Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F034205.441ON52552527030.0
NDAI0B057105.441ON56345914400.0
ZYRO0F10186g5.441ON51949813500.0
TDEL0D026005.441ON52350713341e-180
Kpol_1062.255.441ON53345711961e-159
Suva_2.5435.441ON51151311851e-158
SAKL0G02684g5.441ON53950011851e-157
Skud_4.6405.441ON51151111771e-156
Smik_4.6375.441ON51151311601e-154
TBLA0A027905.441ON54752411581e-153
YDR371W (CTS2)5.441ON51151011121e-147
TPHA0E017205.441ON53751311111e-146
CAGL0A02904g5.441ON50146811051e-146
Ecym_45125.441ON52744710451e-136
KNAG0C048705.441ON45844310071e-132
KAFR0E038105.441ON4904479681e-125
KLLA0E02333g5.441ON4804449631e-125
KLTH0F15906g5.441ON5154539541e-123
ACL166W5.441ON4904429431e-121
Kwal_55.214025.441ON5164529221e-118
KLTH0E11000g8.473ON1019154780.68
Skud_9.672.271ON509156722.9
TBLA0F039202.561ON50062714.2
CAGL0G08085g8.231ON157874724.4
Ecym_4614na 1ON48171705.2
KNAG0H029908.231ON151974715.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03420
         (525 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...  1045   0.0  
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   559   0.0  
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   524   0.0  
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   518   e-180
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   465   e-159
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   461   e-158
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   461   e-157
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   457   e-156
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   451   e-154
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   450   e-153
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   432   e-147
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   432   e-146
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   430   e-146
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   407   e-136
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   392   e-132
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   377   e-125
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   375   e-125
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   372   e-123
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   367   e-121
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   359   e-118
KLTH0E11000g Chr5 complement(988370..991429) [3060 bp, 1019 aa] ...    35   0.68 
Skud_9.67 Chr9 complement(146744..148273) [1530 bp, 509 aa] {ON}...    32   2.9  
TBLA0F03920 Chr6 (970663..972165) [1503 bp, 500 aa] {ON} Anc_2.5...    32   4.2  
CAGL0G08085g Chr7 (763185..767921) [4737 bp, 1578 aa] {ON} highl...    32   4.4  
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    32   5.2  
KNAG0H02990 Chr8 (552495..557054) [4560 bp, 1519 aa] {ON} Anc_8....    32   5.3  

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/525 (95%), Positives = 503/525 (95%)

Query: 1   MIATRRRKFFLNTGXXXXXXXXXXXXQMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEID 60
           MIATRRRKFFLNTG            QMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEID
Sbjct: 1   MIATRRRKFFLNTGVLFALAIVVLVLQMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEID 60

Query: 61  YLMNQTNSNGEKXXXXXXXXXXWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNP 120
           YLMNQTNSNGEK          WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNP
Sbjct: 61  YLMNQTNSNGEKGYLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNP 120

Query: 121 SDEWSDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGS 180
           SDEWSDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGS
Sbjct: 121 SDEWSDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGS 180

Query: 181 STKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEP 240
           STKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEP
Sbjct: 181 STKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEP 240

Query: 241 NKYLEMISKLRRKMDDLELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWN 300
           NKYLEMISKLRRKMDDLELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWN
Sbjct: 241 NKYLEMISKLRRKMDDLELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWN 300

Query: 301 MMTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPS 360
           MMTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPS
Sbjct: 301 MMTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPS 360

Query: 361 SKVVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMY 420
           SKVVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMY
Sbjct: 361 SKVVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMY 420

Query: 421 DPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLY 480
           DPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLY
Sbjct: 421 DPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLY 480

Query: 481 NFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQTS 525
           NFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQTS
Sbjct: 481 NFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQTS 525

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/459 (58%), Positives = 344/459 (74%), Gaps = 29/459 (6%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPYKPR+HFPHDIDLT+++H+YY+FFLV+  TG +  SDEWSDL+MDLYKPLS+KL+ L
Sbjct: 102 WSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTL 161

Query: 143 NLAD----NEKPVQLRD-----KRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSN 193
           +  D    ++   +L +     K++LPLGC+GELFYLK         + K+I+SIGGWSN
Sbjct: 162 HQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKF------QNFKLIMSIGGWSN 215

Query: 194 RDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRK 253
           R+ FP +VRD  K   FI+S+VE MF+YGFDGIDLDWEFP+DDG EP KYLE++ +LR++
Sbjct: 216 REHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKR 275

Query: 254 MDDLELEIFGETK----------DHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMT 303
           MD LE +IF ++K           HPKF+LSVATPAFI KL+ILPI +M++Y+DYWNMMT
Sbjct: 276 MDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPIKEMNKYIDYWNMMT 335

Query: 304 YDYYGSWSEATGYHCNLFNG-DGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSK 362
           YDYYG WSE TGYHCNL+ G +     A YKHEHT+ N GLNAN+AI++M+ + NV S K
Sbjct: 336 YDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNNNVSSRK 395

Query: 363 VVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDP 422
           +VLG+AAYGR F  VK  +  +  IN+KF GVG    G EPGMWLYNQLP+K + EM+DP
Sbjct: 396 LVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAG-EPGMWLYNQLPIKNSKEMFDP 454

Query: 423 NYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNF 482
           NY +AFCYD K++TF+GYDNVD++K+KA+YVQ R L GGFWWESCGDDH +  RSLL  F
Sbjct: 455 NYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAF 514

Query: 483 SN--EVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLS 519
           +N  EV  + K+ D  LI+ + + I YYLN +G DGFLS
Sbjct: 515 TNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLS 553

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/498 (51%), Positives = 342/498 (68%), Gaps = 13/498 (2%)

Query: 27  QMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKXXXXXXXXXXWSPY 86
           +MC ++  FK  A  D++      G    +Q      +     G++          WSPY
Sbjct: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQ----FKDHHTVIGDEGYTSGLYYSDWSPY 80

Query: 87  KPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNLNLAD 146
            PR HFPHDID ++VSHIYYAFFL+D  TG+L  SDEWSD QMDLYKPL+VKL+ L L +
Sbjct: 81  PPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKN 140

