Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F034005.437ON41541519900.0
NDAI0B056905.437ON42339710601e-142
KAFR0E038205.437ON3963878831e-115
Suva_2.5425.437ON4423918121e-104
Smik_4.6365.437ON4463908091e-103
Skud_4.6395.437ON4423887851e-100
YDR370C5.437ON4423887638e-97
TDEL0B021805.437ON4184236712e-83
ZYRO0F10098g5.437ON3733966385e-79
Kpol_1016.45.437ON4133956224e-76
CAGL0A02860g5.437ON4023575762e-69
SAKL0G02596g5.437ON4003875544e-66
KNAG0C048905.437ON4053935441e-64
TPHA0J026005.437ON4413964912e-56
KLTH0F15994g5.437ON3903774776e-55
Kwal_55.214155.437ON3893844742e-54
TBLA0A028005.437ON4533824484e-50
AER404C5.437ON3863634164e-46
KLLA0E02245g5.437ON4033413563e-37
CAGL0C01925g3.570ON40080930.007
NCAS0E002403.570ON38071870.037
Kpol_380.83.570ON379134860.048
KLLA0E12893g3.570ON38471850.064
NDAI0I032603.570ON37771810.20
Kwal_47.192763.570ON38692810.20
Smik_7.153.570ON38792810.20
TDEL0D057303.505ON459131800.28
KLTH0G00660g3.570ON38373780.46
YGL246C (RAI1)3.570ON38792780.46
Skud_7.213.570ON38992780.46
SAKL0F00726g3.570ON38371770.60
Suva_7.153.570ON38992770.61
Suva_2.6305.573ON63156751.2
Kpol_1018.352.531ON51754722.7
CAGL0I01628g1.466ON77467713.8
Kwal_23.5257singletonOFF8323645.0
NCAS0C005908.812ON15369675.2
AFR262CsingletonON77598696.6
KAFR0B037708.812ON15369667.0
AFR263C3.570ON376102687.4
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NCAS0F03400
         (1248 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   771   0.0  
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   412   e-142
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   344   e-115
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   317   e-104
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   316   e-103
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   306   e-100
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   298   8e-97
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   263   2e-83
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   250   5e-79
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   244   4e-76
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   226   2e-69
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   218   4e-66
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   214   1e-64
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   193   2e-56
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   188   6e-55
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   187   2e-54
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   177   4e-50
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   164   4e-46
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   141   3e-37
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    40   0.007
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    38   0.037
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    38   0.048
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    37   0.064
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     36   0.20 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    36   0.20 
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    36   0.20 
TDEL0D05730 Chr4 (1030911..1032290) [1380 bp, 459 aa] {ON} Anc_3...    35   0.28 
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    35   0.46 
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    35   0.46 
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    35   0.46 
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    34   0.60 
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    34   0.61 
Suva_2.630 Chr2 (1119245..1121140) [1896 bp, 631 aa] {ON} YDR456...    33   1.2  
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    32   2.7  
CAGL0I01628g Chr9 complement(132246..134570) [2325 bp, 774 aa] {...    32   3.8  
Kwal_23.5257 s23 complement(1079507..1079758) [252 bp, 83 aa] {O...    29   5.0  
NCAS0C00590 Chr3 (95193..95654) [462 bp, 153 aa] {ON} Anc_8.812 ...    30   5.2  
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    31   6.6  
KAFR0B03770 Chr2 (781218..781679) [462 bp, 153 aa] {ON} Anc_8.81...    30   7.0  
AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON} S...    31   7.4  

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
            Anc_5.437 YDR370C
          Length = 415

 Score =  771 bits (1990), Expect = 0.0
 Identities = 384/415 (92%), Positives = 384/415 (92%)
 Frame = +1

Query: 1    MKKTGQELMPLHTTVQSQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHK 180
            MKKTGQELMPLHTTVQSQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHK
Sbjct: 1    MKKTGQELMPLHTTVQSQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHK 60

Query: 181  LYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEP 360
            LYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEP
Sbjct: 61   LYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEP 120

Query: 361  CMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVV 540
            CMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLF            VQDYVLNVV
Sbjct: 121  CMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVV 180

Query: 541  YTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXX 720
            YTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLM             
Sbjct: 181  YTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEK 240

Query: 721  XXXXXXAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLK 900
                  AVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLK
Sbjct: 241  LTGGEKAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLK 300

Query: 901  AWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVAT 1080
            AWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVAT
Sbjct: 301  AWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVAT 360

Query: 1081 QWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEYL 1245
            QWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEYL
Sbjct: 361  QWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEYL 415

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5.437
            YDR370C
          Length = 423

 Score =  412 bits (1060), Expect = e-142
 Identities = 207/397 (52%), Positives = 274/397 (69%), Gaps = 4/397 (1%)
 Frame = +1

Query: 64   PITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQL- 240
            PIT +PF +F H SIS +P     F+E+S  VALYHN +LY +   ++IP L+  IA+L 
Sbjct: 35   PITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLA 94

Query: 241  -PKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPG 417
             P  S +EAR LK  YLGSDLYDG+E+F+PM   +LDS+EPC  +I+ WE +    Y+ G
Sbjct: 95   NPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLG 154

Query: 418  RKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTG 597
             KF IVS RHHIVEMTM +F            + D++LNV Y G   G LLF++D +   
Sbjct: 155  NKFTIVSARHHIVEMTMCIFNKRK--------MDDFILNVTYKGGSNGMLLFSRDVNKKD 206

Query: 598  NSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXX--AVFAVVENKLD 771
            +    GIYSK+ ++++I YSGFALEDL+                     AVFA++ENKL+
Sbjct: 207  DG---GIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLN 263

Query: 772  DDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGI 951
            DDI +LLRCE+D++N   K FTE+KCF+ LKM+N +HRRKLLKAWVQTGV+P+SDILIGI
Sbjct: 264  DDISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGI 323

Query: 952  RDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDEN 1131
            RD  FGEL D+EW+SR  L  +INNRNLPE+K+D N+NA++A QWSQHCI+SICKLVDE+
Sbjct: 324  RDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDES 383

Query: 1132 LDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEY 1242
            +D+  ++  Q FQIRI++ R I+IK L  VP ++  Y
Sbjct: 384  IDKTRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
            YDR370C
          Length = 396

 Score =  344 bits (883), Expect = e-115
 Identities = 179/387 (46%), Positives = 251/387 (64%), Gaps = 3/387 (0%)
 Frame = +1

