Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F034005.437ON41541520560.0
NDAI0B056905.437ON42339710911e-146
KAFR0E038205.437ON3963959161e-120
Suva_2.5425.437ON4423918301e-107
Smik_4.6365.437ON4463908231e-106
Skud_4.6395.437ON4423887971e-102
YDR370C5.437ON4423907775e-99
TDEL0B021805.437ON4184196712e-83
ZYRO0F10098g5.437ON3733986482e-80
CAGL0A02860g5.437ON4023585901e-71
Kpol_1016.45.437ON4133965851e-70
SAKL0G02596g5.437ON4003875641e-67
KNAG0C048905.437ON4053935562e-66
TPHA0J026005.437ON4413974939e-57
Kwal_55.214155.437ON3893844811e-55
KLTH0F15994g5.437ON3903754776e-55
TBLA0A028005.437ON4533834553e-51
AER404C5.437ON3863154271e-47
KLLA0E02245g5.437ON4033413529e-37
CAGL0C01925g3.570ON40080870.035
NCAS0E002403.570ON38071830.11
TPHA0G036503.570ON377243820.12
KLLA0E12893g3.570ON38492800.23
Kpol_380.83.570ON379134790.28
NDAI0I032603.570ON37763790.31
Kwal_47.192763.570ON38692770.52
KAFR0J001603.570ON380117770.52
Suva_2.6305.573ON63156760.75
KLTH0G00660g3.570ON38373731.5
Smik_7.153.570ON38792731.5
SAKL0F00726g3.570ON38371712.7
Suva_7.153.570ON38992713.0
YGL246C (RAI1)3.570ON38792713.3
Skud_7.213.570ON38992703.6
Kpol_1018.352.531ON51754704.4
TDEL0D057303.505ON459131687.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03400
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   796   0.0  
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   424   e-146
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   357   e-120
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   324   e-107
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   321   e-106
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   311   e-102
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   303   5e-99
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   263   2e-83
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   254   2e-80
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   231   1e-71
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   229   1e-70
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   221   1e-67
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   218   2e-66
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   194   9e-57
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   189   1e-55
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   188   6e-55
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   179   3e-51
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   169   1e-47
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   140   9e-37
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    38   0.035
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    37   0.11 
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    36   0.12 
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    35   0.23 
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    35   0.28 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     35   0.31 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    34   0.52 
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    34   0.52 
Suva_2.630 Chr2 (1119245..1121140) [1896 bp, 631 aa] {ON} YDR456...    34   0.75 
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    33   1.5  
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    33   1.5  
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    32   2.7  
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    32   3.0  
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    32   3.3  
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    32   3.6  
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    32   4.4  
TDEL0D05730 Chr4 (1030911..1032290) [1380 bp, 459 aa] {ON} Anc_3...    31   7.2  

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/415 (92%), Positives = 384/415 (92%)

Query: 1   MKKTGQELMPLHTTVQSQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHK 60
           MKKTGQELMPLHTTVQSQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHK
Sbjct: 1   MKKTGQELMPLHTTVQSQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHK 60

Query: 61  LYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEP 120
           LYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEP
Sbjct: 61  LYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEP 120

Query: 121 CMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVV 180
           CMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLF            VQDYVLNVV
Sbjct: 121 CMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVV 180

Query: 181 YTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXX 240
           YTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLM             
Sbjct: 181 YTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEK 240

Query: 241 XXXXXXAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLK 300
                 AVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLK
Sbjct: 241 LTGGEKAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLK 300

Query: 301 AWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVAT 360
           AWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVAT
Sbjct: 301 AWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVAT 360

Query: 361 QWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEYL 415
           QWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEYL
Sbjct: 361 QWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEYL 415

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  424 bits (1091), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/397 (52%), Positives = 274/397 (69%), Gaps = 15/397 (3%)

Query: 22  PITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQL- 80
           PIT +PF +F H SIS +P     F+E+S  VALYHN +LY +   ++IP L+  IA+L 
Sbjct: 35  PITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLA 94

Query: 81  -PKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPG 139
            P  S +EAR LK  YLGSDLYDG+E+F+PM   +LDS+EPC  +I+ WE +    Y+ G
Sbjct: 95  NPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLG 154

Query: 140 RKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTG 199
            KF IVS RHHIVEMTM +F            + D++LNV Y G   G LLF++D +   
Sbjct: 155 NKFTIVSARHHIVEMTMCIFNKRK--------MDDFILNVTYKGGSNGMLLFSRDVNKKD 206

Query: 200 NSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXX--XXAVFAVVENKLD 257
           +    GIYSK+ ++++I YSGFALEDL+                     AVFA++ENKL+
Sbjct: 207 DG---GIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLN 263

Query: 258 DDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGI 317
           DDI +LLRCE+D++N   K FTE+KCF+ LKM+N +HRRKLLKAWVQTGV+P+SDILIGI
Sbjct: 264 DDISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGI 323

Query: 318 RDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDEN 377
           RD  FGEL D+EW+SR  L  +INNRNLPE+K+D N+NA++A QWSQHCI+SICKLVDE+
Sbjct: 324 RDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDES 383

Query: 378 LDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEY 414
           +D+  ++  Q FQIRI++ R I+IK L  VP ++  Y
Sbjct: 384 IDKTRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  357 bits (916), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 181/395 (45%), Positives = 255/395 (64%), Gaps = 33/395 (8%)

