Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F033905.435ON86186142810.0
NDAI0B056805.435ON8567047613e-87
ZYRO0F10054g5.435ON6606687405e-86
TDEL0E019005.435ON7628077002e-79
Skud_4.6385.435ON8438656762e-75
YDR369C (XRS2)5.435ON8547326561e-72
KAFR0E038305.435ON8457486392e-70
Suva_2.5415.435ON8698516393e-70
SAKL0G02552g5.435ON8348375961e-64
CAGL0A02838g5.435ON8288455511e-58
KLTH0F16038g5.435ON7928345456e-58
Kwal_55.214225.435ON7827095235e-55
KNAG0C049005.435ON7697104677e-48
TBLA0A028205.435ON9258624512e-45
Smik_4.6355.435ON8634283932e-38
Kpol_1016.55.435ON8121082961e-26
TPHA0J025905.435ON7757092843e-25
KLLA0E02201g5.435ON8352592649e-23
AER402C5.435ON8694392004e-15
Ecym_47615.435ON7983011942e-14
SAKL0E10032g2.191ON1626180762.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03390
         (861 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...  1653   0.0  
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   297   3e-87
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   289   5e-86
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   274   2e-79
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   265   2e-75
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   257   1e-72
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   250   2e-70
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   250   3e-70
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   234   1e-64
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   216   1e-58
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   214   6e-58
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   206   5e-55
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   184   7e-48
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   178   2e-45
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   155   2e-38
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   118   1e-26
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   114   3e-25
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...   106   9e-23
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    82   4e-15
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    79   2e-14
SAKL0E10032g Chr5 complement(837606..842486) [4881 bp, 1626 aa] ...    34   2.2  

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score = 1653 bits (4281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 810/861 (94%), Positives = 810/861 (94%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF 120
           IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF
Sbjct: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF 120

Query: 121 HETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACEIL 180
           HETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACEIL
Sbjct: 121 HETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACEIL 180

Query: 181 SSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLKTA 240
           SSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLKTA
Sbjct: 181 SSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLKTA 240

Query: 241 LNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDLEYFKLEDIIT 300
           LNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDLEYFKLEDIIT
Sbjct: 241 LNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDLEYFKLEDIIT 300

Query: 301 AIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQPSHHTVDSIHNDKKNVLS 360
           AIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQPSHHTVDSIHNDKKNVLS
Sbjct: 301 AIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQPSHHTVDSIHNDKKNVLS 360

Query: 361 NRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDESAES 420
           NRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDESAES
Sbjct: 361 NRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDESAES 420

Query: 421 DKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEH 480
           DKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEH
Sbjct: 421 DKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEH 480

Query: 481 TEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKS 540
           TEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKS
Sbjct: 481 TEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKS 540

Query: 541 FVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRT 600
           FVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRT
Sbjct: 541 FVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRT 600

Query: 601 PTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKFT 660
           PTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKFT
Sbjct: 601 PTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKFT 660

Query: 661 GQYNNVPNXXXXXXXXXXXXXXNIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARI 720
           GQYNNVPN              NIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARI
Sbjct: 661 GQYNNVPNDDEDMYEHHDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARI 720

Query: 721 KDTQPDFSDDEGQSFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQENVDSVAVRL 780
           KDTQPDFSDDEGQSFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQENVDSVAVRL
Sbjct: 721 KDTQPDFSDDEGQSFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQENVDSVAVRL 780

Query: 781 DEPYKENKDALNNYTHHSQNSQMIDMDXXXXXXXXXXXXXXXXXXQHKTLIAXXXXXXXX 840
           DEPYKENKDALNNYTHHSQNSQMIDMD                  QHKTLIA        
Sbjct: 781 DEPYKENKDALNNYTHHSQNSQMIDMDPKSYKRPRKSPPKKPGSRQHKTLIADHDDDDDD 840

Query: 841 XXXXXXXXXXXGPKFKFRRQN 861
                      GPKFKFRRQN
Sbjct: 841 DDYDDDDDDDYGPKFKFRRQN 861

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  297 bits (761), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 227/704 (32%), Positives = 362/704 (51%), Gaps = 76/704 (10%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MW+LRYQY LEDG  +K+S C+++S+ Y+IGRS+KN LSIKNDKSISRQH+++KWE    
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNS--LSIKLGTKPVMVHLEFYSSNWLIPNGLT 118
           +H++NQGKLT + E+YL + +SL F  V++  L + LGT PV+V + +   N  IPN   
Sbjct: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE 120

Query: 119 QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACE 178
           QF   L  +G+ V + I + + + I  +V   N    +PL      IPV K Q+ +    
Sbjct: 121 QFRGLLTKYGIEVTSDI-LQEDSHITAVVMTPNDY-YVPLLALALGIPVFKSQYLTEVSN 178

Query: 179 ILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSR-LFENYVILILFDNET---NKDAV 234
           +L  ++  FD    ++    +      + SL + S+  F++Y  +I  +  +   + D  
Sbjct: 179 MLRPDNITFDTDVQKINSMESLKLVPSF-SLSNNSKNFFQDYFFIITLNKSSVSEHADKS 237

Query: 235 KTLKTALNLGGA---IVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDLE 291
             L+ +L L G    I+ D ++L  S   +  +  T+ ++I +V      +    + + E
Sbjct: 238 FILRKSLQLIGGEEEIIKDPTELQNS---VTKILSTSGKNIVIVT--DEDNGKRMIMNFE 292

Query: 292 YFKLEDIITAI--RDDKIMKLITT----IPEREQVMNQDVSLIPEITYPSDRKTNIQPSH 345
              ++DI  +    D K++K   T    +  +   + ++  L+ EI  P        P  
Sbjct: 293 CRNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEP--------PIE 344

Query: 346 HTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASP------ 399
             +       KN+     P E    + IVKKRRL R+RVKPL+SL FF GG++       
Sbjct: 345 AAITEESTSSKNL--KHTPPEPVTTH-IVKKRRLARKRVKPLESLDFFVGGSTTGTPFET 401

Query: 400 -------KIGSPAVQETAQATKDESAESDKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLE 452
                  +I  P V + A    ++  +S   + N  + +P+ +   +  S+      +  
Sbjct: 402 SSTTLQQEIIEPKVPDVAPILNEQIQQS---QVNKSINEPAKDIYSIGGSDRKETAALTY 458

Query: 453 ADHNKNIQEGPTTAVPVIQSKSTQPLEHTEQNKNSEIGSVAATPTPEVLTGNGVERPNTP 512
           A  +K++QE PT  +  I S+      H   N+  E  S ++  +P  +    V      
Sbjct: 459 ATIDKHMQE-PTQQIDDIPSQHIDISPHGNSNE-QEKRSNSSEKSP--MITQQVNDEKDE 514

Query: 513 QVPSTQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGA 572
           ++ + +AL    +E  + K  S   PKS V+ IQ+ KNREVTRL+S++  +D +ELTE A
Sbjct: 515 KISNAKALKIGKRE--DSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDA 572

Query: 573 INQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKTAREWS---------RRKNFKKFV 623
           IN+  +L IVE N SLIR    R E    T + ++   R  S          R+NFK+FV
Sbjct: 573 INEFSNLAIVESNASLIR----RTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFV 628

Query: 624 KIYPKYMKKDTESD-------TTDLIRNNAFLITRNYVPMKKFT 660
           K+YPKY++   +S+        +D IRNNAFLITRNYVP+K+++
Sbjct: 629 KVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYS 672

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  289 bits (740), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 202/668 (30%), Positives = 349/668 (52%), Gaps = 103/668 (15%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRN- 59
           MW+LRYQYDLEDG+ + +S C++    Y IGRS+KN L+IKNDKSISRQH+S+ W+ ++ 
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 60  DIHIINQGKLTYIGEQYLDVGQSLTFG-NVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLT 118
            + +INQGK+T + E+YL +G+S++FG ++ ++ ++LGTKP+ + L++  S W++P G  
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120

Query: 119 QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACE 178
             H  L++ G+ V +     + ++ +LIV +   +    L+G +K IP+   +F +   +
Sbjct: 121 SDHSALEELGIEVLS----SELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQ 176

Query: 179 ILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLK 238
            +S ++ +FD+ W ++    +      Y S + ++++ +N   L +      KD   +L 
Sbjct: 177 KVSGHETEFDSIWTKIMNDGSL----RYKSWEVQAQVLQNLEFLTV-----GKDEDTSL- 226