Query: 79   PFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQ--YDIIPHLKNDIAQLPKK- 249
            PF  F H SI+ FP     F++ S +VA YH+ ++Y  ++   DI+P L  DI+++ +  
Sbjct: 31   PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQGV 90

Query: 250  SASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFN 429
            SA +AR  K  Y+GSDLY GFE F  MS ++LDS  PC ++IK WE     KY   +K+ 
Sbjct: 91   SAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYT 150

Query: 430  IVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMN 609
            IVS RHHIV + M +F             ++ ++N  Y G+  G L F++D S+   +MN
Sbjct: 151  IVSARHHIVNLIMSIFDTS----------KETIVNSTYLGN--GLLTFSQDTSDP-MTMN 197

Query: 610  EGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICIL 789
            EGI++KN  LK+ICYSGFALEDL+                    +F++ EN+LDD+I +L
Sbjct: 198  EGIFTKNKNLKKICYSGFALEDLLTKSQKEP-------------LFSITENQLDDNITLL 244

Query: 790  LRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFG 969
            LRCE+DA+N   + +TELKC++PLKM++  HR+KLLK W+QTGVLP SD++ GIR    G
Sbjct: 245  LRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNG 304

Query: 970  ELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAI 1149
            EL D+EWYSRD L  + NNRNLPE+K   NFNA +A +WS HCI++IC+L+ +NL   A 
Sbjct: 305  ELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDA- 363

Query: 1150 SNPQGFQIRIDSRRNIRIKCLSKVPKD 1230
              PQ FQI++D+ RNI I+ LSK+P++
Sbjct: 364  --PQAFQIKVDTFRNISIRNLSKIPQN 388

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
            YDR370C (REAL)
          Length = 442

 Score =  317 bits (812), Expect = e-104
 Identities = 167/391 (42%), Positives = 246/391 (62%), Gaps = 3/391 (0%)
 Frame = +1

Query: 70   TRVPFGEFSHSSISLFPTCTQP--FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLP 243
            TRVP+  F H+SI  FPT   P  FYES  +VAL+ +++LY A++ D+IP+LK DI+ L 
Sbjct: 64   TRVPYSSFLHTSIRNFPTKPPPDIFYESK-EVALFTDNQLYVAARKDVIPNLKEDISHLY 122

Query: 244  KKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGR 420
            +    EAR LK  YLG DL+   +  VPM+  +LD++ PC+S+I+DW    S K +K G+
Sbjct: 123  ESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGK 182

Query: 421  KFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGN 600
            KF +V+TRHHIV++TM  F             ++   +++ T    G +  +++      
Sbjct: 183  KFTVVTTRHHIVDLTMHPFDR-----------RNKQKSIIATYMGNGFISLSRNPKYDHK 231

Query: 601  SMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDI 780
            +  EGIYS +  +K+IC+SGF  E+ +                    VF++VE KL +DI
Sbjct: 232  ASKEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCP-----VFSIVEGKLSEDI 286

Query: 781  CILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDS 960
             +L+RCE+DAFN   K  TELKCF PL M N SHR+KLLK W+QTG+LP+SDI++G+RDS
Sbjct: 287  GLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDS 346

Query: 961  SFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQ 1140
              G+L D++WYSRD L  K N+  LP +K + N+NA+VA +W +HCI+SIC LV+ N+ +
Sbjct: 347  YSGQLLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISR 406

Query: 1141 KAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 1233
               + P+ F+I ID+   I I  LS +P+++
Sbjct: 407  YNCNKPEPFEINIDANGTIIITKLSTIPRNV 437

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
            YDR370C (REAL)
          Length = 446

 Score =  316 bits (809), Expect = e-103
 Identities = 166/390 (42%), Positives = 237/390 (60%), Gaps = 2/390 (0%)
 Frame = +1

Query: 70   TRVPFGEFSHSSISLFPTCT-QPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPK 246
            TRV +  FSHS +  FP    +  +  S +VAL+ N + Y   + DI+P+LK DIA+L +
Sbjct: 64   TRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAELCE 123

Query: 247  KSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWE-RKASTKYKPGRK 423
            +S  +AR  K  YLG DL+     FVPM+  +LDS+ PC+S+I++W        +K GRK
Sbjct: 124  RSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRK 183

Query: 424  FNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNS 603
            F +V+TRHHIV+MTM LF             ++   ++V T    G + F+++  N    
Sbjct: 184  FTVVTTRHHIVDMTMHLFDR-----------RNKKRSLVATYMGAGLISFSRNQKNDSRM 232

Query: 604  MNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDIC 783
              EGIYS +  +K+ICYSGF  E+ +                    VF+VVE+KL ++I 
Sbjct: 233  SKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKLP-----VFSVVESKLSEEIG 287

Query: 784  ILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSS 963
            +L+RCE+DAFN      TELKCF+PL M N +HRRKLLK W+QTG+ P+SDI+IG+RDS 
Sbjct: 288  LLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSH 347

Query: 964  FGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQK 1143
             G+L D++WYSRD L  K N+  LP +K + N+NA+VA +W  HCI+SIC+L+  N+   
Sbjct: 348  SGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDY 407

Query: 1144 AISNPQGFQIRIDSRRNIRIKCLSKVPKDI 1233
            +  NP+ F+I IDS   I I  L  +PK +
Sbjct: 408  SCKNPESFEISIDSNNTIAITKLKNIPKHV 437

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
            YDR370C (REAL)
          Length = 442

 Score =  306 bits (785), Expect = e-100
 Identities = 163/388 (42%), Positives = 235/388 (60%), Gaps = 2/388 (0%)
 Frame = +1

Query: 76   VPFGEFSHSSI-SLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKS 252
            VP+  F H+SI  L        ++ S +VAL+ N++ Y  ++ D+IP L++ I +L + S
Sbjct: 66   VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESS 125

Query: 253  ASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGRKFN 429
              EAR  K  YLG DL+   + FVPM+  +LDS+ PC+S++++W+     K +K G+KF 
Sbjct: 126  LLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFT 185

Query: 430  IVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMN 609
            IVS RHHIV++TM  F                 L V Y G   G + F+++  N      
Sbjct: 186  IVSARHHIVDLTMHRFDRRNKRKS---------LIVTYMG--AGLISFSRNPKNDFQMSK 234

Query: 610  EGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICIL 789
            EGIYS +  +K+ICYSGF  E  +                    +F+VVE+KL +DI +L
Sbjct: 235  EGIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHP-----IFSVVESKLSEDIGLL 289