Query: 147 NEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GGSSTKMILSIGGWSNRDRFPGLVRDT 204
           ++    +     LP GC+GELFYL+H+GI+    G   K+++++GGWSNRD++P +VRD 
Sbjct: 141 DDVHASMG---VLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDP 197

Query: 205 RKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFGE 264
           R+ ENFI+S VETMF+YGFDGIDLDWEFP++DG EP  YLE+  K+R K D+LE  IF  
Sbjct: 198 RRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAG 257

Query: 265 TKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNGD 324
             +HPKFQLS+ATPAF  KL++LPI ++D+Y+D WNMMTYDY+G WS  TGYHCNL++G 
Sbjct: 258 EPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGP 317

Query: 325 GSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGVD 384
             +  + YKH+ ++ + GL+AN AI  MI    V S K+ LGMAAYGR F HVK+     
Sbjct: 318 -VKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKASSNDK 376

Query: 385 TLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNVD 444
             I++ F GVG    G EPGMWLYNQLP+KG+ E YDP Y + FC+D K++TF+GYDNV+
Sbjct: 377 RFIDKSFHGVGGASEG-EPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDNVE 435

Query: 445 SVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKEC 504
           SVK+KA YV+   L GGFWWESCGD+HI+ +RSLL  F+  +  I K  +++ ++ + E 
Sbjct: 436 SVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAK--NENSVYHKPEA 493

Query: 505 IAYYLNRYGTDGFLSGIL 522
           + YYL ++G D FLS  +
Sbjct: 494 LRYYLEKFGQDEFLSPFI 511

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  518 bits (1334), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 259/507 (51%), Positives = 343/507 (67%), Gaps = 29/507 (5%)

Query: 27  QMCLHKLYF---KQKATQDLIQSHFRNG---TIPNRQEI-DYLMNQTNSNGEKXXXXXXX 79
           +MC +K  F    Q+   D +QS  +     T P   E   YL     SN          
Sbjct: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVEPGQYLSGLYYSN---------- 72

Query: 80  XXXWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKL 139
              WSPY PR HFPHDIDL+RVSHIYYAFFLVD  TG L   DEWSD+ MDLYKP+++KL
Sbjct: 73  ---WSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKL 129

Query: 140 HNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGS--STKMILSIGGWSNRDRF 197
           + LN     K    R +R LP GC+GELFY++++ + P  +    K+I+ +GGWSNR+ F
Sbjct: 130 NKLN--PEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEF 187

Query: 198 PGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDL 257
           P +VR+ ++ + FIDS +ETMF+YGFDGIDLDWEFP+DDG EP  YL++  +L+ +M++L
Sbjct: 188 PKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNEL 247

Query: 258 ELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYH 317
           E  IFG   +HPKFQLS+ATPAF  KL ILPI +MD+Y+D WNMMTYDY+G WSE TGYH
Sbjct: 248 EDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYH 307

Query: 318 CNLFNGDGSEFRAGY-KHEHTAHN-NGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFK 375
           CNL+NG    F   + KH ++  +  GL+A+ AI+ M+    V S K+ LGMAAYGR F 
Sbjct: 308 CNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFT 367

Query: 376 HVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSE 435
           +V ++      I++ F GVG G    EPGMWLYNQLP++GT E++DP+Y + FCY   S+
Sbjct: 368 NVVAQSTDKRFIDKPFHGVG-GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSK 426

Query: 436 TFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQ 495
           TF+GYD+V+SV+ KAQYV+ + L GGFWWESCGDDH N+ RSLL  F+NE+  + KF   
Sbjct: 427 TFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFD-- 484

Query: 496 DLIFRRKECIAYYLNRYGTDGFLSGIL 522
           DL++R+   + YY+N++G D FLS  +
Sbjct: 485 DLMYRQTPVLRYYVNKFGNDAFLSPFI 511

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  465 bits (1196), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 230/457 (50%), Positives = 304/457 (66%), Gaps = 23/457 (5%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPY PR H PHD+D +R++H+YYAFF+VD KTG L  SD WSD +MD YKPL++KL  L
Sbjct: 73  WSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKL 132

Query: 143 NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTK--MILSIGGWSNRDRFPGL 200
            L     P   + K  LP+GCIGELFYL+HS +    +S K  +I+S+GGWSNR+ FP +
Sbjct: 133 QLDHFFNP---KFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRM 189

Query: 201 VRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELE 260
           +RD++K + F++S +E MF YGFDGI+LDWEFPKDD LEP  YLE++ KL+ K ++LE +
Sbjct: 190 IRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQK 249

Query: 261 IF-----GETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATG 315
           IF     G     PKF LS+A PAF  KL IL + +MD YVD WNMMTYDY+G WSE TG
Sbjct: 250 IFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTG 309

Query: 316 YHCNLFNGDGSEFRAGYKHEHTAHN----------NGLNANEAIDFMIKSCNVPSSKVVL 365
           YH NL++   +        +    N          + LN + AI+++IK  ++   K+ L
Sbjct: 310 YHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINL 369

Query: 366 GMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYG 425
           GMAAYGR F  V +       IN+ ++GVG    G EPGMWLYNQLP+K ++E +DP+Y 
Sbjct: 370 GMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEG-EPGMWLYNQLPIKNSLEEFDPDYV 428

Query: 426 AAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNE 485
           +AFCYDKKS+TF+GYDN DS+K+KAQYV+   L GGFWWESCGDDH N  +SLL  F++E
Sbjct: 429 SAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTDE 488

Query: 486 VTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGIL 522
           +  + +    + +F   E + YYL   G  GFLS  +
Sbjct: 489 IGSVTE--KNETMFTNIEVLKYYLKTKGDTGFLSTFI 523

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  461 bits (1185), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 250/513 (48%), Positives = 329/513 (64%), Gaps = 53/513 (10%)

