] {ON}
           RCE1Type II CAAX prenyl protease involved in the
           proteolysis and maturation of Ras and the a-factor
           mating pheromone
          Length = 315

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 54/111 (48%), Gaps = 12/111 (10%)

Query: 212 LSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLG-------SLDFEMS 264
           +SIL++   ++ Y   F   T+F  +RT   +      + L N++G       +L F + 
Sbjct: 210 VSILLTTCFQILYTTLFGGLTKFVFVRTGGNLWCCIILHALCNIMGFPGPSRLNLHFTVV 269

Query: 265 DNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQL 315
           D    R  +L++ ++K  F L     LG+ ++L ++  Q L  TPGY + L
Sbjct: 270 DKKAGRISKLVSIWNKCYFAL---LVLGL-ISL-KDTLQTLVGTPGYRITL 315

>Suva_13.462 Chr13 complement(797041..797988) [948 bp, 315 aa] {ON}
           YMR274C (REAL)
          Length = 315

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 12/111 (10%)

Query: 212 LSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLG-------SLDFEMS 264
           LSIL++   ++ Y   F   T+F  +RT   +      + L NL+G       +L F + 
Sbjct: 210 LSILLTTCFQILYTTLFGGLTKFVFVRTGGNLWCCIVLHALCNLMGFPGPSRLNLHFTVV 269

Query: 265 DNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQL 315
           D       +L++ ++K  F L     L I +   ++  Q L  TPGY + L
Sbjct: 270 DKKTGLTSKLVSIWNKCYFAL-----LLIGLISLKDSLQSLVGTPGYRITL 315

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 9/75 (12%)

Query: 95  GKIQILDDS-ARKRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSG- 152
           GK Q+L DS A K  +L++   Q +D +K    +LDE LQL+ N++PL +  ++  +   
Sbjct: 723 GK-QVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKL 777

Query: 153 ETWNIMKINYQLKQV 167
           +TW   KIN  LK +
Sbjct: 778 KTWE--KINAFLKSI 790

>Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)
          Length = 517

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 44/109 (40%), Gaps = 18/109 (16%)

Query: 72  LSFWNDNISYALRGCILIELALRGKIQILDDSARKR--------------FELSERLVQV 117
           L F  DN+    RGC  + +     ++I+ D+  K+              F ++E  V +
Sbjct: 150 LDFAVDNVPLKARGCTPVAVRATAGLRIIGDAKSKKILTAVTNHLEKDYPFPIAEGSVSI 209

Query: 118 IDGTKTGEVLLDETLQLMKN----DEPLSIASWIDLLSGETWNIMKINY 162
           +DG + G      T  L+KN       L  A+  DL  G T  + +  +
Sbjct: 210 MDGDEEGVFAWITTNYLLKNIGTEGAKLPTAAVFDLGGGSTQIVFEPTF 258

>ABL078C Chr2 complement(254921..255766) [846 bp, 281 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR200W
           (RPN10)
          Length = 281

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 52/109 (47%), Gaps = 8/109 (7%)

Query: 197 PVTDSSCKEAIKRRVL--SILVSRNMELSYNNYFPETTRFKI-IRTIALICGAYGANVLE 253
           P    S KEAI R VL  ++LV  N E S N  FP+ TRF+  I  +  I  A  ++  E
Sbjct: 16  PSAGGSVKEAI-RMVLEATVLVVDNSEYSRNGDFPK-TRFEAQIDAVEFIFQAKRSSNPE 73

Query: 254 NLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQ 302
           N +G +    S   +       A+F K    L   T +G S++L+  +Q
Sbjct: 74  NTVGLISAAGSSPRVLST--FTAEFGKILAGLHD-TTVGGSIHLSTAIQ 119

>Skud_13.446 Chr13 complement(787728..788675) [948 bp, 315 aa] {ON}
           YMR274C (REAL)
          Length = 315

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 12/111 (10%)