Query: 790  LRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFG 969
            +RCE+DAFN   +  TELKCF PL M N +HR+KLLK W+QTG+LP+SDI+IG+RDS  G
Sbjct: 290  MRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSG 349

Query: 970  ELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAI 1149
            +L D++WYSRD L  K N+  LP SK + NFNA+VA +W  HCI+SIC+LV+ N+     
Sbjct: 350  QLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNS 409

Query: 1150 SNPQGFQIRIDSRRNIRIKCLSKVPKDI 1233
            + P+ F++ ID+   I I  L+ VPK++
Sbjct: 410  TRPESFEVSIDANGTIAITKLNTVPKNV 437

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
            Putative protein of unknown function
          Length = 442

 Score =  298 bits (763), Expect = 8e-97
 Identities = 159/388 (40%), Positives = 233/388 (60%), Gaps = 2/388 (0%)
 Frame = +1

Query: 76   VPFGEFSHSSISLFPTCT-QPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKS 252
            +P+  F H+ +  F T   +  +  S +VAL+ N + Y   + D+IP+LK  IA+L + S
Sbjct: 66   IPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAELYESS 125

Query: 253  ASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGRKFN 429
              EA+  K  YLG DL+   + FVPM+  +LDS+ PC S+I++W      K +K G+KF 
Sbjct: 126  LLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFT 185

Query: 430  IVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMN 609
            +V+TRHHIV++TM LF             +   L V Y G   G L F ++         
Sbjct: 186  VVTTRHHIVDLTMHLFNRRN---------RQTSLIVTYMG--AGLLSFCRNVKKDSQMSK 234

Query: 610  EGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICIL 789
            EGIYS +  +K+ICYSGF  E+ +                    +F++VE+KL ++I +L
Sbjct: 235  EGIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCP-----IFSLVESKLSEEIGLL 289

Query: 790  LRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFG 969
            +RCE+DAFN   +  TELKCF+PL M N +HRRKLLK WVQTG+LP+SDI+IG+RDS  G
Sbjct: 290  IRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSG 349

Query: 970  ELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAI 1149
            +L D++WYSRD L  K N+  LP +K + N+NAQ+A +W  +CI +ICKLV+ N+   + 
Sbjct: 350  QLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSS 409

Query: 1150 SNPQGFQIRIDSRRNIRIKCLSKVPKDI 1233
            + P+ F+I ID+   I I  L   P+++
Sbjct: 410  TKPESFEIGIDTNNAIVITKLKTTPRNV 437

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
            YDR370C
          Length = 418

 Score =  263 bits (671), Expect = 2e-83
 Identities = 150/423 (35%), Positives = 232/423 (54%), Gaps = 12/423 (2%)
 Frame = +1

Query: 1    MKKTGQELMPLHTTVQSQKQAPITR---VPFGEFSHSSISLFPTCTQPFYESSNQVALYH 171
            +   G +  P   + Q +KQ    R   +PF +F HS +  FP  T  F+E   +VA Y 
Sbjct: 22   LNSLGLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQ 81

Query: 172  NHKLY--PASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDL 345
            N  L+   +S+  + P L+   A + +    +    K  Y+G DLY G E + P+ + +L
Sbjct: 82   NGYLFMKDSSKKPLYPCLQMFAALIAENRGPKN---KLPYIGCDLYQGHERYKPLPSSEL 138

Query: 346  DSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDY 525
            DS   C  +IK WER+  +K     K  I+S RHH+V++ M LF              D 
Sbjct: 139  DSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALF-------------HDD 185

Query: 526  VLNVVYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXX 705
             ++++ T    G+L+F+ D S    +   G+ SKN + ++ICYSGFALED +        
Sbjct: 186  EVSIICTNIGKGKLIFSGDRSKEERN---GLNSKNSMTRKICYSGFALEDKLTTSHDERM 242

Query: 706  XXXXXXXXXXXAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHR 885
                         +++VE K+++ + +LLRCE+DA+N    ++TELKCF+ L + + +HR
Sbjct: 243  GPF----------YSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHR 292

Query: 886  RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFN 1065
            RKLLK WVQ G++PDSD++IG RD+  G+LED+ WYSR  L  K NN ++  +    NFN
Sbjct: 293  RKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFN 352

Query: 1066 AQVATQWSQHCIRSICKLVDENLDQKAISNP-------QGFQIRIDSRRNIRIKCLSKVP 1224
            A +A +W  HCI SIC LV +N    ++S+P       + F++ +D   NI +K L+KVP
Sbjct: 353  ANIAVEWCFHCIESICDLVMKN----SLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVP 408

Query: 1225 KDI 1233
            + +
Sbjct: 409  RHV 411

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
            similar to uniprot|Q06349 Saccharomyces cerevisiae
            YDR370C Hypothetical ORF
          Length = 373

 Score =  250 bits (638), Expect = 5e-79
 Identities = 144/396 (36%), Positives = 227/396 (57%), Gaps = 1/396 (0%)
 Frame = +1

Query: 49   SQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKND 228
            S+ +A +  VPF +F HSS   FP+  +  +    + + Y+  +L+ +    I   LK+ 
Sbjct: 7    SRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSI--GLKSP 64

Query: 229  IAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKY 408
              +L   S   + + KR +LGSDLY G+E F+P+S + LDS   C  +I  WE    T Y
Sbjct: 65   GNKL---SHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSY 121

Query: 409  KPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWS 588
                 F ++S RH++VE+TM+LF               Y +   + GD  G+++ ++  +
Sbjct: 122  SQRSPFVVISPRHYLVELTMQLFQQ-----------SKYSILCTHLGD--GKIVLSQVEN 168

Query: 589  NTGNSMNEGIYSKNIIL-KRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENK 765
            +  +  +    S+N  + K+I +SG+ALEDL+                     FA++E +
Sbjct: 169  DKKSHQHT---SRNTTMTKKILHSGYALEDLLTRGPRVEDDPF----------FAIIEAE 215

Query: 766  LDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILI 945
            LD +I ++LRCELD++N   + FTELKC++PL M N  HR KLLK W+Q  + P  D+LI
Sbjct: 216  LDANISLVLRCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLI 275

Query: 946  GIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVD 1125
            G+R++  G L+D+++++   L  KIN+RNLP+S   +N+NA +A QW QHCIRSICKLV 
Sbjct: 276  GVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVG 335

