Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F033805.434ON31331316570.0
NDAI0B056705.434ON31831411711e-162
Suva_8.1735.434ON31231311441e-158
NDAI0C016005.434ON31331211441e-158
Smik_15.2985.434ON31231311391e-157
Skud_15.2835.434ON31231311181e-154
YOR120W (GCY1)5.434ON31231311111e-153
NCAS0H020605.434ON32230511121e-153
KNAG0C049105.434ON31331211021e-151
YDR368W (YPR1)5.434ON31231310951e-150
Suva_2.5405.434ON31231310921e-150
Smik_4.6345.434ON31231310881e-149
SAKL0G02530g5.434ON31231310861e-149
CAGL0A02816g5.434ON31031110771e-148
Skud_4.6375.434ON31231310661e-146
TBLA0A02825singletonON31131310491e-143
Kpol_1062.295.434ON31131110301e-140
CAGL0I01100g5.434ON31031010281e-140
TBLA0A065105.434ON31231310241e-140
KAFR0E03850singletonON3113139911e-135
TDEL0E019105.434ON3113139891e-134
KLTH0F16060g5.434ON3093099781e-133
ZYRO0F10032g5.434ON3103119601e-130
TPHA0G00210singletonON3113139441e-127
TPHA0E017605.434ON3103119251e-125
KLLA0B14707gsingletonON3103059251e-124
Kwal_47.18084na 1ON3093069241e-124
Kwal_55.214265.434ON3083099241e-124
KAFR0E038405.434ON3103129171e-123
KLTH0E15532gsingletonON3093029111e-122
KLTH0A03476gna 1ON3083048991e-121
KLTH0E00220gsingletonON3063068901e-119
KLTH0A00528gsingletonON3063068901e-119
KLLA0D10109gsingletonON3093038811e-118
TDEL0D00230singletonON3123148711e-116
TBLA0A02835singletonON3113138401e-112
AER401W5.434ON3133108261e-109
NDAI0A070003.108ON3202925142e-62
SAKL0C10626gsingletonON3223074993e-60
NCAS0I024203.108ON3202904828e-58
ZYRO0B06138g3.108ON3283164821e-57
KAFR0G013503.108ON3243114769e-57
KNAG0K020703.108ON3233154637e-55
YBR149W (ARA1)3.108ON3443104612e-54
KLTH0C10010g3.108ON3213184566e-54
TDEL0D051603.108ON3252894576e-54
Smik_2.2883.108ON3443204579e-54
Kwal_56.226113.108ON3213114551e-53
Smik_2.289singletonON3443104525e-53
Skud_2.2763.108ON3443104516e-53
KLLA0F02728g3.108ON3303104481e-52
Ecym_55085.409ON3263404471e-52
Suva_4.3983.108ON3443204463e-52
SAKL0C09922g3.108ON3223104428e-52
CAGL0I01122g5.409ON3263364314e-50
ACL107C5.409ON3543404319e-50
KNAG0B03780singletonON3263344272e-49
NCAS0A066605.409ON3263274262e-49
KLTH0F16610g5.409ON3293374262e-49
TPHA0E018605.409ON3263284192e-48
SAKL0G01914g5.409ON3293474141e-47
KLLA0E21627g5.409ON3293284123e-47
ZYRO0A06336g5.409ON3273344113e-47
NDAI0D016005.409ON3273354081e-46
TDEL0E021505.409ON3293404071e-46
KAFR0G009207.468ON2863074023e-46
TBLA0F01720singletonON3263044028e-46
YJR096W7.468ON2822853971e-45
Kwal_47.182197.468ON2932843972e-45
KAFR0C05320singletonON3273403993e-45
YHR104W (GRE3)5.409ON3273323967e-45
SAKL0F14278g7.468ON2862853928e-45
Ecym_7160na 2ON2712813882e-44
Smik_8.1825.409ON3273333922e-44
TBLA0A00630singletonON3283413923e-44
Skud_10.3187.468ON2822903883e-44
TDEL0C033207.468ON2832893867e-44
KLTH0G05786g7.468ON2862843859e-44
Skud_8.1655.409ON3273423871e-43
CAGL0C04543g7.468ON2872883841e-43
KNAG0D013707.468ON2822773832e-43
NCAS0H005607.468ON2842923805e-43
ZYRO0G17600g7.468ON2833003789e-43
Suva_12.1847.468ON2822823753e-42
KLTH0F01892gna 3ON3022763763e-42
Smik_10.3847.468ON2822893743e-42
Suva_15.3005.409ON3273343773e-42
Kwal_55.215365.409ON3293353767e-42
KLLA0F03256g7.468ON2852803711e-41
Kpol_1013.827.468ON2852793692e-41
Kwal_47.18893na 4ON2892943641e-40
SAKL0F02574gna 4ON2893133632e-40
ABL209Cna 2ON3102933642e-40
KLLA0F05775g7.285ON3093163642e-40
Kwal_33.13276na 3ON3022763615e-40
KLTH0G02420gna 4ON2893023543e-39
Kpol_1020.137.285ON3133263485e-38
CAGL0J09394g7.285ON3113013381e-36
Smik_4.1137.285ON3123143353e-36
KAFR0B012007.285ON3153053363e-36
ZYRO0E09614gna 5ON3083093345e-36
Kwal_47.19278na 5ON3143163293e-35
YDL124W7.285ON3123123285e-35
Skud_4.1317.285ON3123123242e-34
NCAS0A137407.285ON3093003214e-34
SAKL0F00704gna 5ON3153133215e-34
TBLA0F019807.285ON3023153197e-34
NDAI0A023007.285ON3133103199e-34
KNAG0C041107.285ON3113073172e-33
KLTH0G00638gna 5ON3133223145e-33
Kpol_381.8singletonON3092793092e-32
SAKL0F09746g7.285ON3123152926e-30
TDEL0D02790singletonON3293142867e-29
ZYRO0C09196g7.285ON3123202716e-27
Ecym_32647.285ON3113062472e-23
Kwal_33.13274singletonON108921641e-13
Ecym_22962.604ON3401481103e-05
Kpol_449.4singletonON3413071068e-05
Suva_4.1227.285ON2061881031e-04
Kpol_400.9singletonON3413211014e-04
Suva_12.272singletonON265207986e-04
Kwal_26.83772.604ON33882970.001
TBLA0G01120singletonON343264930.004
ABR094W2.604ON359158910.006
Kpol_2000.109singletonON342200910.006
KNAG0M023402.604ON309157900.007
TBLA0B10110singletonON345248900.009
NCAS0A129502.604ON32381870.019
TBLA0G00960singletonON321287860.022
TDEL0A08000singletonON319285860.027
TBLA0D026408.69ON212495830.079
KLTH0D08844g2.604ON34087770.34
YNL331C (AAD14)na 6ON376118760.54
ZYRO0F00858g2.604ON34690750.59
Suva_9.17singletonON308195740.75
Kwal_33.13275singletonOFF6737670.92
KAFR0D04230singletonON342322731.0
YDL243C (AAD4)singletonON329105731.1
KAFR0A053603.462ON34676731.2
Suva_14.10na 6ON376132711.7
KLTH0E16852gsingletonON375133702.3
Skud_10.383na 7ON376117702.4
Suva_10.4054.46ON916164703.4
NCAS0F04070singletonON344313683.9
TPHA0D030903.462ON34176684.9
KLLA0B09658g3.462ON342162666.9
Suva_5.2077.378ON767223677.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03380