Query: 239 TALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDL-EYFKLED 297
            A+   G   +    +   ++ +      +N    +V   S  +P ++L  L + F ++D
Sbjct: 227 -AIEAAGGKYSAVLSVEELREAVKRKGDLSN----VVILKSHLTPAEELAPLGKTFTVQD 281

Query: 298 IITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQPSHHTVDSIHNDKKN 357
           ++ AI  D+                                         V+S+ N    
Sbjct: 282 VVEAILKDE-----------------------------------------VNSLKNGVIG 300

Query: 358 VLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDES 417
            ++ R   E  +  P+ KKRRLNR RVKPLD L+FFAGG S K      +   ++T   +
Sbjct: 301 EVAKRPEAEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMK------ESQGESTMKLN 354

Query: 418 AESDKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQP 477
           ++ ++ +    L  P   S+          KEVL+ +  K   E         +    + 
Sbjct: 355 SQEEESKDPRKLEDPKEESKE--------SKEVLQPEVPKEFNEYSK------EEPGQKS 400

Query: 478 LEHTEQNKNSEIGSVAATPTPEVLT---GNGVERPNTPQVPSTQALVSNHKEKKNLKSNS 534
            E ++ ++N +       PT +V      +  E+PN  + P  +  +S++++ ++   N 
Sbjct: 401 YEESKADENEKSLEETVEPTLQVTEPPPTSAAEKPNNAR-PHRKPTLSDYRKGESPSQND 459

Query: 535 LEEPKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKAS 594
           +      +Q IQ+TKN EV RL ST++++  +ELTE AINQLG+LV+V+ N +L+R++  
Sbjct: 460 M------IQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLMRRRD- 512

Query: 595 RCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTES--DTTDLIRNNAFLITRN 652
               R+PT    D     W+ RKNFK FVK++PKY  +D+ S   ++D IRN AFL+TR 
Sbjct: 513 ----RSPT---VDSHNPNWNNRKNFKNFVKVWPKYGGQDSTSREGSSDTIRNRAFLLTRQ 565

Query: 653 YVPMKKFT 660
           YVP + +T
Sbjct: 566 YVPTRTYT 573

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  274 bits (700), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 244/807 (30%), Positives = 374/807 (46%), Gaps = 160/807 (19%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MW+L+Y Y+LEDG+ +++S C+ K   ++IGRS+KN L+IKNDKSISR H+S+ W+    
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  -IHIINQGKLTYIGEQYLDVGQSLTFGNV----NSLSIKLGTKPVMVHLEFYSSNWLIPN 115
            I +INQG+LT  G +YL VG+S+ F         + I+LGTKP+ V + +    + +P+
Sbjct: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120

Query: 116 GLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFST 175
            L+QF +TL   G+ V     VD ++   ++ D+I  +    L+G +    ++  QF   
Sbjct: 121 QLSQFIDTLDHVGIGVKADT-VDNRSTTIIVTDKIKFAYKC-LFGLINGAVIRNSQFLVE 178

Query: 176 ACEILSSNDNDFDNSWHRL-QETSNTLFCS----HYISLKD-RSRLFENYVILILFDNET 229
              ILS     F+ SW  L Q  S  L+ +    H + LK  +  L  + VI + +  E 
Sbjct: 179 VTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQE- 237

Query: 230 NKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKP--TTNQHICLVKFGSFKSPNDQL 287
                     AL  G     +   +  ++  ++ LK   +T+  I L    + K P D++
Sbjct: 238 ----------ALERGNG---ELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKI 284

Query: 288 PDLEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDV-SLIPEITYPSDRKTNIQPSHH 346
              +   L D++ A+  + +  L+  +P  E      + S  P +T     KT +  S  
Sbjct: 285 ---KLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLT-----KTEVSSSQS 336

Query: 347 TVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGG---------- 396
             +  H  +  V     P E     P VK+RR NR  VKPLDSL FFAGG          
Sbjct: 337 LSNKEHTPEHTVT----PAE----KPPVKRRRYNR--VKPLDSLMFFAGGDYSTEEPEQE 386

Query: 397 ASPKIGSPAVQETAQAT------------KDESAESDKFRTNNGLTQPSGNSQPLIHSEP 444
            S +  +PA  +TA+ +              ES+  DKF+ N  L     NS     ++P
Sbjct: 387 ISTQPVNPAASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLK----NS-----AKP 437

Query: 445 IVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEHTEQNKNSEIGSVAATPTPEVLTGN 504
           + +    +A +   I         + Q       E  +Q++ + +  V  TP P      
Sbjct: 438 LTIDSPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPT----- 492

Query: 505 GVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREVTRLKSTMVEID 564
                      + +  + + K   N   NS    +  V  I++ K+REV RLKST+V++D
Sbjct: 493 -----------ARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQVD 541

Query: 565 TDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKTARE-----WSRRKNF 619
           TDELTE AINQLG L IV+PN SLIR++            DS +T+R      W  RKNF
Sbjct: 542 TDELTEDAINQLGDLAIVQPNDSLIRRQKI----------DSAETSRNDQHPPWDGRKNF 591

Query: 620 KKFVKIYPKY----MKKDTESDTTDLIRNNAFLITRNYVPMKKFTGQYNNVPNXXXXXXX 675
           K FVK+  KY    M ++    ++D IRN+ +L+TR YVP K +T + +           
Sbjct: 592 KNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKESSK---------- 641

Query: 676 XXXXXXXNIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFSDD--EGQ 733
                                + DF  +S+ + R+  +           P   DD  + +
Sbjct: 642 --------------------EMQDFPEASEQTSRQFSV-----------PQVIDDPEDAE 670

Query: 734 SFSFRRSMANAKKTTANNGLFVVDEDD 760
            F+F R  +    T ANNGLFVVDEDD
Sbjct: 671 PFTFTRHTSG---TPANNGLFVVDEDD 694

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  265 bits (676), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 273/865 (31%), Positives = 406/865 (46%), Gaps = 143/865 (16%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWE---- 56
           MWV+RYQ  +EDG    IS C+Q S  Y+IGRS+KN L IKNDKSISRQH++ KWE    
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 57  ---DRNDIHIINQGKLTYIGEQYLDVGQSLTFGN---VNSLSIKLGTKPVMVHLEFYSSN 110
                + + +INQGKLT I +++L VG+          N  +I+LGT P  + + + S  
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGS---GLIPLWGFMKDIPV 167
           W IP+ LT+F  TL  FG++  + I       I+L++ +   S   G+  L+  +  IP+
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSI---DDGPINLMISDFPSSDDNGMRELYALVNAIPL 177

Query: 168 KKPQFFSTACEIL---SSNDNDFDNSWHR-LQETSNTLFCSHYISLKDRSRLFENYVILI 223
           KK +     C+ L   S  +  FD  W   L      +F      L  +       ++L 
Sbjct: 178 KKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLT 237

Query: 224 LFDNETNKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSP 283
              NE    A     T   L   ++N F ++ +  ++++ LKP+      L+   + K+ 
Sbjct: 238 TTSNERRLSA-----TLRGLNVKLLN-FDNMKSLYEHVDGLKPSIKY---LILTSTNKTE 288

Query: 284 NDQLPDLEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQP 343
           N Q+       +  +IT++ +D +  +  T     ++ N+    + E+   S +      
Sbjct: 289 NGQI----QCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSK------ 338

Query: 344 SHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPK--- 400
                 ++H  +  V      G A     I+KKRRLNR+RV+PLDSL+FFAGG S K   
Sbjct: 339 ------TLHTPEIEV------GPA-----ILKKRRLNRRRVQPLDSLSFFAGGLSSKSSS 381

Query: 401 --------------------IGSPAVQETAQATKDESAESDKFRTNNGLTQPSGNSQPLI 440
                               I SP +    + +        K   NN       ++  ++
Sbjct: 382 EHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKENGQKSTGAIV 441

Query: 441 HSEPIVLKEVLEAD-HNKNIQEGPTTAV-PVIQS----KSTQPLEHTEQNK---NSEIGS 491
            S P +  E +  D  +K  +  P T   P +QS      T P  + E  +   N E G 
Sbjct: 442 ISSPELYAEHISEDSEDKPPRLSPLTVTRPGLQSNPLISRTTPAHYMEDKRIAENYENGK 501

Query: 492 VAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNL----KSNSLEEPKSFVQAIQE 547
            +     + L  N  E P   Q  ++ + V      K L    KSN+   P SFV+AIQE
Sbjct: 502 SSTRDIIQTLEENH-EPPEQSQEKNSYSQVDRKSPVKELLQKRKSNT---PLSFVEAIQE 557