Query: 27  QMCLHKLYFKQKATQDLIQSHFRNG--TIPNRQEIDYLMNQTNSNGEKXXXXXXXXXXWS 84
           +MCL+   FK + ++D I+ +F+NG   +PN      + NQ  S  +           WS
Sbjct: 30  EMCLYNKLFKNQRSED-IRDNFQNGRHQVPNM-----VQNQKPSGDDDGYVSGVYYSNWS 83

Query: 85  PYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL-- 142
           PYKPRFHFPHDI+L +VSH+YYAFF +DPKTG +  +D WSDL+MDLYKPL++K   L  
Sbjct: 84  PYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVD 143

Query: 143 -NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLV 201
            NL DN        +  LPLGCIGELFYLK++     G   K I+SIGGWS+ + F  +V
Sbjct: 144 DNLDDNNM------QSILPLGCIGELFYLKNAC---SGRKFKSIMSIGGWSDSENFKTIV 194

Query: 202 RDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEI 261
           ++ +  +NF+DS+VETMF+ GFDGID+DWEFP+++ +EP  YL+++  LR K++ LE +I
Sbjct: 195 KNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQI 254

Query: 262 FG-ETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNL 320
           FG  TKDH  F+LS+A PAF  KL  LPI ++DQY+D+WNMMTYDYYGSWSE TGYH NL
Sbjct: 255 FGGSTKDH--FELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNL 312

Query: 321 FNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSR 380
           F+                    L+ N AI +MI    V   K+VLGMAAYGR F H+K  
Sbjct: 313 FS-----------------ETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDD 354

Query: 381 Q-----GVDTLINQKFKGVGKGG-----LGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCY 430
           +         LINQ+FKGVGK G        + G+W Y  LP KGT E YDP Y +A+C+
Sbjct: 355 KFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCF 414

Query: 431 DKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIR 490
           D+K+  FIGYDN +S+K KA YV   ELGGGFWWESCG+D+ +K RSL+  F NE     
Sbjct: 415 DEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAF-NEALHFN 473

Query: 491 KFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523
             S +  +F+ K  + YYL++YG  GFL+  L+
Sbjct: 474 -VSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLK 505

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  461 bits (1185), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 236/500 (47%), Positives = 317/500 (63%), Gaps = 23/500 (4%)

Query: 35  FKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKXXXXXXXXXXWSPYKPRFHFPH 94
            K +ATQ   Q +    +  N Q +   +    SN  +          WSPY PR HFPH
Sbjct: 51  LKGRATQKFKQIYSDMNSNDNNQNLQEEVGPA-SNDSQSYISGVYYTNWSPYAPRNHFPH 109

Query: 95  DIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNLNLADNEKPV-QL 153
           D++  R+++++Y+FF+VDPK+G +  SDEWSD QMDLYK    +     L+ +     Q 
Sbjct: 110 DMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLSSSSSSTFQS 169

Query: 154 RDKRKLPLGCIGELFYLKHSGIIPG------GSSTKMILSIGGWSNRDRFPGLVRDTRKF 207
             K  LP+GCIGELFYLK+S I+P         + K+ +S+GGWSNRD FP +VRD  KF
Sbjct: 170 HKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKF 229

Query: 208 ENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFGETKD 267
           + FI + VETMF+YGFDG+D+DWEFP++DGLEP  YL MI +LR  +DDLE +IF +   
Sbjct: 230 DTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERDIFQDEHH 289

Query: 268 HPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNGDGSE 327
              F L+VA PAF  KL +LP+  MD YVD+WN+M YDY+G WSE TGYH NL++ D + 
Sbjct: 290 SEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSN- 348

Query: 328 FRAGYKHEHTAH----NNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGV 383
                 H H  H     N LNA+ A+ +++K+  + S KVVLGMAAYGR F  VK+    
Sbjct: 349 ------HVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANS 402

Query: 384 DTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNV 443
            + I + + GVG    G EPGMWLYNQLPL GT+E +DP   +A+ +D KS+TF+GYDNV
Sbjct: 403 GSYIGKPYNGVGGASEG-EPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNV 461

Query: 444 DSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKE 503
           DS++ KAQYV+   L GGFWWESCGD+H ++++SLL  F+N++  + K   Q  I+    
Sbjct: 462 DSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAK--QQPSIYTSAH 519

Query: 504 CIAYYLNRYGTDGFLSGILQ 523
            I YYL  Y   GFLS + +
Sbjct: 520 VIRYYLKNY-PQGFLSRVFK 538

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  457 bits (1177), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 245/511 (47%), Positives = 327/511 (63%), Gaps = 50/511 (9%)

Query: 27  QMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKXXXXXXXXXXWSPY 86
           +MCL+   FK + + D I+ +FRNG     Q    + NQ   +G K          WSPY
Sbjct: 30  EMCLYNKIFKSQRSDD-IRDNFRNG---GDQVPSMVQNQKPHDGGKGYVSGVYYSNWSPY 85

Query: 87  KPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL---N 143
            PRFHFPHDI+L +VSH+YYAFF ++ KTG +  +D WSDL+M+LYKPL++K   L   N
Sbjct: 86  TPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENN 145

Query: 144 LADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVRD 203
           L D+ + +       LPLGC+GELFYLK++         K+I+SIGGWS+ + F  +V D
Sbjct: 146 LNDSVQNI-------LPLGCVGELFYLKNAC---SEKKFKVIMSIGGWSDSENFKTIVGD 195

Query: 204 TRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFG 263
            +  +NF+DS+VETMF+ GFDGID+DWEFP+++ +EP  YL+++  LR K+++LE +IFG
Sbjct: 196 DKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFG 255

Query: 264 ET-KDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFN 322
           E+ +DH  FQ+S+A PAF  KL  LPI ++DQY+DYWNMMTYDYYGSWSE TGYH NLF+
Sbjct: 256 ESIEDH--FQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFS 313

Query: 323 GDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQ- 381
                               L+ N A+ +MI   +V SSK+VLGMAAYGR F H+K  + 
Sbjct: 314 -----------------ETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKF 355

Query: 382 ----GVDTLINQKFKGVGKGG-----LGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDK 432
                   LINQ FKGVGK G        + G+W Y  LP KGT+E YDP Y +A+C+D+
Sbjct: 356 QPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDE 415