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     642   0.0  
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   455   e-162
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   445   e-158
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   445   e-158
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   443   e-157
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   435   e-154
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   432   e-153
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     432   e-153
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   429   e-151
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   426   e-150
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   425   e-150
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   423   e-149
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   422   e-149
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   419   e-148
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   415   e-146
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     408   e-143
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   401   e-140
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   400   e-140
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   399   e-140
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     386   e-135
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   385   e-134
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   381   e-133
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   374   e-130
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 368   e-127
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   360   e-125
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   360   e-124
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   360   e-124
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   360   e-124
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   357   e-123
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   355   e-122
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   350   e-121
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   347   e-119
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   347   e-119
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   343   e-118
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   340   e-116
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     328   e-112
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   322   e-109
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   202   2e-62
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   196   3e-60
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   190   8e-58
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   190   1e-57
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   187   9e-57
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   182   7e-55
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   182   2e-54
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   180   6e-54
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   180   6e-54
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   180   9e-54
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   179   1e-53
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   178   5e-53
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   178   6e-53
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   177   1e-52
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   176   1e-52
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   176   3e-52
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   174   8e-52
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   170   4e-50
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   170   9e-50
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               169   2e-49
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             168   2e-49
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   168   2e-49
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   166   2e-48
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   164   1e-47
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   163   3e-47
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   162   3e-47
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               161   1e-46
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   161   1e-46
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   159   3e-46
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     159   8e-46
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   157   1e-45
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   157   2e-45
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   158   3e-45
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   157   7e-45
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   155   8e-45
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   154   2e-44
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   155   2e-44