Query: 548 TKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKA--SRCECRTPTGED 605
           TKNREV R KST+V+++ DEL+E  INQL +L IVEPN+ L+RK         RT   ++
Sbjct: 558 TKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKN 617

Query: 606 SDKTAR-EWSRRKNFKKFVKIYPKYM------KKDTESDTTDLIRNNAFLITRNYVPMKK 658
                R EW  RKNFK F+K++PK+       K DT++  +D IR+ AFLITRNYVP++K
Sbjct: 618 ESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQN--SDFIRSAAFLITRNYVPLRK 675

Query: 659 FTGQYNNVPNXXXXXXXXXXXXXXNIENGD--GDLAIPPVVNDFIPSSQLSQRRLQIDSQ 716
           ++   NN                   EN D  G + +  +V++   S   S   +Q   Q
Sbjct: 676 YS--KNN-----------KATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQ---Q 719

Query: 717 SARIKDT--QPDFSDDEG--QSFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQEN 772
             R ++T    D S DEG  QSFSF R    A+   A N LFV ++DD +  N+ N  EN
Sbjct: 720 GPRTQNTFINEDIS-DEGNQQSFSFSRHSDIAQP--AKNKLFVTEDDDKN--NMVNDSEN 774

Query: 773 ------VDSVAVR---LDEPYKENK 788
                 +  + +R    DEP K N+
Sbjct: 775 GCELITLKKIGLRPSNFDEPSKGNR 799

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  257 bits (656), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 222/732 (30%), Positives = 347/732 (47%), Gaps = 119/732 (16%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MWV+RYQ  LEDGS   IS C+Q    Y+IGRS+KN L IKNDKSISRQH++ KWE  N 
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 61  -------IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLS---IKLGTKPVMVHLEFYSSN 110
                  + ++N+GKLT + ++++ VG++ T    + L    I+LGT P+ +  E+ +  
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVD--EINGSGLIPLWGFMKDIPVK 168
           W IP  LTQF   L ++G+  +T+I ++      +I D  +   + +  L+  +  IP+K
Sbjct: 121 WNIPPHLTQFRTMLSEYGI--STEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178

Query: 169 KPQFFSTACEIL---SSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILF 225
           K +F    C  L   S  +  FD  W       N +  +   ++ D    F+  ++L  F
Sbjct: 179 KSRFLMELCNTLLPTSKTNLKFDEMW-------NDMISNPEYNVFD----FDPNILLSKF 227

Query: 226 DNETNKDAVKTLKTALNLGGAI------VNDFSDLNASKDYINNLKPTTNQHICLVKFGS 279
               N   + T+K+   L   +      +  F ++++   Y+++L+ +T           
Sbjct: 228 MRLNNIRVLTTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEAST----------- 276

Query: 280 FKSPNDQLPDLEYFKLEDIITAIRDDKIMKLITTIPER-EQVMNQDVSLIPEITYPSDRK 338
                      EY     I+T     +  K++ TI      +++  +S +  +   S R 
Sbjct: 277 -----------EYL----ILTTTDKKENGKILCTIKTMLTSIIDGTLSAVINMKGASSRT 321

Query: 339 TNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGAS 398
            +    +   D I      +L      E      + KKR+LNR+RV PLDSL FFAGG S
Sbjct: 322 LD----NGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLS 377

Query: 399 PK-----------------------IGSPAVQETAQATKDESAESDKFRTNNGLTQPSGN 435
            K                       I SP + E  +  K      +  +    + + SG+
Sbjct: 378 TKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADE--KHAPFLQNALKPTEDIGKKSGH 435

Query: 436 SQP--LIHSEP-IVLKEVLEADHNKNIQEG--PTTAVPVIQSKSTQPLEHTEQNKNSEIG 490
           S P  +I S P +      E   +K++Q    P  ++P +    +Q +  +  + + E  
Sbjct: 436 SSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTI--SSNSADYETA 493

Query: 491 SVAATPTPEVLTGNGVERPNTPQVPSTQAL-VSNHKE----------KKNLKSNSLEE-- 537
           +V +    EV     V      + PS     +SN+            K  +K  S++E  
Sbjct: 494 AVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKS 553

Query: 538 --PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRK---K 592
             P +FV+AIQETKNREV R+KST+VE+  +EL+E AINQL +L IVEP+ +L+RK    
Sbjct: 554 GTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDS 613

Query: 593 ASRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTE----SDTTDLIRNNAFL 648
                 RT    ++     EW +RKNFK FVK+ PK      E    + ++D IRN AFL
Sbjct: 614 EGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFL 673

Query: 649 ITRNYVPMKKFT 660
           ITRNYVP+KK++
Sbjct: 674 ITRNYVPLKKYS 685

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  250 bits (639), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 213/748 (28%), Positives = 352/748 (47%), Gaps = 140/748 (18%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MW+LRY+ +LEDG+ +K+S C+QK   Y+IGRS+KN L+IKNDKSISRQH++++W+  N+
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 61  -----IHIINQGKLTYIGEQYLDVGQSLTFGN--VNSLSIKLGTKPVMVHLEFYSSNWLI 113
                + ++NQGKLT I E Y+   +S  F +   +++ +KLGTKPV+V + +    W +
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL 120

Query: 114 PNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIV-DEINGSGLIPLWGFMKDIPVKKPQF 172
                QF +++   G  + TQ+       I L++ DE +    I      ++  + KP  
Sbjct: 121 SKDFLQFEKSINSMG--ICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVL 178

Query: 173 FSTACEILSSN-DNDFDNSWHRLQET-SN-TLFCSHYISLKDRSRLFENYVILILFDNET 229
            S  C +L ++   +FD  W +L E+ SN T++    +   D  R F++ V      + +
Sbjct: 179 LSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQD-VQFYTVGSIS 237

Query: 230 NKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPD 289
           + D +    T   L G    +F   + + D +  +K   +  +  +         D++  
Sbjct: 238 HDDLLYLKATVSELQG----NFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQG 293

Query: 290 LEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDVS-LIPEITYPSDRKTNIQP----- 343
           ++ + +++I+ AI D     L T I        ++ +  I      + R +++ P     
Sbjct: 294 IKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTST 353

Query: 344 ----SHHTVDSIHNDKKNVLSNRDPGEA----TLVNPI-VKKRRLNRQRVKPLDSLAFFA 394
               +H T+ +         ++R+ GE+    T++ P   K+RRL R+ VKPLDSL+FFA
Sbjct: 354 LNTNTHATISAAAE------ASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFA 407

Query: 395 GGASP-----KIGSPAVQETAQ-ATKDESAE--SDKFRTNNGLTQPSGNSQPLIHSEPIV 446
           GG++      K  SP V   A   T DE       K   NN       N Q         
Sbjct: 408 GGSTNPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQV-------- 459

Query: 447 LKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEHTE-QNKNSEIGSVAATPTPEVLTGNG 505
             +V++                 +QS S+QP  +   QNK    G +      E+LT   
Sbjct: 460 --DVVQT---------------ALQSLSSQPTTNRSIQNK----GILRTENNDEMLTNAS 498

Query: 506 VERPNTPQVP-----STQALV------SNHKEKKNLKSNSLEE----------------- 537
           ++R N P  P      T  L+      SN  ++ N+   S+E+                 
Sbjct: 499 IKRRNMPLKPLSPDVDTNLLIQPIDSNSNVSQETNVPKESMEDNDNSSNTLSEVNRNILS 558

Query: 538 --------------------PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLG 577
                               P +F++A+Q TK REV R+++ +V++   EL+E AIN+L 
Sbjct: 559 RKSESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLS 618

Query: 578 SLVIVEPNQSLIRKKASRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESD 637
           +L IVE N +LIR++ +         + +D     W  R+NFKKF K++P++       D
Sbjct: 619 NLTIVESNPNLIRERRA---------DKNDSVNDMWKGRRNFKKFNKVWPQHR------D 663

Query: 638 TTDLIRNNAFLITRNYVPMKKFTGQYNN 665
             D +RNNAFLI RNYV +K + G+ N+
Sbjct: 664 GYDSLRNNAFLIIRNYVELKPYDGKRND 691