Query: 19  KQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQ--YDIIPHLKND 76
           ++ PI   PF  F H SI+ FP     F++ S +VA YH+ ++Y  ++   DI+P L  D
Sbjct: 24  QKTPIVS-PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKD 82

Query: 77  IAQLPKK-SASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK 135
           I+++ +  SA +AR  K  Y+GSDLY GFE F  MS ++LDS  PC ++IK WE     K
Sbjct: 83  ISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK 142

Query: 136 YKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDW 195
           Y   +K+ IVS RHHIV + M +F             ++ ++N  Y G+  G L F++D 
Sbjct: 143 YTENKKYTIVSARHHIVNLIMSIFDTS----------KETIVNSTYLGN--GLLTFSQDT 190

Query: 196 SNTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENK 255
           S+   +MNEGI++KN  LK+ICYSGFALEDL+                    +F++ EN+
Sbjct: 191 SDPM-TMNEGIFTKNKNLKKICYSGFALEDLLTKSQKE-------------PLFSITENQ 236

Query: 256 LDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILI 315
           LDD+I +LLRCE+DA+N   + +TELKC++PLKM++  HR+KLLK W+QTGVLP SD++ 
Sbjct: 237 LDDNITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMF 296

Query: 316 GIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVD 375
           GIR    GEL D+EWYSRD L  + NNRNLPE+K   NFNA +A +WS HCI++IC+L+ 
Sbjct: 297 GIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELIS 356

Query: 376 ENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKD 410
           +NL   A   PQ FQI++D+ RNI I+ LSK+P++
Sbjct: 357 DNLQGDA---PQAFQIKVDTFRNISIRNLSKIPQN 388

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  324 bits (830), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 246/391 (62%), Gaps = 20/391 (5%)

Query: 24  TRVPFGEFSHSSISLFPTCTQP--FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLP 81
           TRVP+  F H+SI  FPT   P  FYES  +VAL+ +++LY A++ D+IP+LK DI+ L 
Sbjct: 64  TRVPYSSFLHTSIRNFPTKPPPDIFYESK-EVALFTDNQLYVAARKDVIPNLKEDISHLY 122

Query: 82  KKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGR 140
           +    EAR LK  YLG DL+   +  VPM+  +LD++ PC+S+I+DW    S K +K G+
Sbjct: 123 ESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGK 182

Query: 141 KFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGN 200
           KF +V+TRHHIV++TM  F             Q  ++   Y G+  G +  +++      
Sbjct: 183 KFTVVTTRHHIVDLTMHPFDRRNK--------QKSII-ATYMGN--GFISLSRNPKYDHK 231

Query: 201 SMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDI 260
           +  EGIYS +  +K+IC+SGF  E+ +                    VF++VE KL +DI
Sbjct: 232 ASKEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKC-----PVFSIVEGKLSEDI 286

Query: 261 CILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDS 320
            +L+RCE+DAFN   K  TELKCF PL M N SHR+KLLK W+QTG+LP+SDI++G+RDS
Sbjct: 287 GLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDS 346

Query: 321 SFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQ 380
             G+L D++WYSRD L  K N+  LP +K + N+NA+VA +W +HCI+SIC LV+ N+ +
Sbjct: 347 YSGQLLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISR 406

Query: 381 KAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411
              + P+ F+I ID+   I I  LS +P+++
Sbjct: 407 YNCNKPEPFEINIDANGTIIITKLSTIPRNV 437

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  321 bits (823), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 167/390 (42%), Positives = 235/390 (60%), Gaps = 18/390 (4%)

Query: 24  TRVPFGEFSHSSISLFPT-CTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPK 82
           TRV +  FSHS +  FP    +  +  S +VAL+ N + Y   + DI+P+LK DIA+L +
Sbjct: 64  TRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAELCE 123

Query: 83  KSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWE-RKASTKYKPGRK 141
           +S  +AR  K  YLG DL+     FVPM+  +LDS+ PC+S+I++W        +K GRK
Sbjct: 124 RSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRK 183

Query: 142 FNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNS 201
           F +V+TRHHIV+MTM LF             +   L   Y G   G + F+++  N    
Sbjct: 184 FTVVTTRHHIVDMTMHLFDRRN---------KKRSLVATYMG--AGLISFSRNQKNDSRM 232

Query: 202 MNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDIC 261
             EGIYS +  +K+ICYSGF  E+ +                    VF+VVE+KL ++I 
Sbjct: 233 SKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKL-----PVFSVVESKLSEEIG 287

Query: 262 ILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSS 321
           +L+RCE+DAFN      TELKCF+PL M N +HRRKLLK W+QTG+ P+SDI+IG+RDS 
Sbjct: 288 LLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSH 347

Query: 322 FGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQK 381
            G+L D++WYSRD L  K N+  LP +K + N+NA+VA +W  HCI+SIC+L+  N+   
Sbjct: 348 SGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDY 407

Query: 382 AISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411
           +  NP+ F+I IDS   I I  L  +PK +
Sbjct: 408 SCKNPESFEISIDSNNTIAITKLKNIPKHV 437

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  311 bits (797), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 163/388 (42%), Positives = 235/388 (60%), Gaps = 18/388 (4%)

Query: 26  VPFGEFSHSSI-SLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKS 84
           VP+  F H+SI  L        ++ S +VAL+ N++ Y  ++ D+IP L++ I +L + S
Sbjct: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESS 125

Query: 85  ASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGRKFN 143
             EAR  K  YLG DL+   + FVPM+  +LDS+ PC+S++++W+     K +K G+KF 
Sbjct: 126 LLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFT 185