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     155   3e-44
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   154   3e-44
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   153   7e-44
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   152   9e-44
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   153   1e-43
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   152   1e-43
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   152   2e-43
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   150   5e-43
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   150   9e-43
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   149   3e-42
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   149   3e-42
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   148   3e-42
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   149   3e-42
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   149   7e-42
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   147   1e-41
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   146   2e-41
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   144   1e-40
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   144   2e-40
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   144   2e-40
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   144   2e-40
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   143   5e-40
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   140   3e-39
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   138   5e-38
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   134   1e-36
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   133   3e-36
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   134   3e-36
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   133   5e-36
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   131   3e-35
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   130   5e-35
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   129   2e-34
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   128   4e-34
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   128   5e-34
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   127   7e-34
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     127   9e-34
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   126   2e-33
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   125   5e-33
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   123   2e-32
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   117   6e-30
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     114   7e-29
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   108   6e-27
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   100   2e-23
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    68   1e-13
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    47   3e-05
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    45   8e-05
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    44   1e-04
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    44   4e-04
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    42   6e-04
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    42   0.001
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    40   0.004
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    40   0.006
Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]...    40   0.006
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    39   0.007
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    39   0.009
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    38   0.019
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      38   0.022
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              38   0.027
TBLA0D02640 Chr4 (648703..655077) [6375 bp, 2124 aa] {ON} Anc_8....    37   0.079
KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} simila...    34   0.34 
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    34   0.54 
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    33   0.59 
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     33   0.75 
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    30   0.92 
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    33   1.0  
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    33   1.1  
KAFR0A05360 Chr1 complement(1056443..1057483) [1041 bp, 346 aa] ...    33   1.2  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    32   1.7  
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    32   2.3  
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    32   2.4  
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    32   3.4  
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    31   3.9  
TPHA0D03090 Chr4 (644272..645297) [1026 bp, 341 aa] {ON} Anc_3.4...    31   4.9  
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    30   6.9  
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    30   7.5  