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  250 bits (639), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 277/851 (32%), Positives = 402/851 (47%), Gaps = 158/851 (18%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWE---- 56
           MWV+RYQ  LEDGS   IS C+Q S  Y+IGRS+KN L IKNDKSISRQH++ KWE    
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 57  ---DRNDIHIINQGKLTYIGEQYLDVGQSLTFGNV---NSLSIKLGTKPVMVHLEFYSSN 110
                N + ++NQGKLT I ++++ VG++ T       N   I+LGT P+ +  E+    
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVD--EINGSGLIPLWGFMKDIPVK 168
           W IP+ L QF   L  FG+  AT+  +D  +   LI D    N  G+  L+  +  IP+K
Sbjct: 121 WNIPSNLAQFQTILSQFGI--ATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLK 178

Query: 169 KPQFFSTAC-EILSSN--DNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILF 225
           K Q     C  +LSS+  +  FD +W+ +   +  LF           ++F+ Y   +LF
Sbjct: 179 KSQLLVDLCNSLLSSSVMNLKFDETWNNM--VNKPLF-----------KVFD-YDPSVLF 224

Query: 226 DNETNKDAVKTLKTALNLGG---------AIVNDFSDLNASKDYINNLKPTTNQHICLVK 276
                 D V TL T  N  G           +  F  LN    +++ LKP+  +   ++ 
Sbjct: 225 SKFMRLDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPS--EKYLILT 282

Query: 277 FGSFKSPNDQLPDLEYFKLEDIITAIRDDKIMKLITT--IPEREQVMNQDVSLIPEITYP 334
           F + K  N Q    +   L+++IT+I DD +  +I T  +P   Q  N      PE  + 
Sbjct: 283 FTN-KRENGQ----KLCTLQNLITSIIDDTLPSVINTKAVPFEVQENN-----TPEKVF- 331

Query: 335 SDRKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFA 394
            +  T I  + HT ++               EAT    ++KKRRLNR+RV+PLDSL FFA
Sbjct: 332 -EGHTAISKTVHTPET---------------EATPA--VLKKRRLNRRRVQPLDSLNFFA 373

Query: 395 GGASP-----------------------KIGSPAVQE-----TAQATKDESAESDKFRTN 426
           GG S                         + SP ++E     ++     +    D ++ N
Sbjct: 374 GGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQNTQRISRDTWKEN 433

Query: 427 NGLTQPSGNSQPLIHSEPI--VLKEVLEADHNKNIQEGPTTAVPVIQSKS-----TQPLE 479
             +    G    ++ S  I   ++   E   N+++Q  PT   P  Q+ S     T P +
Sbjct: 434 GYI----GTGAVVVGSPEIGGSVRHDEEEPVNESLQPSPTVTRPDSQNISAYPVTTTPEK 489

Query: 480 HTEQNKNSEIGSVAATPTP-EVLTGNGVERPNTPQVPST-----QALVSNHK-------- 525
           H E  K  E   ++   T  E  T N  +  N  Q  +      Q L  N K        
Sbjct: 490 HMEGRKIVESYKISDDSTQNENQTQNENQTQNENQTQNEMKIKLQTLKDNRKFSVLSQKT 549

Query: 526 -------EKKNLKSNSLEE----PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAIN 574
                      L+  SL+E    P SFV+AIQ+TKNREV R+KST+VE++ DEL+E AIN
Sbjct: 550 PSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAIN 609

Query: 575 QLGSLVIVEPNQSLIRKKASRCECRT-PTGEDSDKTA--REWSRRKNFKKFVKIYPKYMK 631
           QL +L IVEP+  L+R   S    RT  +   S+K A  +EW +RKNFK F K++P   K
Sbjct: 610 QLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPN-SK 668

Query: 632 KDTESD-----TTDLIRNNAFLITRNYVPMKKFTGQYNNVPNXXXXXXXXXXXXXXNIEN 686
              E D      +D IR+ AFLITRNYVP+KK++ +  +  +               +EN
Sbjct: 669 TPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKK--DRASNWDKENNDDVLALTEMEN 726

Query: 687 GDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFSDDEGQSFSF-RRSMANAK 745
            + D  IP    D   +S + +R     +Q + +K+   D  D + +SFSF RRS   + 
Sbjct: 727 LESDTHIP----DNTDASVIQERSY---AQDSVMKENNSD--DMKERSFSFSRRSDTAST 777

Query: 746 KTTANNGLFVV 756
                N LFV 
Sbjct: 778 YQPVKNKLFVA 788

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  234 bits (596), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 231/837 (27%), Positives = 377/837 (45%), Gaps = 127/837 (15%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MW+LRY+YD EDG+   IS C+++ + Y IGRS K+ L IKNDKSISR+H+ LK    N+
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGL--- 117
           ++++N GKLT +  + L V QSL F     L ++LG KP++  +E+    W + + L   
Sbjct: 61  LNLLNTGKLTTLNAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120

Query: 118 TQF-HETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTA 176
           + F  +    +G++V T +      Q   I+ +   +    L+  +K I + +  F S  
Sbjct: 121 SMFKRQEFNSYGISVTTTMSTRTNLQ---IIKQNQDTYSNCLFSLVKGIDIVRESFLSDF 177

Query: 177 CEILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKT 236
              L     D+D  W  L +  + +F +    +     +F+N  I++      +K     
Sbjct: 178 QSHLYMTPTDYDGIWKNLLQ-KHMVFPNFTTCVS----IFQNISIIV-----ASKSIYNL 227

Query: 237 LKTALNLGGAIVNDFSDLNASKDYINNLKPTTN----QHICLVKFGSFKSPNDQLPDLEY 292
            K  + + G  +    ++   + +I     + +    +HI      + K+ N  + + + 
Sbjct: 228 FKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSE-DA 286

Query: 293 FKLEDIITAIRD-----DKIMKLITTIPEREQVMNQDVSLIP-EITYPSDRKTNIQPSHH 346
            KLE++  A          +  L+  + +R+    Q +  IP +I++ S++         
Sbjct: 287 RKLEELKAAAESLGYKLHDVNDLVDAVLKRDP--RQLLEKIPTKISFRSEKDLEEPKLPL 344

Query: 347 TVDSIHNDKKNVLSNRDPGEATLVNPI-------------VKKRRLNRQRVKPLDSLAFF 393
            +D       + +S   P +  L N               VK++R NR +V+PLDSL FF
Sbjct: 345 KIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFF 404

Query: 394 AGG----------ASPKIGSPAVQETAQATKDESAESDKFRTNNGLTQPSGNSQPLIHS- 442
           AGG           + + G   V E       +  + D     N         +  + S 
Sbjct: 405 AGGNIQAKNEGIQKNQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEPPRKKPRRKPVKSL 464

Query: 443 EPIVLKEVLEAD-HNKNIQEGPT-----TAVPVIQSKSTQPLEHTEQNKNSEIGSVAATP 496
           E ++++E  +A+ HNK I + PT        P  + K  +  E       +EI  +   P
Sbjct: 465 ENLMIREKTQAEQHNKEIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPERP 524

Query: 497 TPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSL-------EEPKSFVQAIQETK 549
             ++   N     N P+    Q        +  +  N+L           + V+AIQ+TK
Sbjct: 525 G-QLEQSNNTASANRPRHIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTK 583

Query: 550 NREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKT 609
           +REV+RLK+T+++ID +ELTE AIN L +L IVE  + LIRK + R  C +     SD  
Sbjct: 584 SREVSRLKNTLIQIDKNELTENAINSLSNLAIVE-KKDLIRKNSERGHCIS-----SDTC 637

Query: 610 AREWSRRKNFKKFVKIYPKYMKKDT-ESDTTDLIRNNAFLITRNYVPMKKFTGQYNNVPN 668
              W  RKNFKKF+K+ P+  +++T +SD  ++++N+AFLITR YVP+KKF       PN
Sbjct: 638 L--WEGRKNFKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFD------PN 689

Query: 669 XXXXXXXXXXXXXXNIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFS 728
                           E  D    +    N+             I +Q  RI +T     
Sbjct: 690 EK--------------EQIDDTFFLNHSANEG-----------PIPAQPRRIDETSNFTD 724

Query: 729 DDEGQSFSFRR------SMANAKKTTANNG-------------LFVVDEDDLDSINI 766
           D+EG  F+F+R      S++  K+ T  NG             LFV DEDD  S+NI
Sbjct: 725 DEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQSLNI 781

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  216 bits (551), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 246/845 (29%), Positives = 371/845 (43%), Gaps = 176/845 (20%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKW-EDRN 59
           MWVLRY Y  E G  +K+S CI+++V YTIGRS+KN+L IKNDKSISRQH+SLKW   +N
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 60  DIHIINQGKLTYIGEQYLDVGQSLTF-GNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLT 118
            I + N GKLT   E+YL   + +T+  +   + + LG  PV + L      + IPN L+
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120