Query: 1126 ENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 1233
            EN+D+   S+PQ F++ ID    I+++ L  VP  +
Sbjct: 336  ENVDR---SSPQCFKLTIDESHKIQLEKLKHVPAHV 368

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
            (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  244 bits (622), Expect = 4e-76
 Identities = 145/395 (36%), Positives = 220/395 (55%), Gaps = 2/395 (0%)
 Frame = +1

Query: 55   KQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIA 234
            K+  I  +PF  F HS+   FP  T+  +  S  VA +   +L+   +   +P LK DIA
Sbjct: 34   KKNVINIIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIA 93

Query: 235  QLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERK-ASTKYK 411
             +  KS   ++  K  YLGSDLY   + + P+    LDS +PC  FI+ WE +     Y 
Sbjct: 94   NISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYG 153

Query: 412  PGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKD-WS 588
                + I+S RHHI E+ M LF             ++  + ++ T  + G +L +KD  S
Sbjct: 154  AHADYTILSPRHHITEIVMSLFEDE----------KNCSVYLLCTYLKNGIILLSKDDAS 203

Query: 589  NTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKL 768
            ++ NS   G+ S N + ++ICYSGFA EDL+                    +F+VVE+KL
Sbjct: 204  SSSNSNTTGLNSSNPMTRKICYSGFAFEDLVLEDIAENARP----------IFSVVESKL 253

Query: 769  DDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIG 948
             + I +LLR ELD +N     FTELKCF+PLK   FS  +++LK WVQTG++P+SDI+IG
Sbjct: 254  TESINLLLRNELDGYNNVTNMFTELKCFAPLKCM-FS-AKEVLKTWVQTGLIPESDIVIG 311

Query: 949  IRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDE 1128
            IRD+  G LED+ WY+R  L    NN +LP +   +NFNA +A +W +  + SI  LV  
Sbjct: 312  IRDTQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSS 371

Query: 1129 NLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 1233
            ++     ++P  F+++ID+ + I I+ LS++P+ +
Sbjct: 372  SIADS--NHPCSFKLKIDNHKTISIQKLSRIPQTV 404

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
            similar to uniprot|Q06349 Saccharomyces cerevisiae
            YDR370c
          Length = 402

 Score =  226 bits (576), Expect = 2e-69
 Identities = 120/357 (33%), Positives = 204/357 (57%)
 Frame = +1

Query: 136  FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFE 315
            FY+S+  + ++H+HKLY  ++ D+ P LK+ IA + K + +E   L R +LG  LY+  +
Sbjct: 62   FYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHD 121

Query: 316  TFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXX 495
             + PM+AK+LD+ E C +++  +E     KY   R F IV+ RHH++++ +  F      
Sbjct: 122  KYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSR---- 177

Query: 496  XXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALED 675
                   Q   +N++        L  ++D ++  N    G+ + N ILK+IC+SGFALED
Sbjct: 178  -------QFTNVNLLCAYTPGNLLEISQDPADNTND-KVGVNTDNPILKKICFSGFALED 229

Query: 676  LMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFS 855
            ++                     F +VEN++ +   +L+RCE+DA+N     +TELKC++
Sbjct: 230  ILTESANDEERNP---------TFLIVENEIANTR-LLMRCEIDAYNPITSHYTELKCYA 279

Query: 856  PLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNL 1035
                 N +HRRKLLK+W+QTGV+P +DI+IG+RD+  G L+DV  Y+R+ L +K+ +++L
Sbjct: 280  KYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSL 339

Query: 1036 PESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIK 1206
            P    + N++  ++  W +  I ++   +   LD+     PQ F I++D+  NIRI+
Sbjct: 340  PRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
            weakly similar to uniprot|Q06349 Saccharomyces cerevisiae
            YDR370C Hypothetical ORF
          Length = 400

 Score =  218 bits (554), Expect = 4e-66
 Identities = 121/387 (31%), Positives = 213/387 (55%), Gaps = 5/387 (1%)
 Frame = +1

Query: 91   FSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSA 255
            F HS++S FP+    F++ S ++  +   ++  + +Y       +  LK+DI +     A
Sbjct: 30   FVHSNVSHFPSVPCKFFQESREIGTFT--RMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87

Query: 256  SEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIV 435
              A  +K  YLG DL +GFE ++P+S  +L++++  ++FI +WE K   KY    KF IV
Sbjct: 88   KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIV 147

Query: 436  STRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEG 615
            S RHH++++ M  F                  N++ T  + G L+ + D S     ++ G
Sbjct: 148  SNRHHLIDLIMCPFSLEEA-------------NLIVTHLD-GLLIISSDKSKP--KVDSG 191

Query: 616  IYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLR 795
            I SK+  ++++CY+GF LE+L+                     +++VENKL + + +LL+
Sbjct: 192  IRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHT-------CFYSIVENKLTEGVSLLLQ 244

Query: 796  CELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGEL 975
             E+D++N     + ELKC    ++ N +HRRKLL+ W+QTG++P +D+L+G RD  + +L
Sbjct: 245  AEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQL 304

Query: 976  EDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISN 1155
            + ++ Y+RD +  K + RNL E++  +NFN+ VA QWS H I  I +LVD+NL  + +  
Sbjct: 305  DALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPL-- 362

Query: 1156 PQGFQIRIDSRRNIRIKCLSKVPKDIL 1236
             Q F++ +     + +  L+  P  ++
Sbjct: 363  -QSFKLTLTRDLQLSLTKLANTPAGLI 388

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
            YDR370C
          Length = 405

 Score =  214 bits (544), Expect = 1e-64
 Identities = 133/393 (33%), Positives = 204/393 (51%), Gaps = 8/393 (2%)
 Frame = +1

Query: 73   RVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLY----PASQYDIIPHLKNDIAQL 240
            RV F EF H     + +     ++ S +VA Y   KLY      +   I+P LK DIA L
Sbjct: 27   RVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAAL 86

Query: 241  PK-KSASEARTLKRSYLGSDLYDGFETFV-PMSAKDLDSLEPCMSFIKDWERKASTKYKP 414
             + K+  ++ + K  YLG  LY GFE +V  MS   LDS +PC+ +I +W R +  + K 
Sbjct: 87   AQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKF 146

Query: 415  GRKFN--IVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWS 588
            G  +   IV  RHH+VE+TM LF              DY L  V T      ++ ++   
Sbjct: 147  GESYRHIIVGPRHHLVELTMALFAND----------SDYKL--VCTVLRGKFIVLSQFDD 194