Query: 144 IVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMN 203
           IVS RHHIV++TM  F                 L V Y G   G + F+++  N      
Sbjct: 186 IVSARHHIVDLTMHRFDRRNKRKS---------LIVTYMG--AGLISFSRNPKNDFQMSK 234

Query: 204 EGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICIL 263
           EGIYS +  +K+ICYSGF  E  +                    +F+VVE+KL +DI +L
Sbjct: 235 EGIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKH-----PIFSVVESKLSEDIGLL 289

Query: 264 LRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFG 323
           +RCE+DAFN   +  TELKCF PL M N +HR+KLLK W+QTG+LP+SDI+IG+RDS  G
Sbjct: 290 MRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSG 349

Query: 324 ELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAI 383
           +L D++WYSRD L  K N+  LP SK + NFNA+VA +W  HCI+SIC+LV+ N+     
Sbjct: 350 QLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNS 409

Query: 384 SNPQGFQIRIDSRRNIRIKCLSKVPKDI 411
           + P+ F++ ID+   I I  L+ VPK++
Sbjct: 410 TRPESFEVSIDANGTIAITKLNTVPKNV 437

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  303 bits (777), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 160/390 (41%), Positives = 234/390 (60%), Gaps = 22/390 (5%)

Query: 26  VPFGEFSHSSISLFPTCTQP---FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPK 82
           +P+  F H+ +  F   T+P    +  S +VAL+ N + Y   + D+IP+LK  IA+L +
Sbjct: 66  IPYTSFLHTGMHNF--LTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAELYE 123

Query: 83  KSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGRK 141
            S  EA+  K  YLG DL+   + FVPM+  +LDS+ PC S+I++W      K +K G+K
Sbjct: 124 SSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKK 183

Query: 142 FNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNS 201
           F +V+TRHHIV++TM LF             +   L V Y G   G L F ++       
Sbjct: 184 FTVVTTRHHIVDLTMHLFNRRN---------RQTSLIVTYMG--AGLLSFCRNVKKDSQM 232

Query: 202 MNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDIC 261
             EGIYS +  +K+ICYSGF  E+ +                    +F++VE+KL ++I 
Sbjct: 233 SKEGIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKC-----PIFSLVESKLSEEIG 287

Query: 262 ILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSS 321
           +L+RCE+DAFN   +  TELKCF+PL M N +HRRKLLK WVQTG+LP+SDI+IG+RDS 
Sbjct: 288 LLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSH 347

Query: 322 FGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQK 381
            G+L D++WYSRD L  K N+  LP +K + N+NAQ+A +W  +CI +ICKLV+ N+   
Sbjct: 348 SGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDY 407

Query: 382 AISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411
           + + P+ F+I ID+   I I  L   P+++
Sbjct: 408 SSTKPESFEIGIDTNNAIVITKLKTTPRNV 437

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  263 bits (671), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 150/419 (35%), Positives = 231/419 (55%), Gaps = 45/419 (10%)

Query: 5   GQELMPLHTTVQSQKQAPITR---VPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKL 61
           G +  P   + Q +KQ    R   +PF +F HS +  FP  T  F+E   +VA Y N  L
Sbjct: 26  GLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYL 85

Query: 62  Y--PASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLE 119
           +   +S+  + P L+   A + +    +    K  Y+G DLY G E + P+ + +LDS  
Sbjct: 86  FMKDSSKKPLYPCLQMFAALIAENRGPKN---KLPYIGCDLYQGHERYKPLPSSELDSSI 142

Query: 120 PCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNV 179
            C  +IK WER+  +K     K  I+S RHH+V++ M LF              D  +++
Sbjct: 143 ACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALF-------------HDDEVSI 189

Query: 180 VYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXX 239
           + T    G+L+F+ D S    +   G+ SKN + ++ICYSGFALED +            
Sbjct: 190 ICTNIGKGKLIFSGDRSKEERN---GLNSKNSMTRKICYSGFALEDKLTTSHDERMG--- 243

Query: 240 XXXXXXXAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLL 299
                    +++VE K+++ + +LLRCE+DA+N    ++TELKCF+ L + + +HRRKLL
Sbjct: 244 -------PFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLL 296

Query: 300 KAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVA 359
           K WVQ G++PDSD++IG RD+  G+LED+ WYSR  L  K NN ++  +    NFNA +A
Sbjct: 297 KTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIA 356

Query: 360 TQWSQHCIRSICKLVDENLDQKAISNP-------QGFQIRIDSRRNIRIKCLSKVPKDI 411
            +W  HCI SIC LV +N    ++S+P       + F++ +D   NI +K L+KVP+ +
Sbjct: 357 VEWCFHCIESICDLVMKN----SLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHV 411

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  254 bits (648), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 145/398 (36%), Positives = 226/398 (56%), Gaps = 39/398 (9%)

Query: 17  SQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKND 76
           S+ +A +  VPF +F HSS   FP+  +  +    + + Y+  +L+ +    I   LK+ 
Sbjct: 7   SRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSI--GLKS- 63

Query: 77  IAQLPKKSASEARTL--KRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKAST 134
               P    S  R+   KR +LGSDLY G+E F+P+S + LDS   C  +I  WE    T
Sbjct: 64  ----PGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHT 119

Query: 135 KYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKD 194
            Y     F ++S RH++VE+TM+LF               Y +   + GD  G+++ ++ 
Sbjct: 120 SYSQRSPFVVISPRHYLVELTMQLFQQSK-----------YSILCTHLGD--GKIVLSQV 166