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/313 (100%), Positives = 313/313 (100%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
           RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 301 VVDPDWSPFPLFK 313
           VVDPDWSPFPLFK
Sbjct: 301 VVDPDWSPFPLFK 313

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  455 bits (1171), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 253/314 (80%), Gaps = 6/314 (1%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65
           + S   LKL+TGA+IP+I LGTWRS+G  D Y SVIAALK GYRHIDTAAIYGNE QVGK
Sbjct: 5   QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGK 64

Query: 66  AIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKG 125
           AIRDSG+PR EIFVTSKLW  Q H+P  AL  TL RLGLDY+DLYLMHWPVTFN R++K 
Sbjct: 65  AIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKD 124

Query: 126 TD-----FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
            D     FM IP + NG  D+EMDTWNF+KTWELMQ LP +G TKAVGVSNFSINNL +L
Sbjct: 125 EDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDL 184

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L +   K+ PAANQIE+HPLL +++L+++C+EK I++EAYSP GSINAPILK+  I  I+
Sbjct: 185 LAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIA 244

Query: 241 KKLDVPPAQLIISWHVQR-GYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTL 299
           KKLD+   Q+++SWH+QR GYVVL KS HEERIIANRKV TL  EDF+AI NL KEKG L
Sbjct: 245 KKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGEL 304

Query: 300 RVVDPDWSPFPLFK 313
           RVVDPDWSPFPLFK
Sbjct: 305 RVVDPDWSPFPLFK 318

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  445 bits (1144), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 209/313 (66%), Positives = 252/313 (80%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+ TL+ ST TL LNTGA IP++ LGTW+S    D Y SV+AALK GYRHIDTAAIYGNE
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQS-KDNDAYKSVVAALKDGYRHIDTAAIYGNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           DQVG+AI+DSG+PREEIFVT+KLW TQ H PA AL  +L RLGLDY+DLYLMHWPV  + 
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDP 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K    + IP  E+G   +++  WNF+KTWELMQELP T  T+AVGVSNFSINNLK+L
Sbjct: 120 NYIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SPGN+LTPAANQ+E+HPLLP+++LI FC+ KGIM+EAYSPLGS +AP+LKEP ++EI+
Sbjct: 180 LASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK +V P  ++ISWH QRGYVVL KS + +RI  NRKVFTLS EDFEAI N++KEKG  R
Sbjct: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           VV+PDWSPF  FK
Sbjct: 300 VVNPDWSPFEAFK 312

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  445 bits (1144), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 253/312 (81%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TLK STAT KLNTGA IP + LGTW+S    +GY++V+ ALKAGYRHIDTAAIY NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           DQVGKAI DSGIPREEIFVT+KLW TQ  +P  AL  +L RLGLDY+DLYLMHWPV F  
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
            ++K  ++  +P   NG+ D+++ TWNFVKTWELMQELP TG T+AVGVSNFSINNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L+SPGNKL PAANQ+E HPLLP+ +L KFC+EKGI++EAYSPLGS NAPIL EPKIIEI+
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK +V PAQ++ISWHVQ+G+VVL KS HEERI AN + F LSK++ +++ NL+KEKG  R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 301 VVDPDWSPFPLF 312
           +V P+W+PF  F
Sbjct: 301 IVQPNWAPFVPF 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  443 bits (1139), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 253/313 (80%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+ TL  ST TL LNTGA IP++ LGTW+S    D Y SV+AALKAGY+HIDTAAIY NE
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYKHIDTAAIYRNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           DQVG+AI+DSG+PREEIFVT+KLW+TQ H PA AL ++L RLGLDY+DLYL+HWP   +T
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K  D + +P   +G   +++  WNF+KTWELMQELP TG TKA+GVSNFSINNLK+L
Sbjct: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SPGNKLTPAANQ+EIHPLLP+++LI FC+ K IMIEAYSPLGS +AP+LKEP I++I+
Sbjct: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK +V P  ++ISWH QRGYVVL KS + +RI  NRK+FTLS EDFEAI N++KEKG  R
Sbjct: 240 KKNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           VV+P+WSPF  FK
Sbjct: 300 VVNPNWSPFEAFK 312