Query: 433 KSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKF 492
           K+  FI YDN  S K KA+YV   +LGGGFWWESCG+ H NK RSL+  F+  +      
Sbjct: 416 KNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIR--FNV 473

Query: 493 SDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523
           S +  +F+    I +YLN+YG DGFLS  L+
Sbjct: 474 SSKPSMFQDMRVIKFYLNKYGDDGFLSPYLK 504

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  451 bits (1160), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 244/513 (47%), Positives = 326/513 (63%), Gaps = 54/513 (10%)

Query: 27  QMCLHKLYFKQKATQDLIQSHFRNG--TIPNRQEIDYLMNQT---NSNGEKXXXXXXXXX 81
           +MCL+K  FK + +   I+  F NG   +PN       M+QT   N +GE          
Sbjct: 30  EMCLYKKIFKNQRSNK-IRDSFNNGGHKVPN-------MDQTQGPNVDGE-GFVSGVYYS 80

Query: 82  XWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHN 141
            WSPYKPRFHFPHDI+LT+VSH+YYAFF ++P+TG +  +D WSDL+M+LYKPL++K   
Sbjct: 81  NWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSE 140

Query: 142 LNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLV 201
           L   ++   +Q    + LPLGCIGELFYLKHS     G   K+I+SIGGWS+ + F  ++
Sbjct: 141 LIDGNSSNDIQ----KILPLGCIGELFYLKHSC---SGKKFKVIMSIGGWSDSENFKVII 193

Query: 202 RDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEI 261
           ++    + F+DS+VETMF+ GFDGIDLDWEFP+++  EP  YL+++  LR K++ LE +I
Sbjct: 194 KNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQI 253

Query: 262 FGE-TKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNL 320
           FGE  +DH  FQLS+A PAF  KL  LPI ++DQY+DYWNMMTYDYYGSWSE TGYH NL
Sbjct: 254 FGEGVEDH--FQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNL 311

Query: 321 FNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSR 380
           F+                    L+ N AI +MI    + S K+VLGMAAYGR F H+K  
Sbjct: 312 FS-----------------ETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGS 353

Query: 381 -----QGVDTLINQKFKGVGK-----GGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCY 430
                     LINQ FKGVGK          + G+W Y  LP KGT+E YDP Y +A+C+
Sbjct: 354 GFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCF 413

Query: 431 DKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIR 490
           D+K+  FI YDN  SVK KA+YV   +LGGGFWWESCG+ + N+ RSL++ F+  +    
Sbjct: 414 DEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRS-- 471

Query: 491 KFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523
             S +  +F  +  + +YLN+YG +GFL+  L+
Sbjct: 472 NVSTKPSMFENERVVNFYLNKYGNNGFLTPYLK 504

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  450 bits (1158), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 237/524 (45%), Positives = 334/524 (63%), Gaps = 44/524 (8%)

Query: 27  QMCLH-KLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSN----GEKXXXXXXXXX 81
           +MC + KL+ K+K  Q L Q        P     + + +  N+N      +         
Sbjct: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84

Query: 82  XWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHN 141
            WSPY PR HFPHDID +R+SH+YY+FFLV+   GK+   D+WSD++MDLYKPLS+KL  
Sbjct: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144

Query: 142 L-NLAD--NEKPVQLRDKRKLPLGCIGELFYLKHSGIIP-----GGSSTKMILSIGGWSN 193
           L N  D   E   Q   K  LP GCIGE FYL++S ++P        + KMI++IGGWSN
Sbjct: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204

Query: 194 RDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRK 253
           RD FP + +  +K  NF+ SA+E MF YGFDGIDLDWEFPK++  EP  YL+++ +LR+ 
Sbjct: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264

Query: 254 MDDLELEIFGET----KDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGS 309
           M++LE EI+  +    ++   FQLSVA+PAF  KLS+LPI +M++ +DYWNMMTYDY G 
Sbjct: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324

Query: 310 WSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAA 369
           WSE TGYH NL++G      +  KH+       LNA+ AI +MI++  V  +K+VLG+A 
Sbjct: 325 WSEKTGYHSNLYDG------SKVKHDEEV----LNADSAIKYMIETQGVEPNKLVLGLAG 374

Query: 370 YGREFKHV------------KSRQ--GVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKG 415
           YGR + +V            K R+  G +  I+ ++KGVG    G EPGMW+YNQLP+KG
Sbjct: 375 YGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEG-EPGMWMYNQLPIKG 433

Query: 416 TVEMYDPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKR 475
           ++E +DP + +A+CYD K+ T + YDNV+S+ +K QYV+ + L GGF WESCGD H N +
Sbjct: 434 SIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPK 493

Query: 476 RSLLYNFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLS 519
           RSL+  F+NE+ +I+K   +  IF+ ++   +YL  +G +G+LS
Sbjct: 494 RSLITAFTNELGKIKK--QESSIFQDEKTFEFYLEEFGNEGYLS 535

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  432 bits (1112), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 242/510 (47%), Positives = 315/510 (61%), Gaps = 48/510 (9%)

Query: 27  QMCLHKLYFKQKATQDLIQSHFRNG--TIPNRQEIDYLMNQTNSNGEKXXXXXXXXXXWS 84
           +MCL+   FK + + D I+ +F NG   +P+      + N      ++          WS
Sbjct: 30  EMCLYNKIFKNQRSDD-IRDNFNNGGHRVPSN-----VQNHGTHIRDEAFISGVYYSNWS 83

Query: 85  PYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNLNL 144
           PYKPRFHFPHDI+L +VSHIYYAFF ++ +TG +  +D WSDL+M+LYK L++K   L  
Sbjct: 84  PYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSELIK 143

Query: 145 ADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVRDT 204
             +   VQ      LPLGCIGELFYLK++         K+I+SIGGWS+ + F  +++D 
Sbjct: 144 ESSNNSVQ----NILPLGCIGELFYLKNTC---SDKKFKVIMSIGGWSDSENFKIIIKDD 196