Query: 195 WSNTGNSMNEGIYSKNIIL-KRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVE 253
            ++  +  +    S+N  + K+I +SG+ALEDL+                     FA++E
Sbjct: 167 ENDKKSHQHT---SRNTTMTKKILHSGYALEDLLTRGPRVEDD----------PFFAIIE 213

Query: 254 NKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDI 313
            +LD +I ++LRCELD++N   + FTELKC++PL M N  HR KLLK W+Q  + P  D+
Sbjct: 214 AELDANISLVLRCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDL 273

Query: 314 LIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKL 373
           LIG+R++  G L+D+++++   L  KIN+RNLP+S   +N+NA +A QW QHCIRSICKL
Sbjct: 274 LIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKL 333

Query: 374 VDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411
           V EN+D+   S+PQ F++ ID    I+++ L  VP  +
Sbjct: 334 VGENVDR---SSPQCFKLTIDESHKIQLEKLKHVPAHV 368

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  231 bits (590), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 205/358 (57%), Gaps = 24/358 (6%)

Query: 46  FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFE 105
           FY+S+  + ++H+HKLY  ++ D+ P LK+ IA + K + +E   L R +LG  LY+  +
Sbjct: 62  FYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHD 121

Query: 106 TFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXX 165
            + PM+AK+LD+ E C +++  +E     KY   R F IV+ RHH++++ +  F      
Sbjct: 122 KYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQ--- 178

Query: 166 XXXXXXVQDYVLNVVYTGDETGRLL-FTKDWSNTGNSMNEGIYSKNIILKRICYSGFALE 224
                   +  L   YT    G LL  ++D ++  N    G+ + N ILK+IC+SGFALE
Sbjct: 179 ------FTNVNLLCAYT---PGNLLEISQDPADNTND-KVGVNTDNPILKKICFSGFALE 228

Query: 225 DLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCF 284
           D++                     F +VEN++ +   +L+RCE+DA+N     +TELKC+
Sbjct: 229 DILTESANDEERN---------PTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTELKCY 278

Query: 285 SPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344
           +     N +HRRKLLK+W+QTGV+P +DI+IG+RD+  G L+DV  Y+R+ L +K+ +++
Sbjct: 279 AKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKS 338

Query: 345 LPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIK 402
           LP    + N++  ++  W +  I ++   +   LD+     PQ F I++D+  NIRI+
Sbjct: 339 LPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  229 bits (585), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 148/396 (37%), Positives = 220/396 (55%), Gaps = 28/396 (7%)

Query: 19  KQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIA 78
           K+  I  +PF  F HS+   FP  T+  +  S  VA +   +L+   +   +P LK DIA
Sbjct: 34  KKNVINIIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIA 93

Query: 79  QLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YK 137
            +  KS   ++  K  YLGSDLY   + + P+    LDS +PC  FI+ WE +   + Y 
Sbjct: 94  NISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYG 153

Query: 138 PGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKD-WS 196
               + I+S RHHI E+ M LF             ++  + ++ T  + G +L +KD  S
Sbjct: 154 AHADYTILSPRHHITEIVMSLFEDE----------KNCSVYLLCTYLKNGIILLSKDDAS 203

Query: 197 NTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKL 256
           ++ NS   G+ S N + ++ICYSGFA EDL+                    +F+VVE+KL
Sbjct: 204 SSSNSNTTGLNSSNPMTRKICYSGFAFEDLVLEDIAENAR----------PIFSVVESKL 253

Query: 257 DDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIG 316
            + I +LLR ELD +N     FTELKCF+PLK   FS  +++LK WVQTG++P+SDI+IG
Sbjct: 254 TESINLLLRNELDGYNNVTNMFTELKCFAPLKCM-FS-AKEVLKTWVQTGLIPESDIVIG 311

Query: 317 IRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDE 376
           IRD+  G LED+ WY+R  L    NN +LP +   +NFNA +A +W +  + SI  LV  
Sbjct: 312 IRDTQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSS 371

Query: 377 NLDQKAISN-PQGFQIRIDSRRNIRIKCLSKVPKDI 411
                A SN P  F+++ID+ + I I+ LS++P+ +
Sbjct: 372 ---SIADSNHPCSFKLKIDNHKTISIQKLSRIPQTV 404

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  221 bits (564), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 213/387 (55%), Gaps = 33/387 (8%)

Query: 31  FSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSA 85
           F HS++S FP+    F++ S ++  +   ++  + +Y       +  LK+DI +     A
Sbjct: 30  FVHSNVSHFPSVPCKFFQESREIGTFT--RMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87

Query: 86  SEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIV 145
             A  +K  YLG DL +GFE ++P+S  +L++++  ++FI +WE K   KY    KF IV
Sbjct: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIV 147

Query: 146 STRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEG 205
           S RHH++++ M  F                  N++ T  + G L+ + D S     ++ G
Sbjct: 148 SNRHHLIDLIMCPFSLEEA-------------NLIVTHLD-GLLIISSDKSKP--KVDSG 191

Query: 206 IYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLR 265
           I SK+  ++++CY+GF LE+L+                     +++VENKL + + +LL+
Sbjct: 192 IRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHT-------CFYSIVENKLTEGVSLLLQ 244

Query: 266 CELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGEL 325
            E+D++N     + ELKC    ++ N +HRRKLL+ W+QTG++P +D+L+G RD  + +L
Sbjct: 245 AEMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQL 304