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  435 bits (1118), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 248/313 (79%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TL+ ST TL LNTGA IP++ LGTW+S    D Y SV+AALK GYRHIDTAAIY NE
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYRHIDTAAIYRNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           DQVG+AIRDSG+PRE+IFVT+KLW TQ H PA AL  +L RLGLDY+DLYLMHWPV  + 
Sbjct: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K  + + +P  ++G   +++  WNF+KTWELMQELP TG  KAVGVSNFSINNLK+L
Sbjct: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L S GNKLTPAANQ+EIHPLLP+++LI FCR KGIMIE YSPLGS +AP+LKEP I+EI+
Sbjct: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK +V PA ++ISWH QRGYVVL KS + +R+ ANRK+FTLS EDFEAI  ++K KG  R
Sbjct: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           VV P+WSPF  FK
Sbjct: 300 VVHPNWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  432 bits (1111), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 246/313 (78%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TL  ST  L LNTGA IP+I LGTW+S    D Y +V+ ALK GYRHIDTAAIY NE
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           DQVG+AI+DSG+PREEIFVT+KLW TQ H P  AL  +L RLGLDY+DLYLMHWP   + 
Sbjct: 60  DQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDP 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K  D + +P  ++G   +++  WNF+KTWELMQELP TG TKAVGVSNFSINNLK+L
Sbjct: 120 AYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L S GNKLTPAANQ+EIHPLLP+ +LI FC+ KGI++EAYSPLGS +AP+LKEP I+EI+
Sbjct: 180 LASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK +V P  ++ISWHVQRGYVVL KS + +RI  NRK+FTLS EDFEAI N++KEKG  R
Sbjct: 240 KKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           VV P+WSPF +FK
Sbjct: 300 VVHPNWSPFEVFK 312

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  432 bits (1112), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 201/305 (65%), Positives = 244/305 (80%)

Query: 8   STATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI 67
           ST T KLNTGA I  + LGTW+S    +GY++VIAALKAGYRHIDTAAIYGNE QVGKAI
Sbjct: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76

Query: 68  RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTD 127
            DSG+PREEIFVT+KLW+TQ H+PA  L D+L RLGLDY+DLYLMHWPVT N R++K  +
Sbjct: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136

Query: 128 FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK 187
           F+ IP   +GK D+E+DTW++VKTWELMQELP TG T+AVGVSNFSINNLK++L+SPGNK
Sbjct: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196

Query: 188 LTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPP 247
           + PA NQ+EIHPLLP+ +L+++C  KGI++EAYSPLGS NAPIL EP +I ++KK  V  
Sbjct: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256

Query: 248 AQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWS 307
           AQ++ISWHVQRGY+VL KS H ERI AN K   LS E+   I N++KEKG  R+V P W 
Sbjct: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316

Query: 308 PFPLF 312
           PF  F
Sbjct: 317 PFVPF 321

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  429 bits (1102), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 246/312 (78%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+ TL  +T+ LKLNTGA I  I LGTWRS  ATD YDSVIAAL+AGYRHIDTAAIYGNE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
            +VG+AIR+SG+PR EIFVT+KLW TQ   P  AL  +L RLGLDY+DLYLMHWPV    
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
            N+   D +  P   NGK DI++  WNFVKTWELMQ+LP TG T+A+GVSNFSINNLK+L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SPGNK+ PAANQ+E+HPLLP+ +L+ FC  KGI+IEAYSPLGS +APILKEP IIEI+
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK  V  AQ++ISW+VQRGY+VL KS ++ERI AN   FTL+ EDFEA+ N++K +GT R
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 301 VVDPDWSPFPLF 312
           ++DPDW PF  F
Sbjct: 301 IIDPDWEPFKPF 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  426 bits (1095), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 247/313 (78%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TLK S+ATLKLNTGA+IP +  GTWRS+   +GY SVIAALKAGYRHID AAIY NE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           ++VG+AI+DSG+PREEIF+T+KLW T+Q +P  AL  +L RLGLDY+DLYLMHWPV   T
Sbjct: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             V   + + IP  E+G  DI+   WNF+KTWELMQELP TG TKAVGVSNFSINN+KEL
Sbjct: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SP NK+ PA NQIEIHPLLP+ +LI FC+EKGI++EAYSP GS NAP+LKE  II+++
Sbjct: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK  V PAQLIISW +QRGYVVL KS + ERI++N K+FTL ++DF+ I NL+K  GT R
Sbjct: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299