Query: 119 QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACE 178
           QF ETL+  G+    QI VD        +  +   G   L+    DI +      +  C 
Sbjct: 121 QFRETLETLGI----QISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICN 176

Query: 179 ILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLK 238
            L ++ ++FD  W  +Q        S++ +L                           L+
Sbjct: 177 KLVNDHDNFDAEWRSMQ-------SSYHRNLD--------------------------LE 203

Query: 239 TALNLGGAIVNDFSDLNASKDY--INNLKPTTNQHICLVKFG-----SFKSPNDQLPDLE 291
             L+  G I   F  L    D+  I+ LKP       L+K       S    +D L  + 
Sbjct: 204 GLLSQFGGIRGKFFFLLYKIDWFIISYLKP------FLLKLSVEIHDSIHKNDDLLRLIS 257

Query: 292 YFKLEDIITAIRDDKIMKLITTIPERE-QVMNQDVSLIPE--------ITYPS-DRKTNI 341
             + ++I   I ++KI  L    PE   Q+ + D+    E        I Y S +RK   
Sbjct: 258 SKQADEIPIVISNEKIKYL----PEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIY 313

Query: 342 QPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKI 401
                T ++I   K+++ +   P + +L +   KK+R+ R +V+PL+SL+FFAGG SP  
Sbjct: 314 DLEDETTNAIIPQKRSLANTSQPTDTSLES--TKKKRVRRHKVEPLNSLSFFAGGISPVP 371

Query: 402 G------------------SPAVQETAQATK--DESAESDKFRTNNGLTQPSGNSQPLI- 440
           G                  SP    T +  K   +S      R  + LT    NS+P I 
Sbjct: 372 GTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALT--DDNSEPTIV 429

Query: 441 ---------HSEPIVLK-EVLEADHN------KNIQEGPTTAVPVIQSKSTQPLEH--TE 482
                    H + ++   EV+E  H+      ++I E          +KS   +E+  T+
Sbjct: 430 QRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQ 489

Query: 483 QNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKS---NSLE--E 537
            N    +G   +    E      + + N   + ST+  +    ++ NLKS   NSLE  +
Sbjct: 490 SNLLQSMGYEKSNNKTE------LSKKNAGGIMSTEKNLD--AQRPNLKSQTLNSLEDND 541

Query: 538 PK--------SFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLI 589
           PK          V+ +Q TK  EV RL ST+V+I+  ELTE AIN+L  LV+VEP   LI
Sbjct: 542 PKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLI 601

Query: 590 RKKASRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDL-IRNNAFL 648
           R K+      T        T ++W  RKNFKKFVKI PKY  + +  ++    IR +  +
Sbjct: 602 RTKSDISANNT--------TQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEI 653

Query: 649 ITRNYVPMKKFTGQYNNVPNXXXXXXXXXXXXXXNIENGDGDLAIPPVVNDFIPSSQLSQ 708
           +TR ++  K     Y N  +                             NDF+     + 
Sbjct: 654 LTREFLQTKNVPVDYYNSHHDQ---------------------------NDFVDEINTAP 686

Query: 709 RRLQIDSQSARIKDTQPDFSDDEGQSFSF-RRSMANAKKTTANNG------LFVVDEDDL 761
              Q +  ++ +    P+  D+   SFSF R ++ N    +AN        LFVVD+D  
Sbjct: 687 ---QANKSNSFVHQILPEIGDENENSFSFTRTAIGNGNNNSANEINNSNQQLFVVDDDFE 743

Query: 762 DSINI 766
           DS ++
Sbjct: 744 DSQDV 748

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  214 bits (545), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 221/834 (26%), Positives = 377/834 (45%), Gaps = 135/834 (16%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MW+LRYQY  E GS  ++S C++K   Y +GRS K+ L IK DKSISR+H+ L+    + 
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF 120
           + ++N GKLT IG   + + Q L FG   S+++++G  PV   + +  + W IP+ L   
Sbjct: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLA-I 119

Query: 121 HETLKD----FGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTA 176
            E+LK+    + + V   +    KT + +I +     G   L+  +K IP+    F    
Sbjct: 120 TESLKNHLSLYDIQVTNSLT--SKTSVQIIKEHQKSHGNC-LFALVKKIPIMCEGFIGDF 176

Query: 177 CEILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFE--NYVILILFDNETNKDAV 234
               +    DFD  W ++     TL  + ++ L+ +   F+  N+V+       TN+   
Sbjct: 177 VSQFADTQIDFDAKWEQI-----TLKNAPFLELQTKDAAFKGLNFVV-------TNQKTF 224

Query: 235 KTLKTALNLGGA---IVNDFSDLNASKDYINNLKPTTNQHICL------VKFGSFKSPND 285
              K+ ++ G     +  D S+L     +I     + N  I +          S ++ + 
Sbjct: 225 AIYKSIIDAGSGNLWLCGDVSNLGT---FIEKQIKSENVVILIHLIEEAPALASEQNNSM 281

Query: 286 QLPDLEYFK------------LEDIITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITY 333
            + + +  K            + DI+ A+  + I+ L+  +P+ E+ + ++ +       
Sbjct: 282 HIQEAKLLKNKARSLGFKTRDVNDIVDAVLKNDILSLLDRVPQ-EKALEENSA------- 333

Query: 334 PSDRKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFF 393
                 +I  S    D I  D  N+ +              K++R NRQ ++PL+SLAFF
Sbjct: 334 ----GGSIAGSQVLAD-IVADAPNLRN--------------KRKRANRQ-IQPLNSLAFF 373

Query: 394 AGGAS-----PKIGSPAVQETAQATKDESAE--------SDKFRTNNGLTQPSGNSQPLI 440
            GG+S      ++ +PA ++  +  +             S K R        +GN+    
Sbjct: 374 GGGSSLSQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSKKPREEKNTLHSAGNNSTTT 433

Query: 441 HSE-PIVLKEVLEADHNKNIQEGPT----TAVPVIQSKSTQPLEHTEQNKNSEIGSV--A 493
            SE PI         H +++Q G      +A   + SK  +   HT++   + + S   A
Sbjct: 434 FSETPI---------HQEDVQIGSEPLNHSAAHSVISKEDEST-HTDERNKTLVNSAKDA 483

Query: 494 ATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREV 553
            T T   +  N ++   T    S +A V  +    + +  +++ P+S +QA QE K  EV
Sbjct: 484 RTVTFPSIHKNELKSSRTL---SNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEV 540

Query: 554 TRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDK---TA 610
            RLK  M ++ ++ELTE AIN+L +L  VE    L+R+ +          E+S++   T 
Sbjct: 541 HRLKKNMADVGSEELTEEAINKLDNLASVE-KVDLMRRPSE-------VPENSNQRILTN 592

Query: 611 REWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKFTGQYNNVPNX- 669
            +W+RRKNFKKFVK++P +  + +  + TD +RN A+LITR+YV +  + G  NN  +  
Sbjct: 593 PQWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDG 652

Query: 670 -XXXXXXXXXXXXXNIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFS 728
                         N+    G+LA+  V  +  P+            QS R  ++Q +  
Sbjct: 653 FGDACQQHAAAEQSNLTASPGNLALLGVEVENGPAFAF---------QSQRAANSQANSL 703

Query: 729 DDEGQSFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQENVDSVAVRLDE 782
            +E  +   RR     +    N  LFVVDEDD     +  +  NV  V  RL++
Sbjct: 704 FNETDN---RR--VEERSPERNQELFVVDEDD-SQPQVACYSNNVSQVPSRLED 751

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  206 bits (523), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 203/709 (28%), Positives = 317/709 (44%), Gaps = 113/709 (15%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MW+LRYQY   +G    +S C+++ + Y+IGRS KN L IK+DKSISR H+ L+ +   +
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLT-- 118
           + +   GKLT +  + +  GQ L F     +  ++G  P+   +    S W IP+ L+  
Sbjct: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120

Query: 119 -QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTAC 177
                 L DF + V   +     T I +I D  + S    L+  +K+IP+ +  F     
Sbjct: 121 QSLSRHLADFDIQVTNSL--SSTTSIQIIKDS-SKSFSNCLFSLIKNIPILREHFIGDFV 177

Query: 178 EILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTL 237
             ++    DFD+ W R+      +  + + + K   R F     L+     TN+ A    
Sbjct: 178 TQINDVHADFDSRWDRM-----VVENAQFPNYKCECRPFTTIHFLV-----TNRRAFAIF 227