Query: 212 LSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLG-------SLDFEMS 264
           +SIL++   ++ Y   F   T+F  +RT   +      + L NL+G       +L F + 
Sbjct: 210 ISILLTTCFQILYTTLFGGLTKFVFVRTGGNLWCCIALHALCNLMGFPGPSRLNLHFTVV 269

Query: 265 DNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQL 315
           D       +L++ ++K  F L     L I +   ++  Q L  T GY + L
Sbjct: 270 DKKGGLTSKLVSIWNKCYFAL-----LFIGLISLKDTLQNLVGTSGYRITL 315

>TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3.339
           YBR097W
          Length = 1420

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 166 QVRERLAKGLVDKGVLRTEMKNFFLFDMA-THPVTDSSCKEAIKRRVLSILVSRNMELS 223
           ++   L+K  V   VL   ++ FF FD+  TH +  SSCK+ + R V ++L S ++  S
Sbjct: 712 EISNNLSKAEV-YCVLYPIVRPFFEFDVEFTHDLMLSSCKQPVSRTVYNLLCSWSLRAS 769

>Smik_13.180 Chr13 complement(294921..297278) [2358 bp, 785 aa] {ON}
           YMR016C (REAL)
          Length = 785

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 14  SDNETGSVTPNVERDSDNDNKVAYDPEEARMRN 46
           SD+ TGS++PN  R S N N VA   ++  M N
Sbjct: 238 SDSSTGSMSPNSHRTSRNSNSVACIAQQPPMSN 270

>KAFR0B04380 Chr2 complement(907246..909531) [2286 bp, 761 aa] {ON}
           Anc_5.81 YGR245C
          Length = 761

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 211 VLSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIAR 270
           +L  LV R+ E  +  +  + + ++ +R I ++ G   A+  ++ + S +   SDN+  +
Sbjct: 16  LLQNLVKRDPESYHEEFLQQYSHYESLRDIFMLNGMSAASGAQSSVESSETNTSDNSSTQ 75

Query: 271 ADELIAQFSKFPFDLETPTALGISVNLNREVQQ---ELADTPGYDLQLEVIAGV 321
             ELI   S+        TA     N   E++Q   E   T  Y+L+ ++I  +
Sbjct: 76  LIELIGFVSQVCSCFPKETA-----NFTSELKQLLLEYHKTLPYELKEKIITSL 124

>TPHA0L00860 Chr12 (169610..171196) [1587 bp, 528 aa] {ON} Anc_8.379
           YDR179W-A
          Length = 528

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 21/36 (58%)

Query: 158 MKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDM 193
           MK+N+ L Q+ +++A    +K +    +  F LFD+
Sbjct: 349 MKLNFDLNQINKKMATNRKEKSIFEYYLPTFILFDI 384

>KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conserved
           hypothetical protein
          Length = 760

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 59/147 (40%), Gaps = 24/147 (16%)

Query: 87  ILIELALRGKIQILDDSARKRFELSERLV-QVIDGTKTGEVLLDETLQLMKNDEPL---- 141
           I  E  LRG++ I  +SA+K    SE L   +I      E L  ETL L + +E      
Sbjct: 471 ISTEETLRGELDIAAESAKKELSKSEELRDSLIKSKNEQEALQAETLVLKEQNETSRSRI 530

Query: 142 -SIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD 200
             +   +  L  E     + N QL+Q          +K VL T  K      MA   +  
Sbjct: 531 NELVQLVSQLEAEARKAREENSQLQQ-------SFQEKDVLATHAK------MANVKLQK 577

Query: 201 SSCKEAIK----RRVLSILVSRNMELS 223
              +E  K    RR L +L  R MEL+
Sbjct: 578 DCQRERCKLLDGRRELDLL-RRQMELA 603

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,798,262
Number of extensions: 1484460
Number of successful extensions: 5892
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5995
Number of HSP's successfully gapped: 46
Length of query: 332
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 222
Effective length of database: 40,868,139
Effective search space: 9072726858
Effective search space used: 9072726858
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)