Query: 205 RKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFGE 264
           +  +NF+DS+VETMFR GFDGIDLDWEFP ++  EP  YL+++  LR K++ LE +IFG+
Sbjct: 197 KLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFGK 256

Query: 265 -TKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNG 323
            T+DH  FQLS+A PAF  KL  LPI ++DQYVDYWNMMTYDYYGSWSE TGYH NLF+ 
Sbjct: 257 RTEDH--FQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFS- 313

Query: 324 DGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQ-- 381
                              LN N A+ +MI    V S K+VLGMAAYGR F H+K  +  
Sbjct: 314 ----------------ETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSF-HIKDNKFE 356

Query: 382 ---GVDTLINQKFKGVGK-----GGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKK 433
                  LIN+ FKGVGK          + G+W Y  LP  GT+E YDP Y +A+C+D+K
Sbjct: 357 PFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEK 416

Query: 434 SETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFS 493
           +  FI YDN  SVK KA+YV    LGGGFWWESCG+ + N+ RSL+  F NE       S
Sbjct: 417 NSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAF-NEGLHFN-VS 474

Query: 494 DQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523
            +  IF+      YYLN+YG  GFLS  L+
Sbjct: 475 SKPSIFQDVRVKKYYLNKYGDGGFLSPYLK 504

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  432 bits (1111), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 229/513 (44%), Positives = 320/513 (62%), Gaps = 25/513 (4%)

Query: 27  QMCLHKLYFKQKATQDLIQSHFRNGTIPNR-----QEIDYLMNQTNS---NGEKXXXXXX 78
           +M L+ +Y  +K T  L +   + G I +      +E D +M   NS   NG +      
Sbjct: 23  EMVLYNIY--KKYTDQLQRFDAKPGNISSELNQHDREYDPIMKPENSEQNNGTENSLYSM 80

Query: 79  XX--XXWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLS 136
                 WSPY PR  FPHDID +RVSH+YY+F LVD   G +  SD WSD Q+D+YKPL 
Sbjct: 81  GVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYKPLY 140

Query: 137 VKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGI-IPGGSST--KMILSIGGWSN 193
           + L  ++   +  P+ ++ K  LP+GCIGE FYL+++ I I G  ST  K+ +S+GGWSN
Sbjct: 141 LSLGQVDNDFDSVPISMK-KELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGWSN 199

Query: 194 RDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRK 253
           R+ FP +VRD +K + FI+S ++TMF YGFDGIDLDWEFP+DDG EP  YL++I +L+ K
Sbjct: 200 REAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLKMK 259

Query: 254 MDDLELEIFGETKDH----PKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGS 309
           M +LE  I+ +   H    P F+LS+A PAF  KL ILP+ QMD++VD WNMMTYDY G 
Sbjct: 260 MLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYSGE 319

Query: 310 WSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAA 369
           WS+ TGYH NLF+       +  K   +  N  L  + A+ +M  +  + S K++LGMAA
Sbjct: 320 WSDVTGYHSNLFSPPDVS-GSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMAA 378

Query: 370 YGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFC 429
           YGR F  V   +    L  +KF GV  G   DEPG+WLYN+LP+KG+ E +D    +A+C
Sbjct: 379 YGRGFSGVSKSKTNGKLTGKKFNGVS-GSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYC 437

Query: 430 YDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEI 489
           YD KS+ F+ YDN  S+ +K++YV+   LGGGF WE+CG+   N + SL+ +F+ ++  I
Sbjct: 438 YDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNI 497

Query: 490 RKFSDQDLIFRRKECIAYYLNRYGTDGFLSGIL 522
            K   Q  +F  ++ + YYL +YG  GFLSG +
Sbjct: 498 DK---QKSMFSNRKVLEYYLMKYGKQGFLSGYI 527

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  430 bits (1105), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 293/468 (62%), Gaps = 12/468 (2%)

Query: 57  QEIDYLMNQTNSNGEKXXXXXXXXXXWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTG 116
           Q  DY M +++               WSPY+PR HFPHDID  +VSHIYYAF L+DP+TG
Sbjct: 39  QSDDYRMPESDVLSNTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETG 98

Query: 117 KLNPSDEWSDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGII 176
            L  SDEWSD Q++L K     +      D  K V      + P GCIGEL YL++    
Sbjct: 99  NLTSSDEWSDTQLNLAKQCREYMFKRFTGDELKAVT---NIRAPPGCIGELNYLRYIYSK 155

Query: 177 PGGSSTKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDD 236
               + K+I+S+GGWSNR+ FP +VRD  KF+NFI+S +ETM  YGFDGIDLDWEFP+DD
Sbjct: 156 IKKRNVKLIMSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDD 215

Query: 237 GLEPNKYLEMISKLRRKMDDLELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQYV 296
             EP+ YL M  +L+ ++  LE  I G+  +   FQLS+ATPAF  KLSILPI ++D+Y+
Sbjct: 216 SYEPDAYLRMARELKLQLQKLEANILGDHSN-KTFQLSMATPAFKDKLSILPIHKLDKYI 274

Query: 297 DYWNMMTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSC 356
           D WN+MTYDYYG WSE TG H NL+N  G      ++H+  A   GL+ + AI++M+  C
Sbjct: 275 DLWNLMTYDYYGEWSERTGLHANLYNEKGKLLHL-HRHDEDA---GLSGDAAINYMVNRC 330

Query: 357 NVPSSKVVLGMAAYGREFKHVKSRQ-GVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKG 415
            +   KV+LGMAAYGR F +V  +          KF GVG    G EPGMWLYNQLP+ G
Sbjct: 331 KIDPRKVILGMAAYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEG-EPGMWLYNQLPIPG 389

Query: 416 TVEMYDPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKR 475
           + E YD  +  A+CYD ++ T +GYDN  SV  KA Y+ +  LGG FWWESCGD H N +
Sbjct: 390 SNEKYDYRHVGAYCYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPK 449

Query: 476 RSLLYNFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523
           RSLL  +   +  ++  ++++ I+   +   YYL  Y T+GFL+G ++
Sbjct: 450 RSLLNTYIRVIRNVK--NNKETIYSTTKLHDYYLENYDTNGFLTGFIK 495