Query: 238 KTALNLGGA---IVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLP-----D 289
           K  ++ G     + +D S+L    D+    K T++  I LV   + KS           D
Sbjct: 228 KHIIDAGSGTLWLCDDISNL----DHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLD 283

Query: 290 LEYFKL---------------EDIITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYP 334
           ++  KL                DI+ A+ D    KL+  +P R      ++       +P
Sbjct: 284 VQEAKLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVR------NLPSKAPTGFP 337

Query: 335 SDRKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFA 394
            +  TN               K+V+ + D  +     P  K++R NRQ V PLDSLAFF 
Sbjct: 338 LEEATN---------------KSVIKSADTPK-----PSNKRKRTNRQ-VVPLDSLAFFG 376

Query: 395 GGASPKIG--------SPAVQETAQATKDESAE---SDKFRTNNGLTQPS-GNSQPLIHS 442
           GG++ +          S    ET+Q T  E AE   S K      L +P   N       
Sbjct: 377 GGSAAESKQNPTEVPESERGHETSQNTTTEFAEGEPSPKKARIGALRKPDIPNVSEERVK 436

Query: 443 EPIVL---KEVLE--ADHNKNIQEGPTTAVPVIQ-SKSTQPLEHTEQNKNSEIGSVAATP 496
           EP+V    K   E  AD +  +Q  P  +   +Q S+    LE+   + N E G +  T 
Sbjct: 437 EPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEGHTILENDNNSLNIESGPLPKTK 496

Query: 497 TPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREVTRL 556
           +  +  GN   +     V + +A                + P SF QA++ETK+ EV RL
Sbjct: 497 STSL--GNEAAQAQADAVQTREA----------------KRPVSFAQAVKETKSHEVDRL 538

Query: 557 KSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKTAREWSRR 616
           +  +V + ++ELTE AIN+L  L +VE  + L+R       C    G      + +W+ R
Sbjct: 539 EKDIVNVTSEELTEEAINKLDKLALVE-TKDLMRADREYAVCGQSGG------SEQWAGR 591

Query: 617 KNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKFTGQYNN 665
           KNFKKFVK++P    +++    T+ +RN A LITR YVP++ + GQ  N
Sbjct: 592 KNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQNAN 640

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  184 bits (467), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 196/710 (27%), Positives = 322/710 (45%), Gaps = 113/710 (15%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNK-NHLSIKNDKSISRQHLSLKWEDRN 59
           MW+LRY Y+ ED  T  +S C+Q+S  Y+IGRS+K N L IKNDKSISRQH+S +W   +
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  DIHIINQGKLTYIGEQYLDVGQS--LTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGL 117
            + I+N GKLTYI + +L   ++  ++       +IK+G+ PV+V+L  +   ++    +
Sbjct: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNL-VWEDVFIDMTPI 119

Query: 118 TQFHETLKDFGVNVATQIP----VDQKTQIDLIVDEINGSG-LIPLWGFMKDIPVKKPQF 172
           +   ++LK  G+  A         D    + + + EI     LI L      +  K    
Sbjct: 120 SDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRL-YKADLV 178

Query: 173 FSTACEILSSNDN--DFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETN 230
              A +++ SN+N   FD  W+R  ++        Y + K     F ++ I I FDN  N
Sbjct: 179 DLMAQQLVDSNENISSFDEIWNRTVDSGQ---YKEYPNFKVDRNSFRDFTI-IYFDN--N 232

Query: 231 KDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDL 290
              +  +++ +   G  +  F +  + + Y +  +  T  ++ L++   F+  +   P  
Sbjct: 233 DSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNE--TLHNVLLLRSERFQVSH---PVY 287

Query: 291 EYFKLEDIITAIRDDKIMKLIT-----TIPEREQVMNQDVSLIPEITYPSDRKTNIQPSH 345
           E     DI +        K +T     T+  RE  +               R T+I    
Sbjct: 288 EILNKIDICST---GSFFKAVTENNVSTLVHRELFLR--------------RYTDIT--- 327

Query: 346 HTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPA 405
                    +K +   ++P E T V   +KKRRLNR++V+PL+ L FFAGG +      +
Sbjct: 328 ---------QKEMRRPKEPVEDTAVP--LKKRRLNRRKVQPLNPLEFFAGGDTATTTKQS 376

Query: 406 VQETAQATK--DESAESDKFR-TNNGLTQPSGNSQPLIHSE----PIV-----LKEVLEA 453
             +   ATK  DE+  SDK   + + L+  + N+Q  + ++    PI+       EV + 
Sbjct: 377 SDDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKG 436

Query: 454 DHNKNIQEGPTT-----AVP---VIQSKSTQPLEHTEQNKNSEIGSVAATPTPEVLTGNG 505
           D + ++ E   T      +P    +     +P    E+ + S I     TP   V     
Sbjct: 437 DESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKEPVAEMED 496

Query: 506 VERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPK----------------SFVQAIQETK 549
                      T  L ++ +  K +   SL   +                S V+ IQ  K
Sbjct: 497 ELEEVDEVDEPTH-LKASREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVK 555

Query: 550 NREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKT 609
           + E  RL+ T+  +D  ELT+ AI    ++ IVEP  +++RKK +           ++ +
Sbjct: 556 DNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMV---------TESS 606

Query: 610 AREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKF 659
            R  S R NFKKF+K++PK  K +      D +RNNA+LITR+YVPMK +
Sbjct: 607 IR--SDRPNFKKFMKVWPKARKGN------DSLRNNAYLITRDYVPMKAY 648

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 224/862 (25%), Positives = 360/862 (41%), Gaps = 147/862 (17%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKW--EDR 58
           MW++ Y Y   D +   +S C++++  Y+IGRS K+ L +KNDKSISRQH++  W     
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 59  NDIHIINQGKLTYIGEQYLDVGQSLTFGN--VNSLSIKLGTKPVMVHLEFYSSNWLIPNG 116
           N + ++NQGKLT +  + L+  ++L F     +   ++LG  PV+V   + +  + IP  
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120

Query: 117 LTQFHETLKDFGVNVATQIPVDQKTQIDLIVD----EING---SGLIPLWGFMKDIPVKK 169
             QF   LKD+G N+       +   I  ++D     +N    SG +  +  +    + K
Sbjct: 121 FQQFESQLKDYGFNI--NFGPQKNEAITYVIDIEPRPMNNNFISGTL-YYSLVNKSIILK 177

Query: 170 PQFFSTACEILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNET 229
             F ++   +L+ N   F+  +  L + S  +     I+L+          +++L DN T
Sbjct: 178 SSFLTSLLNLLNPNVTTFNIDFQNLLDAS-KIEDFRNINLESLKVELTGIKLIVLNDNTT 236

Query: 230 NKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPD 289
           +          +NL      D         +IN +K  + + + L+   + +     +  
Sbjct: 237 DLIYFIAAMEVINLPTITTED------DTIFINTVKSHSEERLILLTTSNSR----HIET 286

Query: 290 LEYFKLEDIITAIRDDKIMKLITTIPER-----EQVMNQDVSLIPE-ITY----PSDRKT 339
           ++    +D    I++  I  LI  I +      E+   + +SL  E  TY    P     
Sbjct: 287 IKVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDN 346

Query: 340 NIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGG--- 396
           N   S+   DS+      ++       A    P VK+RRLNR+RV+PLDSL FF GG   
Sbjct: 347 NKVNSNTISDSLLKQTSELIKPSVNDHAP-EKPPVKRRRLNRKRVQPLDSLHFFVGGNTN 405

Query: 397 ----------------ASPKIGSPAVQETAQATKDESAESDKFR---------------- 424
                           A+P+      +   +  KDE   S  +                 
Sbjct: 406 PTQNNLSQTESDLKNVANPRNVFSQRKSNDKIDKDEIIVSQPYTKEPFLKEDLSIPTSIT 465

Query: 425 -----TNNGLTQPSGNSQ--PLIHSEPIV------LKEVLEADHNKNIQEGPTTA----- 466
                +NN   Q   NSQ  P+   EPI       +  + + D N ++      A     
Sbjct: 466 KQMSLSNNETLQYPSNSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAASTSK 525

Query: 467 --VPVIQSKSTQPL------EHTEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQ 518
             V ++ ++S +PL      + ++Q + ++I S A     E  T +     N P   +  
Sbjct: 526 KDVKILAARSKKPLNDSIDMDMSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANS 585