Query: 301 VVDPDWSPFPLFK 313
           VVD  W  FP+F+
Sbjct: 300 VVDMKWGSFPIFQ 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  425 bits (1092), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 202/313 (64%), Positives = 248/313 (79%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TLK S+ATLKLNTGA+IP +  GTWRS+  + GY SVIAALKAGYRHID AAIY NE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNS-GYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           ++VGKAI+DSG+PREEIF+T+KLW T+Q +P  AL  +L RLGLDY+DLYLMHWPV   T
Sbjct: 60  EEVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +   DF+ IP  E+G  D++   WNFVKTW+LMQ+LP TG TKAVGVSNFSINN+KEL
Sbjct: 120 DTITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKEL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SP NKL PA NQIEIHPLLP+ +LI FC+EKGI++EAYSP GS NAP+LKE  II+++
Sbjct: 180 LKSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK  V PAQLIISW +QRGYVVL KS + ER+++N K+FTL ++DF+ I NL+K  G  R
Sbjct: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           VV+  W+ FP+F+
Sbjct: 300 VVNMQWNSFPIFE 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  423 bits (1088), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 199/313 (63%), Positives = 250/313 (79%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TLK S+A+LKLNTGA+IP +  GTWRS+   +GY SVIAALKAGYRHID AAIY NE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           ++VG+AI+DSG+PRE+IF+T+KLW T+Q +P  AL ++L RLGLDY+DLYLMHWPV   T
Sbjct: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +   + + IP  ++G  D++   WNF+KTW+LMQELP TG TKAVGVSNFSINN+K L
Sbjct: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SP NKL PAANQIEIHPLLP+++LI FC+EKGI++EAYSP GS+NAP+L+E  II+++
Sbjct: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK  V PAQLIISW +QRGYVVL KS + ERI++N K+FTL ++DF+ I NL+K  G  R
Sbjct: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           VVD  WS FP+FK
Sbjct: 300 VVDMKWSSFPIFK 312

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  422 bits (1086), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 252/313 (80%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M++ LK S+AT+KLNTGA IP++ LGTWRS    + Y+SV++A+K GYRHID+AAIYGNE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRS-SDEEAYNSVLSAIKLGYRHIDSAAIYGNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           + VGKAIRDSG+PR E+FVT+KLW TQQ NP  AL  +L RLGLDY+DLYL+HWP+ F T
Sbjct: 60  EPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
            N+K  D++ +P  ++GK D+++  WNFVKTWEL+QELPATG  KAVGVSNFS+NNLKEL
Sbjct: 120 DNIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SPGNKL PA NQ+E+HPLLP+ +LI+F + KGI+IEAYSPLGS  +P+LKEP IIE++
Sbjct: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK  V PAQ++I+W +QRGYV+L KS + +R+ +N KVF LSKED + I  ++KE+G  R
Sbjct: 240 KKYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKR 299

Query: 301 VVDPDWSPFPLFK 313
            V PDW  FP+F+
Sbjct: 300 FVHPDWPSFPIFE 312

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  419 bits (1077), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 199/311 (63%), Positives = 242/311 (77%), Gaps = 1/311 (0%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           ++LK STATLKLNTGA IP + LGTWRS  A DGYDSV+AALK GYRHID AAIYGNEDQ
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRS-AANDGYDSVLAALKLGYRHIDAAAIYGNEDQ 59

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122
           VG+AI+DSG+PR+EIF+T+KLW T+  NPA AL  +L RLGLDY+DLYLMHWPV      
Sbjct: 60  VGRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHG 119

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182
            +  D + IPK  +GK DI+++ W+F+KTWELMQELP TG TKA+GVSNFSINNLK L  
Sbjct: 120 SEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKN 179

Query: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242
           SP     PAANQ+EIHPL P+ +LI++C+ + I+IEAYSP GS +AP+LKEP++ ++++K
Sbjct: 180 SPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEK 239