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  407 bits (1045), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 214/447 (47%), Positives = 299/447 (66%), Gaps = 41/447 (9%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPY+PR HFPHDID  RV+++ YAFF+VDPKTGK+ P+D WSDL+M  + P        
Sbjct: 72  WSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAP-------- 123

Query: 143 NLADNEKPVQLRDKRKLP---LGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPG 199
                           +P    G IGEL YLK    +   ++ ++ +++GGWSNR+ FP 
Sbjct: 124 ---------------GIPQGVTGMIGELNYLK----LQRNTNFRLFMAVGGWSNREAFPK 164

Query: 200 LVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLEL 259
           +VR   K +NF++S ++ MF YGFDGIDLDWEFPKDDG EP  YLEM S+LR KMD LE 
Sbjct: 165 IVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLED 224

Query: 260 EIFGETK-DHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHC 318
           EI+G    D+PKF+LSVATPAF   L ILPII+M+++V  WNMMTYD++GSWS+ TGYH 
Sbjct: 225 EIWGANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHS 284

Query: 319 NLFNGDGSE---FRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFK 375
           NL++G+ +     +  ++      N GLNA++AI  M+++  V + KV LGM AYGR F 
Sbjct: 285 NLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFT 344

Query: 376 HVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSE 435
           +V+++   D L+N+K+ GVG G  G+  G+WLYNQLPL  T E +D  + +A+C+DK  +
Sbjct: 345 NVQTKDD-DDLLNKKYSGVGGGSEGEP-GIWLYNQLPLANTAEKFDDRWVSAYCFDKNLK 402

Query: 436 TFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQ 495
           TF+GYDN+ S+++K+ YV+ + L GGF+WESCGD H + +R+L+  FS E++E+R  +  
Sbjct: 403 TFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRIPT-- 460

Query: 496 DLIFRRKECIAYYLNRYGTDGFLSGIL 522
             IF+    IAYYL ++   GFL  + 
Sbjct: 461 --IFKDPRAIAYYL-KHRQKGFLYSLF 484

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  392 bits (1007), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 206/443 (46%), Positives = 281/443 (63%), Gaps = 46/443 (10%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPY+PR HFP +ID ++++HIYY+FFLVD  +  L   D WSD++M + K   +K    
Sbjct: 60  WSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLK---- 115

Query: 143 NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVR 202
                              GCIG L  L+     PG    K I+++GGWSN+D FP  +R
Sbjct: 116 -------------------GCIGALNSLRDEK--PG---FKNIMAVGGWSNKDAFPLALR 151

Query: 203 DTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIF 262
                E    S VETMF+YGFDGIDLDWE+PKDDG EP  YLE++ K+R+ M++LE+ I+
Sbjct: 152 KKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIW 211

Query: 263 GETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFN 322
           G+ K   +F LSVATPAF  KL   PI +MDQY+DYWNMMTYDYYG WS  TG+H NL++
Sbjct: 212 GDKKR--RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYD 269

Query: 323 GDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQG 382
           G  ++F      EH+     L A+ AI +M     + S KVVLGMA YGR F +VK    
Sbjct: 270 GT-NKFS-----EHS-----LCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDP 318

Query: 383 VDT--LINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGY 440
             T  LIN+KFKGVG    G EPGMWLYNQLP++GT E++D  YG+A+C+D K++T +GY
Sbjct: 319 KKTSGLINRKFKGVGGESEG-EPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGY 377

Query: 441 DNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFR 500
           DNVDS + KAQYV+   L GGFWWESCG+   N ++SL++ F+ ++  + +  ++  +++
Sbjct: 378 DNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDR--NETNLYQ 435

Query: 501 RKECIAYYLNRYGTDGFLSGILQ 523
             +   +YL  +   GFL+   +
Sbjct: 436 DPKLREHYLQIFAKSGFLAATFK 458

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  377 bits (968), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/447 (44%), Positives = 266/447 (59%), Gaps = 37/447 (8%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WS Y+PR HFPH+I+   +SH+YYAFFLVD K GKL   D+W+D Q  + K         
Sbjct: 67  WSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK--------- 117

Query: 143 NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVR 202
                          KL  G +GELF LK        +  K I+ IGGWSNR+ +     
Sbjct: 118 -------------NNKLVKGNVGELFDLKMK------NRVKCIMCIGGWSNREAWHIFST 158

Query: 203 DTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIF 262
           D  K E+F + AV+ MF YGFDGIDLDWE+P+DDG+EP  YLE++ +++  M+ LE EIF
Sbjct: 159 DPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIF 218

Query: 263 GETKDHPK-FQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLF 321
            +T      F+LSVATPAF  KL I P+ +MD  +DYWNMMTYDYYG WSE TGYH NL+
Sbjct: 219 KDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLY 278

Query: 322 NGD-GSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHV--- 377
           +G  GS           +   GLN + A+ +MI    +   K++LGMAAYGR F +V   
Sbjct: 279 DGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVP 337

Query: 378 -KSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSET 436
                     I + F GVG    G EPGMW Y+QLP+ GTVE +DP Y + +C++  + T
Sbjct: 338 TPRPNESPRYIGRTFDGVGGASEG-EPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGT 396

Query: 437 FIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQD 496
           F+GYD +DSV++K QY++ +++GGGFWWESCGD H N  RSL+  +  E+         +
Sbjct: 397 FVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGR-DNIKKPE 455

Query: 497 LIFRRKECIAYYLNRYGTDGFLSGILQ 523
            I++   C+++Y   +   GFLS  L+
Sbjct: 456 SIYKNLHCVSHYKQSFHGKGFLSKYLK 482

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/444 (44%), Positives = 275/444 (61%), Gaps = 43/444 (9%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPY  R H P DI  ++++H+YYAFF+VD K+G +  SD WSD ++    PLSV +   
Sbjct: 75  WSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK-- 128