Query: 589  NTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKL 768
             +  + NEGI   +   + +CYSGF +  +                    + F      +
Sbjct: 195  GSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIP-----------SQFFYYGTPI 243

Query: 769  DDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIG 948
                     CE+DA+N  E  +TELKC+ PL M +  H+ KLL+ WVQT V PD+D++IG
Sbjct: 244  RRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIG 303

Query: 949  IRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDE 1128
             R++  G L+D+   SR+ L  K NN++ P +  ++N+NAQVA +WSQ+ +++I +L++ 
Sbjct: 304  CRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEG 363

Query: 1129 NLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPK 1227
            NL+QK++  PQ F + +    +I I+ L  VPK
Sbjct: 364  NLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPK 396

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
            Anc_5.437 YDR370C
          Length = 441

 Score =  193 bits (491), Expect = 2e-56
 Identities = 119/396 (30%), Positives = 201/396 (50%), Gaps = 7/396 (1%)
 Frame = +1

Query: 67   ITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPAS--QYDII-----PHLKN 225
            I R+PF  FS+S+  +  +    F E+   VALY++ ++   +  + ++I     P L  
Sbjct: 60   IARIPFKHFSYSNAHIGKSQPNIFQEAKG-VALYYDKRITKITNNEAELINESNPPFLTK 118

Query: 226  DIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK 405
            DI+ L + S  +++  K  Y+G +LYD  E F PM +  LDS  PC  +++  +     K
Sbjct: 119  DISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDK 178

Query: 406  YKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDW 585
                  +  ++ RHH+ E+ M ++            +        +T  +   ++ ++D 
Sbjct: 179  LY-NTPYTFMTPRHHLTELMMTVYESRESELTGKSWL--------FTRIKDDLIVISEDL 229

Query: 586  SNTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENK 765
            +   N   +    +N   K++  SGF  E+L+                     F + EN+
Sbjct: 230  AKENNPSPQNHKLQNSFSKKVINSGFTFEELVIENFQECHKPY----------FYISENR 279

Query: 766  LDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILI 945
            L      ++R E+D++N   + FTELKCF+ L +    HR+KLLK W QTG+ P+ DI+I
Sbjct: 280  LTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVI 339

Query: 946  GIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVD 1125
            GIRD+S G LED+ WYSR+ +  K+ + +LP+ K  ++F   +  QW  HCI +I     
Sbjct: 340  GIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFT 399

Query: 1126 ENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 1233
            ++    A SNP  +++ ID  ++I IK LS VPK++
Sbjct: 400  KDTSDTA-SNPMTYKVIIDKHKSIIIKKLSIVPKNV 434

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
            similar to uniprot|Q06349 Saccharomyces cerevisiae
            YDR370C Hypothetical ORF
          Length = 390

 Score =  188 bits (477), Expect = 6e-55
 Identities = 111/377 (29%), Positives = 189/377 (50%), Gaps = 5/377 (1%)
 Frame = +1

Query: 91   FSHSSISLFPTCTQPFYESSNQVAL---YHNHKLYPASQYDIIPHLKNDIA--QLPKKSA 255
            F  +SIS FP     F++   ++     + +   +   +    PHLK D+    + KK A
Sbjct: 24   FERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLFTITKKLA 83

Query: 256  SEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIV 435
                    SY+G DL + ++ F P++   L+ +     F+  WE      Y  G  F IV
Sbjct: 84   KT-----NSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIV 138

Query: 436  STRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEG 615
             +RH+++++ M  F             +D   NV Y     G L    D        ++G
Sbjct: 139  CSRHNLIDLIMAPFSD-----------EDVHFNVKYIN---GYLHIFPD--KQFQKKDDG 182

Query: 616  IYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLR 795
            IYS    ++RICY+GF LEDL+                   A +++V+ K+  +I +L +
Sbjct: 183  IYSSESNIRRICYTGFELEDLVTETQPGAPKS---------AFYSLVQGKISKNIKLLFK 233

Query: 796  CELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGEL 975
             E+D FN A++ +TE+KC + LK+ +  HRRKLL+ WVQT ++P +D+LIG+RD  + +L
Sbjct: 234  AEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQL 293

Query: 976  EDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISN 1155
               E Y+R  L  K NNRNL   K  +N+NA ++ QW +H ++ +C+ +   + +K  + 
Sbjct: 294  SSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYV-EKTPTE 352

Query: 1156 PQGFQIRIDSRRNIRIK 1206
               F++ +  +  +R++
Sbjct: 353  AVSFKLTLTKQLELRLR 369

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
            Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  187 bits (474), Expect = 2e-54
 Identities = 111/384 (28%), Positives = 204/384 (53%), Gaps = 5/384 (1%)
 Frame = +1

Query: 91   FSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSA 255
            F H+ I+ FP    PF++   +VA   +  L    ++ +     +P L  D+ +  +   
Sbjct: 24   FQHAQINQFPKNVLPFFDEVQEVATITH--LLDTDEFLLDDKLGMPELVQDLCEFTE--- 78

Query: 256  SEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIV 435
            S     K  Y+G DL D F+ +VP++ K L+ +    +F++ W++     +     F IV
Sbjct: 79   SGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIV 138

Query: 436  STRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEG 615
             +RH+++++ M  F             +D  L + ++    G L  + D        ++G
Sbjct: 139  CSRHNLIDLIMMPFSD-----------EDVHLKIQFSN---GYLNLSPDAQY--QKTDQG 182

Query: 616  IYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLR 795
            I+S +  +K+ICY+GF LE+L+                   + +++VE KL D I +LL+
Sbjct: 183  IHSGDTKIKKICYTGFELENLITATSKPDVRS---------SFYSLVEGKLGDGIKLLLK 233

Query: 796  CELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGEL 975
             E+D FN + + +TE+KC S LK+ +  HRRKLL+ WVQT ++P +++L+GIRD  + +L
Sbjct: 234  AEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQL 293

Query: 976  EDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISN 1155
               E Y+R +L  K NN+ L   + ++N+NA ++ QW +H I+ +C+++   +++    +
Sbjct: 294  TSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEK---GS 350

Query: 1156 PQGFQIRIDSRRNIRIKCLSKVPK 1227
             +    R+  R+N+ IK L K+P+
Sbjct: 351  KEEVNFRLTLRKNLTIK-LRKMPE 373

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
            YDR370C
          Length = 453