Query: 243 LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVV 302
            ++  AQLIISW VQRGYVVL KS H ERI AN KV TL  ED E I NL+K KG  R+V
Sbjct: 240 YNISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLV 299

Query: 303 DPDWSPFPLFK 313
             DWSPFP F+
Sbjct: 300 QLDWSPFPTFE 310

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  415 bits (1066), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 247/313 (78%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TL+ S+ATLKLNTGA+IP +  GTWRS+   +GY SVIAALK GYRHID AAIY NE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           ++VG+AI+DSGI REEIF+T+KLW T+Q +P  AL ++L RLGLDY+DLYLMHWPV   T
Sbjct: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             V   + + IP  E+G  D++   WNF+KTW+LMQELP TG T+AVGVSNFSINN+KEL
Sbjct: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SP NKL PA NQ+EIHPLLP+ +LI FC+EKGI++EAYSP GS NAP+LKE  II+++
Sbjct: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK  V P+QLIISW +QRGYVVL KS + ER+++N K+FTL ++DF+AI +L+K  G  R
Sbjct: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           VV+  W+ FP+F+
Sbjct: 300 VVNMKWASFPIFE 312

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  408 bits (1049), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 196/313 (62%), Positives = 236/313 (75%), Gaps = 2/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+  LK  TAT+KLNTGANIP I LGTWRS    DGYDSVIAA K GYRHIDTAAIYGNE
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSEN-NDGYDSVIAAAKVGYRHIDTAAIYGNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           DQVGKAI + G+ R E+FVT+KLW TQQ +P  AL  +L RLGLDY+DLYL+HWPV F T
Sbjct: 60  DQVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K  + + IPK ++G+ DI+   WNF+KTWELMQ L  TG TKA+G+SNFSINN+KEL
Sbjct: 120 DTIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKEL 178

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L +P   +TPA NQ+E+HPLLP+ +LI FC+EKGI+IEAYSPLG INAP+LK+  IIEI+
Sbjct: 179 LAAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIA 238

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           K+ +V   Q++ SWHVQRGYVVL KS  E RII+N K FTLS +D   I NL K KG  R
Sbjct: 239 KRNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENR 298

Query: 301 VVDPDWSPFPLFK 313
             D     FP+F+
Sbjct: 299 TCDLGIKGFPMFQ 311

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  401 bits (1030), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 236/311 (75%), Gaps = 2/311 (0%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           ++LK     +KLNTGA +P + LGTW+SL   D Y +V+ ALK GYRHID AAIY NE +
Sbjct: 1   MSLKNCETRVKLNTGAELPAVGLGTWQSL-ENDAYKAVLTALKTGYRHIDGAAIYCNEGE 59

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122
           VGKAIRDSG+PR EIFVT+KLW TQQ  P  AL+ +L RLGLDY+DLYL+HWP+  N   
Sbjct: 60  VGKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQ 119

Query: 123 VKGT-DFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181
            + + +++  P   NGK D+++DTWNFVKTWELMQELPATG  KAVGVSNFSINN+KELL
Sbjct: 120 CEESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELL 179

Query: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241
           +SPGNKL PA NQIE+HPLLP+ +L+ FC+EKGI++EAYSPLG   A ILKEP + E++K
Sbjct: 180 SSPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAK 239

Query: 242 KLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRV 301
           K ++P A L++SW VQRG VVL KS  E RII+N +  TL+ ED E I NL+KEKG  R 
Sbjct: 240 KYNIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRT 299

Query: 302 VDPDWSPFPLF 312
             PD+SPF  F
Sbjct: 300 CAPDFSPFNTF 310

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 193/310 (62%), Positives = 235/310 (75%), Gaps = 2/310 (0%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
             L  +T+TLKLNTGA+IP I LGTW+S    +GY++ + ALKAGYRHIDTAAIY NE++
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQS-SENEGYNATLEALKAGYRHIDTAAIYKNEEE 60