Query: 326 EDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISN 385
           + ++ Y+RD +  K + RNL E++  +NFN+ VA QWS H I  I +LVD+NL  + +  
Sbjct: 305 DALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPL-- 362

Query: 386 PQGFQIRIDSRRNIRIKCLSKVPKDIL 412
            Q F++ +     + +  L+  P  ++
Sbjct: 363 -QSFKLTLTRDLQLSLTKLANTPAGLI 388

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  218 bits (556), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 204/393 (51%), Gaps = 31/393 (7%)

Query: 25  RVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLY----PASQYDIIPHLKNDIAQL 80
           RV F EF H     + +     ++ S +VA Y   KLY      +   I+P LK DIA L
Sbjct: 27  RVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAAL 86

Query: 81  PK-KSASEARTLKRSYLGSDLYDGFETFV-PMSAKDLDSLEPCMSFIKDWERKASTKYKP 138
            + K+  ++ + K  YLG  LY GFE +V  MS   LDS +PC+ +I +W R +  + K 
Sbjct: 87  AQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKF 146

Query: 139 GRKFN--IVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWS 196
           G  +   IV  RHH+VE+TM LF              DY L  V T      ++ ++   
Sbjct: 147 GESYRHIIVGPRHHLVELTMALFAND----------SDYKL--VCTVLRGKFIVLSQFDD 194

Query: 197 NTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKL 256
            +  + NEGI   +   + +CYSGF +  +                    + F      +
Sbjct: 195 GSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIP-----------SQFFYYGTPI 243

Query: 257 DDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIG 316
                    CE+DA+N  E  +TELKC+ PL M +  H+ KLL+ WVQT V PD+D++IG
Sbjct: 244 RRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIG 303

Query: 317 IRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDE 376
            R++  G L+D+   SR+ L  K NN++ P +  ++N+NAQVA +WSQ+ +++I +L++ 
Sbjct: 304 CRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEG 363

Query: 377 NLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPK 409
           NL+QK++  PQ F + +    +I I+ L  VPK
Sbjct: 364 NLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPK 396

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  194 bits (493), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 119/397 (29%), Positives = 204/397 (51%), Gaps = 30/397 (7%)

Query: 23  ITRVPFGEFSHSSISLFPTCTQP-FYESSNQVALYHNHKLYPAS--QYDII-----PHLK 74
           I R+PF  FS+S+  +    +QP  ++ +  VALY++ ++   +  + ++I     P L 
Sbjct: 60  IARIPFKHFSYSNAHI--GKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLT 117

Query: 75  NDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKAST 134
            DI+ L + S  +++  K  Y+G +LYD  E F PM +  LDS  PC  +++  +     
Sbjct: 118 KDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEED 177

Query: 135 KYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKD 194
           K      +  ++ RHH+ E+ M ++                  + ++T  +   ++ ++D
Sbjct: 178 KLY-NTPYTFMTPRHHLTELMMTVYESRESELTGK--------SWLFTRIKDDLIVISED 228

Query: 195 WSNTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVEN 254
            +   N   +    +N   K++  SGF  E+L+                     F + EN
Sbjct: 229 LAKENNPSPQNHKLQNSFSKKVINSGFTFEELVIENFQECHK----------PYFYISEN 278

Query: 255 KLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDIL 314
           +L      ++R E+D++N   + FTELKCF+ L +    HR+KLLK W QTG+ P+ DI+
Sbjct: 279 RLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIV 338

Query: 315 IGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLV 374
           IGIRD+S G LED+ WYSR+ +  K+ + +LP+ K  ++F   +  QW  HCI +I    
Sbjct: 339 IGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAF 398

Query: 375 DENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411
            ++    A SNP  +++ ID  ++I IK LS VPK++
Sbjct: 399 TKDTSDTA-SNPMTYKVIIDKHKSIIIKKLSIVPKNV 434

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  189 bits (481), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 111/384 (28%), Positives = 204/384 (53%), Gaps = 39/384 (10%)

Query: 31  FSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSA 85
           F H+ I+ FP    PF++   +VA   +  L    ++ +     +P L  D+ +    + 
Sbjct: 24  FQHAQINQFPKNVLPFFDEVQEVATITH--LLDTDEFLLDDKLGMPELVQDLCEF---TE 78

Query: 86  SEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIV 145
           S     K  Y+G DL D F+ +VP++ K L+ +    +F++ W++     +     F IV
Sbjct: 79  SGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIV 138

Query: 146 STRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEG 205
            +RH+++++ M  F             +D  L + ++    G L  + D        ++G
Sbjct: 139 CSRHNLIDLIMMPFSD-----------EDVHLKIQFSN---GYLNLSPDAQY--QKTDQG 182

Query: 206 IYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLR 265
           I+S +  +K+ICY+GF LE+L+                   + +++VE KL D I +LL+
Sbjct: 183 IHSGDTKIKKICYTGFELENLITATSKPDVRS---------SFYSLVEGKLGDGIKLLLK 233

Query: 266 CELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGEL 325
            E+D FN + + +TE+KC S LK+ +  HRRKLL+ WVQT ++P +++L+GIRD  + +L
Sbjct: 234 AEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQL 293

Query: 326 EDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISN 385
              E Y+R +L  K NN+ L   + ++N+NA ++ QW +H I+ +C+++   +++    +
Sbjct: 294 TSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEK---GS 350