 Score =  177 bits (448), Expect = 4e-50
 Identities = 118/382 (30%), Positives = 192/382 (50%), Gaps = 17/382 (4%)
 Frame = +1

Query: 139  YESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSASEARTLKRSYLGSDLY 303
            Y +S +VA YH   L   +   I     +P LK+DI Q+  KS  +++  K  Y+G+DL+
Sbjct: 60   YRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADLF 119

Query: 304  DGFETFVPMSAKDLDSLEPCMSFIKDWERKAST---KYKPGRKFNIVSTRHHIVEMTMKL 474
              +E +  M  + L     C  +I+ +++K +    KY   ++F I+++RHHI ++ +  
Sbjct: 120  KDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAP 179

Query: 475  FXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICY 654
            F            + D  ++V+ T     R+L ++D+++      E     N  +++I  
Sbjct: 180  FKK----------ISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNS-MRKIVN 228

Query: 655  SGFALEDLMXXXXXXXXXXXXXXXXXXXA------VFAVVENKLDDDICILLRCELDAFN 816
            SGFA EDL+                           F+VVEN +   + ILLR E+D +N
Sbjct: 229  SGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYN 288

Query: 817  GAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYS 996
                 +TELKCF+ L M +  HR+KLLK WVQ G LP+SD+L+G RD+  G L D+ W+S
Sbjct: 289  PLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFS 348

Query: 997  RDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQ--KAISN-PQGF 1167
            RD L +K ++   P  +   N     A+ W  H + +I  L  + L +  KA S+ P  F
Sbjct: 349  RDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPF 408

Query: 1168 QIRIDSRRNIRIKCLSKVPKDI 1233
            ++ ++  R I +  L KVP  +
Sbjct: 409  RLIVEKNRTITLLPLKKVPASV 430

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  164 bits (416), Expect = 4e-46
 Identities = 112/363 (30%), Positives = 174/363 (47%), Gaps = 6/363 (1%)
 Frame = +1

Query: 136  FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFE 315
            F ES      +    +Y       +P L ++I +     +  +++    Y+GSDL    E
Sbjct: 47   FSESREVGTAFRQGLVYDLDDKKNLPLLNDEICEY---ISHRSKSKLIGYVGSDLSVESE 103

Query: 316  TFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXX 495
            TF P+++++L  L   + FI  WE      Y    KF IVS RHHI+++ M  F      
Sbjct: 104  TFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPF------ 157

Query: 496  XXXXXXVQDYVLNVVYTGDETGRLLFTKDW-----SNTGNSMNEGIYSKNIILKRICYSG 660
                             G+E  RL+FT        +   +    GI S +   ++ICY+G
Sbjct: 158  -----------------GNERCRLVFTAHRGLFVITLAPSQRPTGINSPSSATRKICYTG 200

Query: 661  FALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLRCELDAFNGAEKKFTE 840
            F LE L+                   + ++ +E KL+ DI ILL+CE+DA+N   +K+TE
Sbjct: 201  FELERLLTATSGTERG----------SFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTE 250

Query: 841  LKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKI 1020
            +K      + N  H  KLLK W QT +LP +DIL+G RD S   L+ V  YS D++  K+
Sbjct: 251  IKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKL 310

Query: 1021 NNRNLPESKIDW-NFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNI 1197
              R+   S   + NFN +VA  W+ + IR IC+ +   +D  + S+PQ F + ID    +
Sbjct: 311  YIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATS-SSPQSFLVEIDKNLQM 369

Query: 1198 RIK 1206
            +I+
Sbjct: 370  KIR 372

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
            weakly similar to uniprot|Q06349 Saccharomyces cerevisiae
            YDR370C Hypothetical ORF
          Length = 403

 Score =  141 bits (356), Expect = 3e-37
 Identities = 102/341 (29%), Positives = 172/341 (50%), Gaps = 5/341 (1%)
 Frame = +1

Query: 211  PHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWER 390
            P L+ ++    K S  E + +K S++G DL  G++ +VP+    L+SL       + +E+
Sbjct: 90   PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149

Query: 391  KASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLL 570
              + +     K   VS RHHI+++ M  F              D  L+++ T      +L
Sbjct: 150  TLNPE-----KTTFVSLRHHIIDIIMCPFL-------------DEPLSLLMTVQPDKNIL 191

Query: 571  FTKDWS-NTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVF 747
             + D S +  N ++E   ++N   K+ICY+GFALEDL+                     +
Sbjct: 192  ISVDKSKDKPNGIHE---TRNSFNKKICYTGFALEDLLIESPTEGHILEHELY------Y 242

Query: 748  AVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLP 927
            ++V   L+D+I +L++ E+D+ N     +TE+K     K+ N  HRRKLL+ W+QT +LP
Sbjct: 243  SIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLP 302

Query: 928  DSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNL-PESKIDWNFNAQVATQWSQHCIR 1104
             SD+LIG R+S   ELE ++ Y    +  KINN ++  +    + FN  VA  W QH   
Sbjct: 303  KSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQH--- 359

Query: 1105 SICKLVDEN---LDQKAISNPQGFQIRIDSRRNIRIKCLSK 1218
             I +++ +N   L Q++ S    F+++ID+   + I   S+
Sbjct: 360  -IFQVLKQNLLLLSQESTSTT--FKVQIDTNLTLSISPASQ 397

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
            similar to uniprot|P53063 Saccharomyces cerevisiae
            YGL246c RAI1
          Length = 400

 Score = 40.4 bits (93), Expect = 0.007
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = +1

Query: 826  KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 999
            K +TELKC S +  +N   R  +K+ +AW+Q  ++    ++ G RD  +  L+ VE +S 
Sbjct: 242  KHYTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRDDQY-MLKTVEEFST 300

Query: 1000 DRLR--SKINNRNLPESKID 1053
            + +    K NN  L +S +D
Sbjct: 301  EEIPVIIKANNPTLGQSCLD 320

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
            Anc_3.570
          Length = 380

 Score = 38.1 bits (87), Expect = 0.037
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +1

Query: 826  KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 999
            K + ELKC + +  +  +H+  RK+ + W+Q  ++    I+ G RD ++  L+ +E YS 
Sbjct: 233  KHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTIEEYST 291

Query: 1000 DRLRSKINNRN 1032
            D +   + N N
Sbjct: 292  DEIPILLKNNN 302

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15173)
            [1140 nt, 380 aa]
          Length = 379

