Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F034105.438ON1061065624e-76
CAGL0A02882g5.438ON1041044454e-58
KNAG0C048805.438ON1041034436e-58
Kwal_55.214145.438ON1191044212e-54
TDEL0D026305.438ON1021034142e-53
NDAI0B057005.438ON1041034107e-53
SAKL0G02618g5.438ON1041034021e-51
ZYRO0F10120g5.438ON1051053993e-51
Kpol_1016.35.438ON971033844e-49
KLTH0F15972g5.438ON1031033691e-46
KLLA0E02267g5.438ON1031043491e-43
ACL169W5.438ON1031043455e-43
Ecym_45095.438ON1031043386e-42
Kpol_1016.3asingletonON971033273e-40
TPHA0C00950singletonON991042362e-26
KAFR0D02490singletonON107952206e-24
TBLA0C05870singletonON1001011935e-20
KAFR0D02400singletonON114941615e-15
KAFR0D02500singletonON112941512e-13
Kpol_2001.657.322ON120667607.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03410
         (106 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     221   4e-76
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   176   4e-58
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   175   6e-58
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   166   2e-54
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   164   2e-53
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   162   7e-53
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   159   1e-51
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   158   3e-51
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   152   4e-49
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   146   1e-46
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   139   1e-43
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   137   5e-43
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   134   6e-42
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   130   3e-40
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                 96   2e-26
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      89   6e-24
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    79   5e-20
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                67   5e-15
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      63   2e-13
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    28   7.0  

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  221 bits (562), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKSKK 106
           QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKSKK
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKSKK 106

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  176 bits (445), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 82/104 (78%), Positives = 89/104 (85%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCVIVYDKPGSDRS  RPQHLA IP LVE GKLVCAGAIYNEP   G   TFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104
           QI+ADTKEEAL +V ND+FAK GIWD +NIIIY+FGCAVR+PK+
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA 104

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  175 bits (443), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 79/103 (76%), Positives = 89/103 (86%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWC +VYDKPGSDRS FRP+HLA IP LV+QGKLVCAGAIYNEP + G   TFAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103
           QI+ADTKEEAL ++  D+FAKEGIWD  NII+Y+FGCAVREPK
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  166 bits (421), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (82%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCVIVYDK GSDRS FRP HL  IP LVE+GKLVCAGAIY +   EG+   FAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104
           QI+ADTKEEAL IV  D+FAKEGIWD +NIIIY FGCAVR+PK+
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPKA 119

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  164 bits (414), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/103 (77%), Positives = 86/103 (83%), Gaps = 2/103 (1%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEW VIVYDK   DRSAFRP HLA IP LVEQGKLVCAGAIYNEP + G   TFAGSHL
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103
           QI+ADTKEEAL +V  DIFAKEG+WD DNIIIY+FGCAVR+ K
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  162 bits (410), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 82/103 (79%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCVI+ DK GSDRSAF  QH A IPALVEQGK+VC GAIYNEP  EG  PT AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103
           Q++ADTKEE + +V  DIFAKEGIWD DN IIYRF  A+R PK
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  159 bits (402), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 85/103 (82%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCV+VYDKP +DRS FRP HLA IP LVEQGKLVCAGAI+NE   EG+   FAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103
            I+AD+KEEAL +V ND+FAKEGIWD +NI+I+ FGCAVR+ K
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  158 bits (399), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 73/105 (69%), Positives = 89/105 (84%), Gaps = 2/105 (1%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEW VI +DK  +DRSA+R +HLA IP  VE GKLVCAGAIYNEPK+ GE  TFAGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKSK 105
           Q++ADTKEEA+ IV +DIFAKEG+WD DN+I+Y+FGCA+R+P +K
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPVNK 103

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  152 bits (384), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 82/103 (79%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCVI+ DK GSDRS  RPQHLA IP LVEQGKL CAGAIYN+  S      FAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYNDDGS------FAGSHL 54