Query: 386 PQGFQIRIDSRRNIRIKCLSKVPK 409
            +    R+  R+N+ IK L K+P+
Sbjct: 351 KEEVNFRLTLRKNLTIK-LRKMPE 373

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  188 bits (477), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 109/375 (29%), Positives = 189/375 (50%), Gaps = 32/375 (8%)

Query: 31  FSHSSISLFPTCTQPFYESSNQVA-LYH--NHKLYPASQYDIIPHLKNDIAQLPKKSASE 87
           F  +SIS FP     F++   ++  + H  +   +   +    PHLK D+      + ++
Sbjct: 24  FERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF---TITK 80

Query: 88  ARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVST 147
                 SY+G DL + ++ F P++   L+ +     F+  WE      Y  G  F IV +
Sbjct: 81  KLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVCS 140

Query: 148 RHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEGIY 207
           RH+++++ M  F             +D   NV Y     G L    D        ++GIY
Sbjct: 141 RHNLIDLIMAPFSD-----------EDVHFNVKYIN---GYLHIFPD--KQFQKKDDGIY 184

Query: 208 SKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLRCE 267
           S    ++RICY+GF LEDL+                   A +++V+ K+  +I +L + E
Sbjct: 185 SSESNIRRICYTGFELEDLVTETQPGAPKS---------AFYSLVQGKISKNIKLLFKAE 235

Query: 268 LDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELED 327
           +D FN A++ +TE+KC + LK+ +  HRRKLL+ WVQT ++P +D+LIG+RD  + +L  
Sbjct: 236 MDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSS 295

Query: 328 VEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQ 387
            E Y+R  L  K NNRNL   K  +N+NA ++ QW +H ++ +C+ +   + +K  +   
Sbjct: 296 FECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYV-EKTPTEAV 354

Query: 388 GFQIRIDSRRNIRIK 402
            F++ +  +  +R++
Sbjct: 355 SFKLTLTKQLELRLR 369

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  179 bits (455), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/383 (30%), Positives = 192/383 (50%), Gaps = 28/383 (7%)

Query: 46  FYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSASEARTLKRSYLGSDL 100
            Y +S +VA YH   L   +   I     +P LK+DI Q+  KS  +++  K  Y+G+DL
Sbjct: 59  LYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADL 118

Query: 101 YDGFETFVPMSAKDLDSLEPCMSFIKDWERKAST---KYKPGRKFNIVSTRHHIVEMTMK 157
           +  +E +  M  + L     C  +I+ +++K +    KY   ++F I+++RHHI ++ + 
Sbjct: 119 FKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLA 178

Query: 158 LFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRIC 217
            F            + D  ++V+ T     R+L ++D+++      E     N  +++I 
Sbjct: 179 PFKK----------ISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNS-MRKIV 227

Query: 218 YSGFALEDLMXXXXXXXXXXXXXXXXX------XXAVFAVVENKLDDDICILLRCELDAF 271
            SGFA EDL+                           F+VVEN +   + ILLR E+D +
Sbjct: 228 NSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGY 287

Query: 272 NGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWY 331
           N     +TELKCF+ L M +  HR+KLLK WVQ G LP+SD+L+G RD+  G L D+ W+
Sbjct: 288 NPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWF 347

Query: 332 SRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQ--KAISN-PQG 388
           SRD L +K ++   P  +   N     A+ W  H + +I  L  + L +  KA S+ P  
Sbjct: 348 SRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVP 407

Query: 389 FQIRIDSRRNIRIKCLSKVPKDI 411
           F++ ++  R I +  L KVP  +
Sbjct: 408 FRLIVEKNRTITLLPLKKVPASV 430

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  169 bits (427), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 157/315 (49%), Gaps = 40/315 (12%)

Query: 94  SYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVE 153
            Y+GSDL    ETF P+++++L  L   + FI  WE      Y    KF IVS RHHI++
Sbjct: 92  GYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILD 151

Query: 154 MTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKD-----WSNTGNSMNEGIYS 208
           + M  F                       G+E  RL+FT        +   +    GI S
Sbjct: 152 ILMIPF-----------------------GNERCRLVFTAHRGLFVITLAPSQRPTGINS 188

Query: 209 KNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVFAVVENKLDDDICILLRCEL 268
            +   ++ICY+GF LE L+                   + ++ +E KL+ DI ILL+CE+
Sbjct: 189 PSSATRKICYTGFELERLLTATSGTERG----------SFYSFIEAKLEPDITILLQCEM 238

Query: 269 DAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDV 328
           DA+N   +K+TE+K      + N  H  KLLK W QT +LP +DIL+G RD S   L+ V
Sbjct: 239 DAYNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTV 298

Query: 329 EWYSRDRLRSKINNRNLPESKIDW-NFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQ 387
             YS D++  K+  R+   S   + NFN +VA  W+ + IR IC+ +   +D  + S+PQ
Sbjct: 299 VPYSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATS-SSPQ 357

Query: 388 GFQIRIDSRRNIRIK 402
            F + ID    ++I+
Sbjct: 358 SFLVEIDKNLQMKIR 372

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  140 bits (352), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 103/341 (30%), Positives = 171/341 (50%), Gaps = 38/341 (11%)

Query: 71  PHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWER 130
           P L+ ++    K S  E + +K S++G DL  G++ +VP+    L+SL      +K+  +
Sbjct: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSL----VILKEAYQ 145