 Score = 37.7 bits (86), Expect = 0.048
 Identities = 40/134 (29%), Positives = 61/134 (45%), Gaps = 18/134 (13%)
 Frame = +1

Query: 784  ILLRCELDA-FNGAEKKFTELKCFSPLKMSNF--------SHRRKLLKAWVQTGVLPDSD 936
            ++L  E+DA F+  E+    LK +  LK +N            +K+ K W+Q  ++    
Sbjct: 207  LMLGAEVDAIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPR 266

Query: 937  ILIGIRDSSFGELEDVEWYSRDR--LRSKINNRNLPESKIDWNFNAQVATQW-------S 1089
            I+ G RD++F  L+ VE +S D   L  K N+  L  S +D      V T+W        
Sbjct: 267  IIYGFRDNNF-ILKSVEEFSTDEVPLLLKSNSPQLGNSCVDAIKWYGVFTEWLLNQIPRD 325

Query: 1090 QHCIRSICKLVDEN 1131
               I+   KLV EN
Sbjct: 326  DPSIKKAYKLVYEN 339

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa] {ON}
            similar to uniprot|P53063 Saccharomyces cerevisiae
            YGL246C RAI1 Nuclear protein that binds to and stabilizes
            the exoribonuclease Rat1p required for pre-rRNA
            processing
          Length = 384

 Score = 37.4 bits (85), Expect = 0.064
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +1

Query: 826  KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 999
            K + ELKC + +   + +H+  RKL K W+Q  ++  + I+ G RD +F  L+ VE ++ 
Sbjct: 233  KHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDNF-MLKTVEEFTT 291

Query: 1000 DRLRSKINNRN 1032
              +   + N N
Sbjct: 292  SEVPLILKNNN 302

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 35.8 bits (81), Expect = 0.20
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +1

Query: 826  KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 999
            + + ELKC + +  +  +HR  RKL K W+Q  ++    I+ G RD ++  L+ VE +S 
Sbjct: 225  RHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRDENY-TLKSVEEFST 283

Query: 1000 DRLRSKINNRN 1032
            + +   +   N
Sbjct: 284  EEVPILLKEHN 294

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
            (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 35.8 bits (81), Expect = 0.20
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 9/92 (9%)
 Frame = +1

Query: 784  ILLRCELDA-FNGAEKKFTELKCFSPLK----MSNF----SHRRKLLKAWVQTGVLPDSD 936
            ++L  E+D  F+ AE     LK ++ LK    +S F    S  RKL K W+Q  ++  + 
Sbjct: 210  LVLGAEVDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINR 269

Query: 937  ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 1032
            I+ G RD  F  L  VE Y    +   + N N
Sbjct: 270  IIYGFRDEHF-ILRSVEEYGSHEIPLLLKNNN 300

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
            YGL246C (REAL)
          Length = 387

 Score = 35.8 bits (81), Expect = 0.20
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 9/92 (9%)
 Frame = +1

Query: 784  ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 936
            ++L  E+D       NG +  K + ELKC   +  ++ +H+  RKL + W+Q  ++    
Sbjct: 216  LILGAEVDCIFDFKENGRDNLKHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPR 275

Query: 937  ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 1032
            I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276  IIYGFKDDHY-VLKTVEEFSTEEVPVLLKNNN 306

>TDEL0D05730 Chr4 (1030911..1032290) [1380 bp, 459 aa] {ON}
           Anc_3.505 YGR141W
          Length = 459

 Score = 35.4 bits (80), Expect = 0.28
 Identities = 38/131 (29%), Positives = 58/131 (44%), Gaps = 7/131 (5%)
 Frame = +1

Query: 46  QSQKQAPITRVPFGEFSHSSISLFPTCTQPFY--ESSNQVALYHNHKLYPASQYDIIPHL 219
           +SQK  P+  +P  + +  + SLF     P Y  +    V LY   + +PA   D + H 
Sbjct: 50  RSQKLPPV--LPPNKLNDKNRSLFKKGEIPDYVIDDCPLVHLYSEERYWPADIADFVTHF 107

Query: 220 K---NDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKD--W 384
           K   +  + + KK   E + LK  Y    L +G  + +P SA  + SL+    F KD  W
Sbjct: 108 KVTDSYGSSIVKKETLELKDLKSEY-SYKLSNGSMSTIPSSATFMTSLD---DFSKDPKW 163

Query: 385 ERKASTKYKPG 417
               S +Y  G
Sbjct: 164 LLGYSPEYGTG 174

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
            highly similar to uniprot|P53063 Saccharomyces cerevisiae
            YGL246C RAI1 Nuclear protein that binds to and stabilizes
            the exoribonuclease Rat1p required for pre-rRNA
            processing
          Length = 383

 Score = 34.7 bits (78), Expect = 0.46
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +1

Query: 826  KKFTELKCFSPLKMSNFSH----RRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWY 993
            K + ELKC   +  S F+      RK+ K W+Q  ++  + ++ G RD +F  L  VE Y
Sbjct: 231  KHYAELKCTKGV--STFAEARAFERKMFKTWLQCFLVGINRVIYGFRDENF-ILRSVEEY 287

Query: 994  SRDRLRSKINNRN 1032
            S   +   + N N
Sbjct: 288  STQEVPLLLKNNN 300

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
            RAI1Nuclear protein with decapping endonuclease activity
            targeted toward mRNAs with unmethylated 7-methylguanosine
            cap structures; binds to and stabilizes the
            exoribonuclease Rat1p; required for pre-rRNA processing;
            homologous to human DOM3Z
          Length = 387

 Score = 34.7 bits (78), Expect = 0.46
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 9/92 (9%)
 Frame = +1

Query: 784  ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 936
            ++L  E+D       NG +  K + ELKC   +   + +H+  RKL + W+Q  ++    
Sbjct: 216  LILGAEVDCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPR 275

Query: 937  ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 1032
            I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276  IIYGFKDDHY-VLKTVEEFSTEEVPVLLKNNN 306

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
            YGL246C (REAL)
          Length = 389

 Score = 34.7 bits (78), Expect = 0.46
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 9/92 (9%)
 Frame = +1

Query: 784  ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 936
            ++L  E+D       NG +  K + ELKC   +   + +H+  RKL + W+Q  ++    
Sbjct: 216  LILGAEVDCVFDFKENGKDNLKHYAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPR 275

Query: 937  ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 1032
            I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276  IIYGFKDDQY-VLKTVEEFSTEEVPVLLKNNN 306