Query: 519 ALVSNHKEKKNLKS-NSLEEPKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLG 577
              S  +EK  +        P +F+ A+Q+ KNRE  RL S  V+I  +ELTE AIN+  
Sbjct: 586 LKRSKEQEKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFS 645

Query: 578 SLVIVEPNQSLIRKKASRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTES- 636
           +L +VE N  ++  +  +        E       +W  RKNFK FVK  PKY  K   S 
Sbjct: 646 NLAVVETNVDIVISEGKK------NNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSG 699

Query: 637 --DTTDLIRNNAFLITRNYVPMKKFTGQYNNVPNXXXXXXXXXXXXXXNIENGDGDLAIP 694
                  IRN+AFL+ R YVPM++F  + NN                     G+     P
Sbjct: 700 DNGVASFIRNSAFLLAREYVPMQEF--KMNN--------------------QGNRIQEFP 737

Query: 695 PVVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFSDDE----GQSFSFRRSMA-------- 742
               ++ P     Q+  Q+ S  A +      FS D+     QSFSF R+          
Sbjct: 738 EFPVEYSP-----QQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFSRASGGDINNNVY 792

Query: 743 -NAKKTTANNGLFVVDEDDLDS 763
            +  KTT  N LFV ++DD D+
Sbjct: 793 PHITKTTKGNSLFVTEDDDDDA 814

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 137/428 (32%), Positives = 212/428 (49%), Gaps = 71/428 (16%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWE---- 56
           MWV+RYQ  LEDG+   IS C+Q S  Y+IGRS+KN L IK+DKSISRQH++LKW+    
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 57  ---DRNDIHIINQGKLTYIGEQYLDVGQSL---TFGNVNSLSIKLGTKPVMVHLEFYSSN 110
              + N + +INQGKLT I  +++ VG++      G  NS  I+LG  P+ + +E+ +  
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSG---LIPLWGFMKDIPV 167
           W IP+ L QF   L  FG++  T I    +   ++++ +   S    +  L    ++IP+
Sbjct: 121 WNIPSHLAQFRTALSQFGISTETSI---NEVPTNIMISDYPSSDDNVIRELCALAENIPL 177

Query: 168 KKPQFFSTACEILSS---NDNDFDNSWHRLQETSNT--------LFCSHYISLKDRSRLF 216
           KK Q     C  L S    D  FD  W+ + ++           L  S ++ L D     
Sbjct: 178 KKSQLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSD----- 232

Query: 217 ENYVILILFDNETNKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVK 276
               IL    NE        L + L      + DF D+N+   ++++LKP+T +++ L  
Sbjct: 233 --ITILTTISNE------PYLPSILRRFNIKLFDFVDINSLYKHVDSLKPST-KYLILTS 283

Query: 277 FGSFKSPNDQLPDLEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDVSLI-PEITYPS 335
               K  N Q+        + ++T++  D +  +I T     +  N +  +  PE     
Sbjct: 284 MN--KKENGQI----LCTTKCLLTSLIKDTLASVINTKSVSFEAPNNETPVRDPE----- 332

Query: 336 DRKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAG 395
            + ++    HHT+++               EA+ V  I+KKRRLNR+RV PLDSL FFAG
Sbjct: 333 -KLSSASKIHHTIET---------------EASPV--ILKKRRLNRRRVLPLDSLNFFAG 374

Query: 396 GASPKIGS 403
           G + K  S
Sbjct: 375 GLNVKASS 382

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 90/131 (68%), Gaps = 9/131 (6%)

Query: 538 PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRK----KA 593
           P SFVQAIQ+TK REV R+KST+VE++ DEL+E AINQL  L IVE N  L+RK    + 
Sbjct: 552 PHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRL 611

Query: 594 SRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKY--MKKDTESDT--TDLIRNNAFLI 649
           +     T  G +     +EW RRKNFK FVK +PK+   K+ +++DT  +D IR  AFLI
Sbjct: 612 NTVSSSTEKGGNG-VIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLI 670

Query: 650 TRNYVPMKKFT 660
           TRNYVP+KK++
Sbjct: 671 TRNYVPLKKYS 681

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/108 (50%), Positives = 83/108 (76%), Gaps = 2/108 (1%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWE-DRN 59
           MWVLRYQY L+DGS +KIS CI+    Y +GRS+KN LS++NDKSISRQ +S++W+ D++
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 60  DIHIINQGKLTYIGEQYLDVGQSLTFGNVNSL-SIKLGTKPVMVHLEF 106
            I + N GK+T + E+YL  G++L+F + N L ++K+GT P++V+L +
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSW 108

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 187/709 (26%), Positives = 304/709 (42%), Gaps = 117/709 (16%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           M +LRY+  L DG    +S C+   V Y IGRS+KN  +IKNDKSISRQH+SL W+  +D
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 61  -----IHIINQGKLTYIGEQYLDVGQSLTFGNVN-SLSIKLGTKPVMVHLEFYSSNWLIP 114
                I I N GK+T I ++YL   ++L F  ++  L + +GT P+   LE ++   ++ 
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPIT--LEIFNQE-VVC 117

Query: 115 NGLTQFHETLKDF---GVNVATQIPVDQKTQIDLIVDEINGSG--LIPLWGFMKDIPVKK 169
           N +     +        +N+    P+  K +   I+ + N     L+ L+  +  IP+  
Sbjct: 118 NSIEDIQNSDSKLILNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSNVFGIPI-- 175

Query: 170 PQFFSTACEILS-SNDNDFDNSWHRLQETSNT--------LFCSHYISLKDRSRLFENYV 220
                T  E+   +N NDF + W ++              L   +YIS  D+      YV
Sbjct: 176 ----VTIEELRGIANANDFYSYWDKIYSRKKNKGKACMLDLSTCYYISEVDK------YV 225

Query: 221 ILILFDNETNKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSF 280
                      D VK    +LN    I+ D  DL   KD   N+         + KF  F
Sbjct: 226 -----------DYVKVAIRSLNAEIKILKDKDDL--VKDIRKNISKGN-----ISKF--F 265

Query: 281 KSPNDQLPDLEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDVSL---IP-EITYPSD 336
              ND +   E       +T+I   K+++ + T   ++ VM+   S    IP E+  P D
Sbjct: 266 VLSND-ITQGEEAPFNISVTSIA--KLLEAVKTNNMKDIVMHDYSSFKIEIPREVKSPKD 322

Query: 337 RKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGG 396
                               N++  ++P       P  K+RR+NR +VKPLD+L+FFAGG
Sbjct: 323 -------------------DNIIEKQEP-------PAPKRRRMNRSKVKPLDTLSFFAGG 356

Query: 397 AS---------PKIGSPAVQETAQATKDESAESDKFRTNNGLTQPSGNSQPLIHSEPI-- 445
            S         P     + QET +   +   ES +   +N        S  L  S+ +  
Sbjct: 357 MSHDTHSINTKPSNDVQSHQETEKDVNNSKIESIQDVESNQDQTKYDKSTELQKSKAVSK 416

Query: 446 -VLKEVLEADHNKNIQEGPTTAVPVIQ-SKSTQPLEHTEQNKNSEIGSVAATPTPEVL-T 502
               ++ ++   K I   PTT  P    S + + +E++  N +  +        P  L T
Sbjct: 417 NADDKLQDSTAEKPINFNPTTKTPSFSPSINDKAIENSNANLDPTMEKTRVNKKPASLDT 476

Query: 503 GNGV-------ERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKS--FVQAIQETKNREV 553
            N +       E+ N      T       + +  L   + ++  S   V+ IQ  K+R V
Sbjct: 477 KNNLLDNKLIAEQINEALSAKTNDAPVVRRRRTLLDYGNTDKSSSTDLVRTIQNVKSRGV 536

Query: 554 TRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKTAREW 613
            R+ S +V +D +EL E  +N+   +V+V+ N  L++K  +  +       D +     +
Sbjct: 537 DRVNSKIVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNAQKVIDNANIDHNSN---F 593

Query: 614 SRRKNFKKFVKIYPKY---MKKDTESDTTDLIRNNAFLITRNYVPMKKF 659
             RK++K F K  PK+   + K   S T+D   N      RN +P++K+
Sbjct: 594 KNRKDYKLFKKSIPKWQSKLNKQHHSMTSDNGENLVVSKNRNKIPLRKY 642

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 131/259 (50%), Gaps = 39/259 (15%)