Query: 143 NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVR 202
                              GCI EL  +K    +      K IL +GGWSNR+ +  + +
Sbjct: 129 -------------------GCIKELQKIK----LESKHEFKTILCLGGWSNREAYKKIAK 165

Query: 203 DTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIF 262
             +K + FI++AV+ MFRYGFDGIDLDWEFP++D  EP  YLEM+  +R  MD LE +IF
Sbjct: 166 SEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIF 225

Query: 263 G---ETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCN 319
           G   E KDHP FQLSVATPAF  KL+ILPI +M +YVD WNMM YD++G WS+ TGYH N
Sbjct: 226 GSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSN 285

Query: 320 LFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKS 379
           L+    S  R+     +   N+ L+++ A+  M    N+ S ++ LGMAAYGR F +V++
Sbjct: 286 LYLQGHSHRRS---LSNRISNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVET 342

Query: 380 RQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIG 439
               D  + +K+ GVG G  G EPG+WLYNQLP+ G+ E +D N  +A+C+D KS TF+G
Sbjct: 343 ND--DNYLGKKYHGVGGGSEG-EPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVG 399

Query: 440 YDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIF 499
           YDNV S+ +K +Y++ + L GGFWWESCGD   + R+SL+  FS E+     F     +F
Sbjct: 400 YDNVQSMDIKGKYIKKKNLNGGFWWESCGDSK-DPRKSLVNAFSKEIGLSEGFVS---LF 455

Query: 500 RRKECIAYYLNRYGTDGFLSGILQ 523
           +  +   ++L +Y  D ++S + Q
Sbjct: 456 KSDKVKQFHLQKYPKD-YISSLFQ 478

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 280/453 (61%), Gaps = 30/453 (6%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPY  R HFPHDID  +++H+YYAF +V+ +TG+   SDEWSD+QMDLYK +      L
Sbjct: 80  WSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQMISSFKKL 139

Query: 143 NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GGSST----KMILSIGGWSNRDR 196
           +L   + P   +DK  LPLGCIGELF+LK+S  +   GGS+     K I+S+GGWSNR+ 
Sbjct: 140 DL-RAQFPTGSKDK--LPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREA 196

Query: 197 FPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDD 256
           F  LV    K E F+DS V  MF YGFDGID+DWEFPK+D  EP  YL+M+  LR ++D 
Sbjct: 197 FTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDT 256

Query: 257 LELEIFGETKDHP-KFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATG 315
           LE +IFG +KDH   F L+ A  A    L  LP+ + D+YVDYWN+M YD+ G+WS  T 
Sbjct: 257 LESQIFG-SKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTA 315

Query: 316 YHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFK 375
           Y  NL+    +  R        + N   +A++A+ F+     + S K+VLGM AYGR FK
Sbjct: 316 YQSNLYTPAKTNKR--------STNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFK 367

Query: 376 HVK-SRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFC----Y 430
            V+ S + ++ +I + F+ V     G+E G+ LY QLPLKG +E +D N  +A+C    +
Sbjct: 368 GVEVSHKSIENVIGKPFQDVSGSSEGEE-GISLYKQLPLKGGMEFFDHNAVSAYCVKLSH 426

Query: 431 DKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIR 490
           +KK    I YDNVDS+  KA YV+   LGGGFWWESCG+D+  K +SL+  F+ E+  + 
Sbjct: 427 NKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFTKEIKCLN 484

Query: 491 KFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523
           K   +  I+   E + +YL  +   GFL+   Q
Sbjct: 485 K--TEPTIYSLPEVVQHYLKLH-PGGFLASTFQ 514

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  367 bits (943), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/442 (46%), Positives = 278/442 (62%), Gaps = 38/442 (8%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPYKPR H+P +ID  RV+H+YYAFF+VD KTGK+   D+WSD +M             
Sbjct: 72  WSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM------------- 118

Query: 143 NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVR 202
                  P+ L    +   G IGEL YLK       G+  K+++++GGWSNR+ F  +VR
Sbjct: 119 -------PMNLTGMPRGLNGAIGELNYLKTRP----GTDFKLMMAVGGWSNREPFHKIVR 167

Query: 203 DTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIF 262
           D  KF NFIDSA++ MF YGFDGIDLDWEFPKDDG EP  YLEM S+LR KMD+LE  I+
Sbjct: 168 DEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIW 227

Query: 263 GE-TKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLF 321
           G      P+F LS+A PAF   L I P+ +M++Y+  WNMMTYDY+G+WSE TGYH NL+
Sbjct: 228 GPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLY 287

Query: 322 NGDGSEFRAGY---KHEHTAHNN--GLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKH 376
           N   S +++     ++E    +N   LNA++AI  M +   V   K+ LGMAAYGR F +
Sbjct: 288 NATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTN 347

Query: 377 VKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSET 436
           V  R   + LI QK+ GVG G  G+  GMWLYNQLPL    E +D  + +A+ YD  ++T
Sbjct: 348 V--RGDGEQLIGQKYSGVGGGSEGEP-GMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKT 404

Query: 437 FIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQD 496
            + YDNVDS+K+K +YV+ ++L G F WESCGD+  +K R+L+  F+  +   RK +   
Sbjct: 405 LVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKAT--- 461

Query: 497 LIFRRKECIAYYLNRYGTDGFL 518
             ++  + I YYL R   +GFL
Sbjct: 462 -AYKDSKLIQYYL-RTRPEGFL 481

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  359 bits (922), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 196/452 (43%), Positives = 275/452 (60%), Gaps = 27/452 (5%)

Query: 83  WSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL 142
           WSPYK R HFPHDID  R++ ++Y+F +V+ +TG+   SDEWSD+QMDLYK +      +
Sbjct: 80  WSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQMFSAFEKV 139

Query: 143 NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GG----SSTKMILSIGGWSNRDR 196
           +L   ++      +  LPLGCIGELFYLK++  +   GG     + K I+S+GGWSNR+ 
Sbjct: 140 DL---KRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREA 196

Query: 197 FPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDD 256
           F  LV+   K + FI+S V+ MF+YGFDGID+DWEFPK+D  EP  YL+M+  LR+K+DD
Sbjct: 197 FESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDD 256