Query: 131 KASTKYKPGRKFNIVSTRHHIVEMTMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLL 190
           +      P  K   VS RHHI+++ M  F              D  L+++ T      +L
Sbjct: 146 RYEKTLNP-EKTTFVSLRHHIIDIIMCPFL-------------DEPLSLLMTVQPDKNIL 191

Query: 191 FTKDWS-NTGNSMNEGIYSKNIILKRICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAVF 249
            + D S +  N ++E   ++N   K+ICY+GFALEDL+                     +
Sbjct: 192 ISVDKSKDKPNGIHE---TRNSFNKKICYTGFALEDLLIESPTEGHILEHE------LYY 242

Query: 250 AVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLP 309
           ++V   L+D+I +L++ E+D+ N     +TE+K     K+ N  HRRKLL+ W+QT +LP
Sbjct: 243 SIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLP 302

Query: 310 DSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKID-WNFNAQVATQWSQHCIR 368
            SD+LIG R+S   ELE ++ Y    +  KINN ++       + FN  VA  W QH   
Sbjct: 303 KSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQH--- 359

Query: 369 SICKLVDEN---LDQKAISNPQGFQIRIDSRRNIRIKCLSK 406
            I +++ +N   L Q++ S    F+++ID+   + I   S+
Sbjct: 360 -IFQVLKQNLLLLSQESTST--TFKVQIDTNLTLSISPASQ 397

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 5/80 (6%)

Query: 276 KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 333
           K +TELKC S +  +N   R  +K+ +AW+Q  ++    ++ G RD  +  L+ VE +S 
Sbjct: 242 KHYTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRDDQY-MLKTVEEFST 300

Query: 334 DRLRS--KINNRNLPESKID 351
           + +    K NN  L +S +D
Sbjct: 301 EEIPVIIKANNPTLGQSCLD 320

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 276 KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 333
           K + ELKC + +  +  +H+  RK+ + W+Q  ++    I+ G RD ++  L+ +E YS 
Sbjct: 233 KHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTIEEYST 291

Query: 334 DRLRSKINNRN 344
           D +   + N N
Sbjct: 292 DEIPILLKNNN 302

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 95/243 (39%), Gaps = 40/243 (16%)

Query: 97  GSDLYDGFETFVPMSA--KDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEM 154
           G DL  G++ F    +  KD  +L   +S +KD+E+K + K     K +IV+ R  I ++
Sbjct: 56  GLDLNGGYKKFKDYYSEFKDASTLHGLLSSLKDYEQKKNKK----MKVDIVTFRGIIRKL 111

Query: 155 TMKLFXXXXXXXXXXXXVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILK 214
            M  F            +      V++ G      LF KD S T N+  E +        
Sbjct: 112 IMSSFETNSKYNVVDLRI------VLFDGQ-----LFIKDVS-TVNAKPEKVTP------ 153

Query: 215 RICYSGFALEDLMXXXXXXXXXXXXXXXXXXXAV------FAVVENKLDDDICILLRCEL 268
            + Y+G+  E L                     +      F  V      +  ILL  E+
Sbjct: 154 -LEYTGYKFEALCTLPEPLPYVSRTKLNKRPKKIVSHGDEFVSVVKTGVGNCKILLGAEV 212

Query: 269 DA-FNGAEK------KFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRD 319
           DA F+  EK       + ELKC + +   N + +   KL K W+Q  ++  + I  G RD
Sbjct: 213 DAIFDFKEKGKDNLQHYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRD 272

Query: 320 SSF 322
             +
Sbjct: 273 EQY 275

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 10/92 (10%)

Query: 262 ILLRCELDA-FNGAE------KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 312
           IL+  E+D  F+  E      K + ELKC + +   + +H+  RKL K W+Q  ++  + 
Sbjct: 212 ILIGAEVDCIFDFKEDSDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINR 271

Query: 313 ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344
           I+ G RD +F  L+ VE ++   +   + N N
Sbjct: 272 IIYGFRDDNFM-LKTVEEFTTSEVPLILKNNN 302

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 61/134 (45%), Gaps = 19/134 (14%)

Query: 262 ILLRCELDA-FNGAEKKFTELKCFSPLKMSNF--------SHRRKLLKAWVQTGVLPDSD 312
           ++L  E+DA F+  E+    LK +  LK +N            +K+ K W+Q  ++    
Sbjct: 207 LMLGAEVDAIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPR 266

Query: 313 ILIGIRDSSFGELEDVEWYSRDR--LRSKINNRNLPESKIDWNFNAQVATQW-------S 363
           I+ G RD++F  L+ VE +S D   L  K N+  L  S +D      V T+W        
Sbjct: 267 IIYGFRDNNFI-LKSVEEFSTDEVPLLLKSNSPQLGNSCVDAIKWYGVFTEWLLNQIPRD 325

Query: 364 QHCIRSICKLVDEN 377
              I+   KLV EN
Sbjct: 326 DPSIKKAYKLVYEN 339

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 276 KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 333
           + + ELKC + +  +  +HR  RKL K W+Q  ++    I+ G RD ++  L+ VE +S 
Sbjct: 225 RHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRDENYT-LKSVEEFST 283

Query: 334 DRL 336
           + +
Sbjct: 284 EEV 286

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 10/92 (10%)

Query: 262 ILLRCELD-AFNGAEKKFTELKCFSPLK----MSNF----SHRRKLLKAWVQTGVLPDSD 312
           ++L  E+D  F+ AE     LK ++ LK    +S F    S  RKL K W+Q  ++  + 
Sbjct: 210 LVLGAEVDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINR 269