Query: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60
           MW++ + +D E   + K+ + +Q  V Y+IGRS K    I+ DKSISR HL +K+ D +D
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKF-DGSD 59

Query: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF 120
           + I N+GKLT   E+ + + +++   N N++ I +G  P+ V++ ++   W IP+ L + 
Sbjct: 60  LIITNKGKLTKFNEEIIPLDETIVVHNQNTV-INIGGMPIDVNVRYFYEEWKIPHRL-EL 117

Query: 121 HET---LKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTAC 177
           +ET   + DFGV ++      +KT   +  D  + SG   L+  +K +PV   +F     
Sbjct: 118 NETKSLVSDFGVKLSESF--SKKTTTQICSDSSSYSGC--LFALLKGVPVVSIEFL---- 169

Query: 178 EILSSNDNDFDNSWHRLQETSNTL-FCSHYISLKDRSRLFENY---------VILILFDN 227
                      N   +L +  N L F S Y  L +R +LF +Y         + LI+F+ 
Sbjct: 170 -----------NQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFE- 217

Query: 228 ETNKDAVKTLKTALNLGGA 246
              +    TL+  + +GG 
Sbjct: 218 ---QKMYDTLRYTIEVGGG 233

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 12/119 (10%)

Query: 541 FVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRT 600
            + AI ETK +EV RL+  ++E+D  ELTE A+        +   Q   R  AS      
Sbjct: 594 IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLAS-----I 648

Query: 601 PTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKF 659
           P    + K    W  RKNFKKF K +P Y+++ TE   +D   N +  I R Y+ M+K+
Sbjct: 649 PISNGNTK----WLGRKNFKKFKKNWPSYLRRTTEGLCSD---NTSNQIGREYITMRKY 700

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 111/439 (25%), Positives = 182/439 (41%), Gaps = 61/439 (13%)

Query: 1   MWVLR--YQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDR 58
           MWV +  YQ   + G+ Q IS  +     + +GR++K+ L I+ +K +SR HL L+  D 
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVID- 58

Query: 59  NDIHIINQGKLTYIGEQYLDVGQSLTFGNVNS-LSIKLGTKPVMVHLEFYSSNWLIPNGL 117
           + ++I+  G    +G +    G  L FG   S + +++G+  V   LE+    + +PN L
Sbjct: 59  DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTL 118

Query: 118 TQ----FHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFF 173
            Q      E +K  G+ V T         I +   E +      L+  +K IP+   +F 
Sbjct: 119 LQEDPALLEVIKGLGIRVVTSFSKATTHHI-IRPHEDDQDYEKYLFALVKGIPILHLEFL 177

Query: 174 STACEILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDA 233
                +L     DFD     +QE        HY + +  ++   +   L    N   K  
Sbjct: 178 KQFTALLRQPVTDFDPQLRSIQE-------QHY-AFRGFTKKAADLNGLHFIVN--RKHD 227

Query: 234 VKTLKTALNLGGAIVN---DFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDL 290
            + LK  L +GG  V+   D +DL+A    I       N  + L       +   ++ D 
Sbjct: 228 FEMLKYTLEIGGGTVHFCHDINDLSACLKTI-----PINGALALKYDHGISAEVKKVDDT 282

Query: 291 EY-----------FKLEDIITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKT 339
            Y           F + ++  AI  DK+ +L++  P                  P+  K 
Sbjct: 283 RYCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRP------------------PTMMKL 324

Query: 340 NIQPSHHTVDSIHNDKKNVLSNRDPGEATLVN-PIVKKRRLNRQRVKPLDSLAFFAGGAS 398
            ++P   T+      K+  LS    G  T+ + P   K R   ++ +PLDSL+FFAGG S
Sbjct: 325 -VEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLS 383

Query: 399 PKIGSPAVQETAQATKDES 417
            +  S  +  TA   K ES
Sbjct: 384 RQNSS--IGGTADLVKQES 400

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 66/121 (54%), Gaps = 14/121 (11%)

Query: 539 KSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCEC 598
           ++ V AI++ K REV R+++T+VE+  +ELTE AI QL SL IV+P   L ++       
Sbjct: 597 QNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDTVG 656

Query: 599 RTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKK 658
            +P              RKN+K F K++PKYM +    +T    RN   +  R Y+P++ 
Sbjct: 657 SSPLT----------FARKNYKNFKKVWPKYMNRKNSPET----RNATAISNRKYLPLEL 702

Query: 659 F 659
           +
Sbjct: 703 Y 703

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 142/301 (47%), Gaps = 42/301 (13%)

Query: 372 PIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDESAESDKFRTNNGLTQ 431
           P  KKRR+N   VKPLDSL+FFA G S +  +   + +++    + AE      +N + +
Sbjct: 364 PPAKKRRINS--VKPLDSLSFFA-GGSIERSTRVERNSSEKQTVQPAE------HNKIAE 414

Query: 432 PSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLE------------ 479
            S  S  L+ ++  + KE+ +      + E      P++  K   P +            
Sbjct: 415 TSIASIELLPTKSGI-KEITDV-----VPETENEPEPMVSPKKRSPAKNESLADMRAGDN 468

Query: 480 HTEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPK 539
           H       E+   +A P+ + L   G+      ++ + Q    N + K +  + S +   
Sbjct: 469 HVSIKTTLEVEK-SAEPSHKKLKVEGIFDEKV-EMSNEQKYHLNAESKDS--TLSTQSHS 524

Query: 540 SFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECR 599
           S V AI+E K REV+R+K+T+VEI  DELTE AI +L +L +VE +  ++RK  SR    
Sbjct: 525 SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE-SVDMLRKTQSR---- 579

Query: 600 TPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIR--NNAFLITRNYVPMK 657
                   +T +    R+NFK+FVK++P Y+ K    D     R  N   +  + Y PM 
Sbjct: 580 ----HMKTETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMN 635

Query: 658 K 658
           K
Sbjct: 636 K 636

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 92/201 (45%), Gaps = 8/201 (3%)

Query: 1   MWVLRYQY-DLEDGST-QKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDR 58
           MW+ + QY + +D  T   IS  I+    Y +GR++K+ L I +++ +SR HL LK  +R
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLK-ANR 58

Query: 59  NDIHIINQGKLTYIGEQYLDVGQSLTFGNVNS-LSIKLGTKPVMVHLEFYSSNWLIPNGL 117
           N I I   G    IG + ++ G S  F    S L +++G+  +   L +    + +P+ L
Sbjct: 59  NIIEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118

Query: 118 TQFHETLKDFGVNVATQIPVD-QKTQIDLIVDEINGSGLIP--LWGFMKDIPVKKPQFFS 174
              +  L    V +  +I     K     IV    G       L+  +K +P+ +  F  
Sbjct: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178

Query: 175 TACEILSSNDNDFDNSWHRLQ 195
               +L+S+   F++    L+
Sbjct: 179 GISSLLNSDTLKFESKVKELE 199

>SAKL0E10032g Chr5 complement(837606..842486) [4881 bp, 1626 aa]
           {ON} similar to uniprot|Q12275 Saccharomyces cerevisiae
           YOR093C Hypothetical ORF
          Length = 1626

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 74/180 (41%), Gaps = 31/180 (17%)

Query: 429 LTQPSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEHTEQNKNSE 488
           L+ PS +++ L+H     L   +   +N +++    T+  + Q K+   L      ++S 
Sbjct: 54  LSSPSNSAKALLHKRNHSLSSTIRTQNNPSLETQSITSSTMYQHKNASSLYRVTTVRSS- 112

Query: 489 IGSVAATPTPEVLT-----GNGVERP--------NTPQVPSTQALVSNHKEK-------- 527
             S+A+  +P +L+     G    +P        N P +P + A +   + +        
Sbjct: 113 --SLASNKSPTMLSLPLQEGASAYKPMIPLLPRSNNPAIPDSLASILRGRSQIYDRETAI 170

Query: 528 ----KNLKSNSLEEPKSFVQA---IQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLV 580
               +  K NS+   K +++A     E    ++ R+   ++  + DE+ E  I  LG  +
Sbjct: 171 ISINRRAKENSISWEKLYLKAEKVAHELTRSKLYRMNKVLLWYNKDEVIEFTIALLGCFI 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,116,154
Number of extensions: 4594359
Number of successful extensions: 14519
Number of sequences better than 10.0: 187
Number of HSP's gapped: 15176
Number of HSP's successfully gapped: 205
Length of query: 861
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 743
Effective length of database: 39,950,811
Effective search space: 29683452573
Effective search space used: 29683452573
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)