Query: 257 LELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGY 316
           LE +IFG  K    F L+ A  A    L  LP+ ++D+YVD WN+M YD+ G+WS  T Y
Sbjct: 257 LESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAY 316

Query: 317 HCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKH 376
             NL+    S    G + E++    G +A+ A+  ++    +P+ K+VLGM AYGR FK 
Sbjct: 317 QSNLY----SRSSLGKRSENS---EGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKG 369

Query: 377 VK-SRQGVDTLINQKFKGVGKGGLGD-EPGMWLYNQLPLKGTVEMYDPN----YGAAFCY 430
           V         +I Q F+ V   GL + E G+ LYNQLPLKG  E +D +    Y      
Sbjct: 370 VSVPHHSEHNVIGQSFQQV--SGLSEGESGISLYNQLPLKGGQEWFDQDAVSAYSVKLAS 427

Query: 431 DKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIR 490
           +K+    + YDNV S+K+KAQYV    LGGGFWWESCG+++++  RSL   F+ E+  + 
Sbjct: 428 NKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKYLN 487

Query: 491 KFSDQDLIFRRKECIAYYLNRYGTDGFLSGIL 522
           K      I+   +   YY  +Y  DGFL+ I+
Sbjct: 488 K--TVPTIYALPQVGEYYHKKY-PDGFLASII 516

>KLTH0E11000g Chr5 complement(988370..991429) [3060 bp, 1019 aa]
           {ON} similar to uniprot|P06777 Saccharomyces cerevisiae
           YPL022W RAD1 Single-stranded DNA endonuclease
          Length = 1019

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 65/154 (42%), Gaps = 24/154 (15%)

Query: 124 WSDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTK 183
           WS  + D  +P SV   +L   D         +R+L L          H GI+   S   
Sbjct: 142 WSGTEEDGQRPFSVVTADLLTVDQ--------RRRLYL----------HGGIVSVTSRIL 183

Query: 184 MILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKY 243
           ++  + G  + ++  GLV      EN  + + E+     +  ++  W F K    EP  +
Sbjct: 184 IVDLLSGIIHPNKITGLV--ILHVENLHNYSNESFIAEMYRSVN-RWGFIKAVSDEPEAF 240

Query: 244 LEMISKLRRKMDDLELEIFGETKDHPKFQLSVAT 277
           +   S L+RK+ DL L+    T   P+F + V++
Sbjct: 241 MTEFSPLKRKLKDLRLK---RTLLWPRFHVEVSS 271

>Skud_9.67 Chr9 complement(146744..148273) [1530 bp, 509 aa] {ON}
           YIL104C (REAL)
          Length = 509

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 66/156 (42%), Gaps = 16/156 (10%)

Query: 84  SPYKPRFHFPHD-IDLTRVSHIYYA-FFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHN 141
           SPY  R  FPH+ +D  R + +Y +    ++ K GKLN ++ + DL +    P  +    
Sbjct: 45  SPYYLRLRFPHELVDDERSTALYDSKSECINVKIGKLNKNEYFEDLDL----PTKLLARQ 100

Query: 142 LNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIG---GWS-----N 193
            +L D++   +  D++K     I E+       +       K I  +G    W      +
Sbjct: 101 GDLVDSDALTEHPDEKKKQKPLIQEI--CADDTLNTPKEDVKTIGQMGEDFNWEIEQKMD 158

Query: 194 RDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLD 229
           R    GL++    F+N  D+ +      G D  +LD
Sbjct: 159 RAINEGLLKTKYGFDNLYDTIISVSMSNGNDINELD 194

>TBLA0F03920 Chr6 (970663..972165) [1503 bp, 500 aa] {ON} Anc_2.561
           YMR014W
          Length = 500

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 14/62 (22%)

Query: 84  SPYKPRFHFPHDIDLTRVS------------HIYYAFFLVDPKTGKLNPSDEWSDLQMDL 131
           S ++      HDID T++S            H Y+ F+  + KT K NPS  W D+ + +
Sbjct: 134 SKFEEALKKHHDIDQTKISDIKDPVELWFHNHEYWTFY--NDKTNKFNPSKIWKDVVLTV 191

Query: 132 YK 133
            K
Sbjct: 192 EK 193

>CAGL0G08085g Chr7 (763185..767921) [4737 bp, 1578 aa] {ON} highly
           similar to uniprot|Q12675 Saccharomyces cerevisiae
           YDR093w
          Length = 1578

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 310 WSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAA 369
           W E+ G H NL++  G+ FR     ++   N  +N N   + +++ C + ++K  +G+ A
Sbjct: 475 WIESEGPHANLYSYQGN-FRWNSLEDNQLKNEPVNIN---NLLLRGCTLRNTKWAMGVVA 530

Query: 370 YGREFKHVKSRQGV 383
           +  +   +    GV
Sbjct: 531 FTGDDTKIMLNAGV 544

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 5/71 (7%)

Query: 171 KHSGIIPGGSSTKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDW 230
           K SGII  GS+  ++  +         PG + D   F  F +S V+  F  G    + +W
Sbjct: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELG----NKNW 361

Query: 231 EFPKDDGL-EP 240
             P    L EP
Sbjct: 362 TIPASSYLGEP 372

>KNAG0H02990 Chr8 (552495..557054) [4560 bp, 1519 aa] {ON} Anc_8.231
           YER166W
          Length = 1519

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 310 WSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAA 369
           W E+ G H NLFN  G+ F+     +    N  ++ N   + +++ C + ++K  +GMA 
Sbjct: 430 WVESEGPHANLFNYQGN-FKWLDPTDRATKNEPVSIN---NVLLRGCTLRNTKWAMGMAI 485

Query: 370 YGREFKHVKSRQGV 383
           +  +   +    GV
Sbjct: 486 FTGDDTKIMLNSGV 499

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,387,239
Number of extensions: 2745133
Number of successful extensions: 6590
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6628
Number of HSP's successfully gapped: 30
Length of query: 525
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 411
Effective length of database: 40,409,475
Effective search space: 16608294225
Effective search space used: 16608294225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)