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
            highly similar to uniprot|P53063 Saccharomyces cerevisiae
            YGL246C RAI1 Nuclear protein that binds to and stabilizes
            the exoribonuclease Rat1p required for pre-rRNA
            processing
          Length = 383

 Score = 34.3 bits (77), Expect = 0.60
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +1

Query: 826  KKFTELKCFSPLKM--SNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 999
            K +TELKC   +       +  RK+ K W+Q  ++  + ++ G RD +F  L+ VE +S 
Sbjct: 231  KHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYGFRDDNF-ILKSVEEFST 289

Query: 1000 DRLRSKINNRN 1032
              +   + N N
Sbjct: 290  QEIPIILKNNN 300

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
            YGL246C (REAL)
          Length = 389

 Score = 34.3 bits (77), Expect = 0.61
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 9/92 (9%)
 Frame = +1

Query: 784  ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 936
            ++L  E+D       NG +  K + ELKC   +   + +H+  RKL + W+Q  ++    
Sbjct: 216  LILGAEVDCVFDFKENGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPR 275

Query: 937  ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 1032
            I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276  IIYGFKDDHY-VLKTVEEFSTEEVPVLLKNNN 306

>Suva_2.630 Chr2 (1119245..1121140) [1896 bp, 631 aa] {ON} YDR456W
            (REAL)
          Length = 631

 Score = 33.5 bits (75), Expect = 1.2
 Identities = 23/56 (41%), Positives = 31/56 (55%)
 Frame = +1

Query: 955  DSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLV 1122
            DS+FG L+D E  S D  RS I+ RNL   K+   FN+   +QW Q+    + K V
Sbjct: 555  DSTFGGLDDTENASPDFGRSSIDKRNL-RDKLGTIFNSD--SQWFQNFDEQVLKPV 607

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
            (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 32.3 bits (72), Expect = 2.7
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 877  SHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLP 1038
            SHR  +++   QTG+  DS    GI D +   LED+++ +   +R  I  + LP
Sbjct: 181  SHRNNIIEPGFQTGINYDS----GIMDKNHLSLEDIKFQNVGEVRPNIMKQKLP 230

>CAGL0I01628g Chr9 complement(132246..134570) [2325 bp, 774 aa] {ON}
           similar to uniprot|P37020 Saccharomyces cerevisiae
           YJR040w GEF1 voltage-gated chloride channel protein
          Length = 774

 Score = 32.0 bits (71), Expect = 3.8
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 6/67 (8%)
 Frame = -3

Query: 292 NPNMIFSKFLPLRPISWAIEQCHSSSAE*------YRIVRPDKVYGCDIMPLGYLIHRMV 131
           N N I SK L + P    + + H +  E       Y IVR   ++  D + +GY++ R +
Sbjct: 589 NANQIMSKDLAVLPEKLTVSELHHTVFENDKLYSGYPIVRSADLHENDKVCIGYILRRHI 648

Query: 130 VCKLEIM 110
           + KLE++
Sbjct: 649 LKKLEVI 655

>Kwal_23.5257 s23 complement(1079507..1079758) [252 bp, 83 aa] {OFF}
           [contig 8] FULL
          Length = 83

 Score = 29.3 bits (64), Expect = 5.0
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +2

Query: 140 MNQVTKWHYITTINFIRPHNTIL 208
           + Q T W Y++T NF +PH+ +L
Sbjct: 45  LTQTTLWKYVSTKNFRKPHHFLL 67

>NCAS0C00590 Chr3 (95193..95654) [462 bp, 153 aa] {ON} Anc_8.812
            YMR260C
          Length = 153

 Score = 30.4 bits (67), Expect = 5.2
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = +1

Query: 838  ELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSK 1017
            E  CF  +K       +   K W+  G +    IL+ +RD    + + V  Y+ D  R+ 
Sbjct: 48   EASCFDGIKRMAHIRGKLRKKVWMGQGDI----ILVSLRDFQDDQCDVVHKYNLDEARTL 103

Query: 1018 INNRNLPES 1044
             N   LPE+
Sbjct: 104  KNQGELPEN 112

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGL246C
            (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 31.2 bits (69), Expect = 6.6
 Identities = 26/98 (26%), Positives = 43/98 (43%)
 Frame = +1

Query: 826  KKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDR 1005
            K + ELK     K  NFS   KL  +W+Q  ++  + ++IG RD  F  L+ VE +S   
Sbjct: 639  KHYVELKVCQ--KNRNFSE--KLFSSWLQCFLVGINRVIIGFRDEKF-VLKSVEEFSTSE 693

Query: 1006 LRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKL 1119
            +   +         +D       A +W     + +C+L
Sbjct: 694  IPHLLKGTEYSNVCVD-------AIEWYGALTKWLCEL 724

>KAFR0B03770 Chr2 (781218..781679) [462 bp, 153 aa] {ON} Anc_8.812
            YMR260C
          Length = 153

 Score = 30.0 bits (66), Expect = 7.0
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = +1

Query: 838  ELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSK 1017
            E  CF  +K       +   K W+  G +    IL+ +RD    + + V  Y+ D  R+ 
Sbjct: 48   EATCFDGIKRMAHIRGKLRKKVWMGQGDI----ILVSLRDFQDDQCDVVHKYNLDEARTL 103

Query: 1018 INNRNLPES 1044
             N   LPE+
Sbjct: 104  KNQGELPEN 112

>AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGL246C
            (RAI1); Tandem gene duplication in this genome
          Length = 376

 Score = 30.8 bits (68), Expect = 7.4
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 4/102 (3%)
 Frame = +1

Query: 826  KKFTELKCFSPLKM----SNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWY 993
            K + ELK    ++     +NF   +KL   W+Q  ++  + ++IG RD  F  L+ VE +
Sbjct: 231  KHYVELKVAKKVQTLKDATNFE--QKLFSVWLQCFLVGINRVIIGFRDEKF-VLKSVEEF 287

Query: 994  SRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKL 1119
            S   +   + +  L  + +D       A +W     + +C+L
Sbjct: 288  STSEIPLLLKSTGLRNACVD-------AIKWYGALTKWLCEL 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 115,347,497
Number of extensions: 2528760
Number of successful extensions: 7875
Number of sequences better than 10.0: 40
Number of HSP's gapped: 7816
Number of HSP's successfully gapped: 42
Length of query: 416
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 304
Effective length of database: 40,638,807
Effective search space: 12354197328
Effective search space used: 12354197328
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)