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103
           QI+ADTKE+AL +V  D+FA  GIWD D+IIIY+FGCAVR+PK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  146 bits (369), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 81/103 (78%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCVIV+DK GSDRSA RP HL  +    E+G LVCAGAIY+E   +G+   FAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103
           QI A+TKE+AL +V NDIFAKEGIWD +NIIIY FGCAVR+ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  139 bits (349), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (76%), Gaps = 1/104 (0%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEW VIVYDKPGSDRSA RPQHLA IP LVE GK+V AGAIY +   +G+   FAGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104
            I+AD+K+E + ++ ND+FAK  IWD DN +IY FGCAVR+ K 
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  137 bits (345), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 79/104 (75%), Gaps = 1/104 (0%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWC I+YDKPG DRS  R +HLA IP LVEQGKLV AGAIY E   +G    FAGS L
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEV-VDGRPSQFAGSQL 59

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104
            ++AD++EEALAI+ +D FAK G+WD +N+++Y FGCAVR+ K 
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  134 bits (338), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 80/104 (76%), Gaps = 1/104 (0%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           MVEWCV VYDKPGSDRS +R  HL  IP LV++GK+V AGAIY +   +G+   FAGSHL
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKD-LVDGKPGGFAGSHL 59

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104
            ++ADT+EE + ++  DI+AKEG+WD DNI+I+ FGCAVR+ K 
Sbjct: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  130 bits (327), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (70%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           M EWC+I+ DK GS+RS    QH A I  LVEQG L C GAIYN+  S       AGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYNDDGS------VAGSHL 54

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103
           QI+ADTKE+AL +V  D+FA  GIWD D+I+IY+F CAVR+PK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 68/104 (65%), Gaps = 8/104 (7%)

Query: 1   MVEWCVIVYDKPGSD--RSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGS 58
           M E+ V++ D  G++  R    P+H   IP LV+ G +VC GA++NE  S        GS
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNEEGSP------VGS 54

Query: 59  HLQIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREP 102
           H+QI+AD++E+ L ++  D+FA+E +WD ++ IIY+F CAVR+P
Sbjct: 55  HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRKP 98

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 89.4 bits (220), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 6/95 (6%)

Query: 1  MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
          M EW V V DKP +DR+ +  +HLAA+P L E+  LV AGA+  +   E       GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALIGDNGKE------VGSSF 54

Query: 61 QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRF 95
          Q++A++KE+A+ ++ NDIFAKEG+++ D+ + YRF
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 79.0 bits (193), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 57/101 (56%), Gaps = 6/101 (5%)

Query: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
           M EW V + D P SDR+    +H+  +P L+  G L C GA+ ++  +        GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDDNGN------MIGSHF 54

Query: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVRE 101
           ++  +TKEEA+ ++  D F K G+WD ++I I +F C  RE
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHRE 95

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 66.6 bits (161), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 6/94 (6%)

Query: 1  MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
          M EW V V D    DR+ + P+H+  +P+LV+ G +V AGA+      E       G   
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGALTTPEGKE------IGGMF 54

Query: 61 QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYR 94
           + A TKEEA+ IV  D+FA++GI++ D++   R
Sbjct: 55 IVTAKTKEEAIEIVKRDVFARKGIFNMDSVTCER 88

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 62.8 bits (151), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 1  MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60
          M EW V + D  G+DR+ + P+H+  +  L ++  LV AGA+      E       G  L
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGALTTPEGKE------TGGIL 54

Query: 61 QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYR 94
           I A TKEEA+ +V  D+FA++GI+  D I   R
Sbjct: 55 IIAAKTKEEAIEVVKRDVFARKGIFKMDTITCER 88

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 4/67 (5%)

Query: 31  VEQGKLVCAGAIYNEP----KSEGEAPTFAGSHLQIIADTKEEALAIVMNDIFAKEGIWD 86
           V+QGK +   ++ N        +G+       H   I + + E ++     I  K   WD
Sbjct: 485 VQQGKQLAEMSLKNVKYVSWSQDGQYVALISKHTITITNKRLELVSTRHETIRVKSAAWD 544

Query: 87  TDNIIIY 93
             N++IY
Sbjct: 545 ESNVLIY 551

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,122,586
Number of extensions: 392960
Number of successful extensions: 686
Number of sequences better than 10.0: 23
Number of HSP's gapped: 674
Number of HSP's successfully gapped: 23
Length of query: 106
Length of database: 53,481,399
Length adjustment: 76
Effective length of query: 30
Effective length of database: 44,766,783
Effective search space: 1343003490
Effective search space used: 1343003490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)