Query: 313 ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344
           I+ G RD  F  L  VE Y    +   + N N
Sbjct: 270 IIYGFRDEHFI-LRSVEEYGSHEIPLLLKNNN 300

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 21/117 (17%)

Query: 262 ILLRCELDAF-----NGAE--KKFTELKCFSPLK----MSNFSHRRKLLKAWVQTGVLPD 310
           +L+  E+D       +GA+  K + ELKC   L     + NF   +KL K W+Q  ++  
Sbjct: 209 VLMGGEVDGIYDFKEDGADNLKHYLELKCTRSLSSYQDIENFE--KKLFKTWLQCFLIGI 266

Query: 311 SDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCI 367
             I  G RD S+  L  +E Y  + +     NR +    +D       A QW    I
Sbjct: 267 PRITYGFRDRSYN-LTSIEEYLTEDVPKLFTNRGVKAQCMD-------AIQWYGEII 315

>Suva_2.630 Chr2 (1119245..1121140) [1896 bp, 631 aa] {ON} YDR456W
           (REAL)
          Length = 631

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 319 DSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLV 374
           DS+FG L+D E  S D  RS I+ RNL   K+   FN+   +QW Q+    + K V
Sbjct: 555 DSTFGGLDDTENASPDFGRSSIDKRNL-RDKLGTIFNSD--SQWFQNFDEQVLKPV 607

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 276 KKFTELKCFSPLKMSNFSH----RRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWY 331
           K + ELKC     +S F+      RK+ K W+Q  ++  + ++ G RD +F  L  VE Y
Sbjct: 231 KHYAELKCTK--GVSTFAEARAFERKMFKTWLQCFLVGINRVIYGFRDENFI-LRSVEEY 287

Query: 332 SRDRLRSKINNRN 344
           S   +   + N N
Sbjct: 288 STQEVPLLLKNNN 300

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 10/92 (10%)

Query: 262 ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 312
           ++L  E+D       NG +  K + ELKC   +  ++ +H+  RKL + W+Q  ++    
Sbjct: 216 LILGAEVDCIFDFKENGRDNLKHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPR 275

Query: 313 ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344
           I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276 IIYGFKDDHY-VLKTVEEFSTEEVPVLLKNNN 306

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 276 KKFTELKCFSPLKM--SNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSR 333
           K +TELKC   +       +  RK+ K W+Q  ++  + ++ G RD +F  L+ VE +S 
Sbjct: 231 KHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYGFRDDNF-ILKSVEEFST 289

Query: 334 DRLRSKINNRN 344
             +   + N N
Sbjct: 290 QEIPIILKNNN 300

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 10/92 (10%)

Query: 262 ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 312
           ++L  E+D       NG +  K + ELKC   +   + +H+  RKL + W+Q  ++    
Sbjct: 216 LILGAEVDCVFDFKENGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPR 275

Query: 313 ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344
           I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276 IIYGFKDDHY-VLKTVEEFSTEEVPVLLKNNN 306

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 10/92 (10%)

Query: 262 ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 312
           ++L  E+D       NG +  K + ELKC   +   + +H+  RKL + W+Q  ++    
Sbjct: 216 LILGAEVDCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPR 275

Query: 313 ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344
           I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276 IIYGFKDDHY-VLKTVEEFSTEEVPVLLKNNN 306

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 10/92 (10%)

Query: 262 ILLRCELDAF-----NGAE--KKFTELKCFSPLKMSNFSHR--RKLLKAWVQTGVLPDSD 312
           ++L  E+D       NG +  K + ELKC   +   + +H+  RKL + W+Q  ++    
Sbjct: 216 LILGAEVDCVFDFKENGKDNLKHYAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPR 275

Query: 313 ILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344
           I+ G +D  +  L+ VE +S + +   + N N
Sbjct: 276 IIYGFKDDQY-VLKTVEEFSTEEVPVLLKNNN 306

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 293 SHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNLP 346
           SHR  +++   QTG+  DS    GI D +   LED+++ +   +R  I  + LP
Sbjct: 181 SHRNNIIEPGFQTGINYDS----GIMDKNHLSLEDIKFQNVGEVRPNIMKQKLP 230

>TDEL0D05730 Chr4 (1030911..1032290) [1380 bp, 459 aa] {ON}
           Anc_3.505 YGR141W
          Length = 459

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 58/131 (44%), Gaps = 13/131 (9%)

Query: 16  QSQKQAPITRVPFGEFSHSSISLFPTCTQPFY--ESSNQVALYHNHKLYPASQYDIIPHL 73
           +SQK  P+  +P  + +  + SLF     P Y  +    V LY   + +PA   D + H 
Sbjct: 50  RSQKLPPV--LPPNKLNDKNRSLFKKGEIPDYVIDDCPLVHLYSEERYWPADIADFVTHF 107

Query: 74  K---NDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKD--W 128
           K   +  + + KK   E + LK  Y    L +G  + +P SA  + SL+    F KD  W
Sbjct: 108 KVTDSYGSSIVKKETLELKDLKSEY-SYKLSNGSMSTIPSSATFMTSLD---DFSKDPKW 163

Query: 129 ERKASTKYKPG 139
               S +Y  G
Sbjct: 164 LLGYSPEYGTG 174

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,062,504
Number of extensions: 1797235
Number of successful extensions: 4482
Number of sequences better than 10.0: 41
Number of HSP's gapped: 4528
Number of HSP's successfully gapped: 43
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)