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122
           +G+AIRDS IPR E+FVT+KLW TQ  NP  AL  +L RLGLDY+DLYLMHWPV   T  
Sbjct: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182
           +K  + + IP+ E+G  D++++ WNFVKTWELMQELP     +A+GVSNFSINNLKELL 
Sbjct: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179

Query: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242
           S GNK+ PAANQIEIHPLLP+ +LI FC+EKGI++EAYSPLGS +APILKE +I EI+KK
Sbjct: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239

Query: 243 LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVV 302
             V   QL+ISWH QRGYVVL KS   ERI  N++ F LS EDF  + N AK+ G  RVV
Sbjct: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299

Query: 303 DPDWSPFPLF 312
            P+W PF  F
Sbjct: 300 SPNWGPFKPF 309

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 240/313 (76%), Gaps = 1/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M   LK S   + LN G  IP + LGTW+S    DGY+SVI ALKAGYRHIDTAAIY NE
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKS-QENDGYNSVIYALKAGYRHIDTAAIYRNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
            +VG+AI+DSG+PR++IF+T+KLW T+  NP  AL+ +L RLGLDY+DLYLMHWPV  N 
Sbjct: 60  GEVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNP 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
           R +K  D++V+P+  +G  D++M+TW+++KTWEL+QELPATG+T++VGVSNFSINNL+++
Sbjct: 120 RYIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKV 179

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L+SPGNKLTPA NQ+E+HPLLP+ +L K+C  K I +EAYSP GS NAP LK+  I++I+
Sbjct: 180 LSSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIA 239

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
            K  V PAQ+I SW VQR  VVL KS HEER+I+N KVF LSKED   I  LAK  G  R
Sbjct: 240 AKNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKR 299

Query: 301 VVDPDWSPFPLFK 313
           +  PDW PFP+F+
Sbjct: 300 INKPDWDPFPVFE 312

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  386 bits (991), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 245/313 (78%), Gaps = 2/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M  TL+ +T TLKLNTGA++P + LGTWR+    +GY++V +AL+AGYRHIDTAAIY NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           + VG+AIR+SGIPR+EIFVT+KLW TQ  +PA AL  +L RLGLDY+DLYLMHWPV    
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
           +  K +  +  P   +G   +E D W+F+KTWELMQELP T  T+A+GVSNFSINN+ +L
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVESD-WDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SPGNK+ PAANQ+E+HPLLP+ +L+ FC+EKGI++EAYSP GS++AP+L E  IIE++
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK DV  AQ+I+SWH++RG  VL KS H+ER+++N K F+L ++DF  I N++KEKG  R
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 301 VVDPDWSPFPLFK 313
           VV+ DWSPF +F+
Sbjct: 299 VVNFDWSPFKIFE 311

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  385 bits (989), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 233/313 (74%), Gaps = 2/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+ TL  +T+T+KLNTG  IP++ LGTWRS    DGY +V AALKAGYRHID AAIY NE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYRHIDGAAIYLNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           ++VGKAIRDSGIPREE+F+T+KLWNTQQ NP  AL+ +L RLGL+Y+DLYLMHWPV   T
Sbjct: 60  EEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
           + +   + +  P  E+GKPD++ + W+FVKTWELMQELP T   ++VGVSNFSINNLKEL
Sbjct: 120 KRITDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKEL 178

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SPGNKL PA  Q+EIHPLLP++ L  FC+E  I +EAYSPLG   AP+L +P I +I+
Sbjct: 179 LASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIA 238

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
            + +     +++SW VQRG V L KST  ER+++N + F LS E+  +I NL+K +G  R
Sbjct: 239 DRHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKR 298

Query: 301 VVDPDWSPFPLFK 313
              PD SPFPLF+
Sbjct: 299 TNAPDMSPFPLFE 311

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  381 bits (978), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 178/309 (57%), Positives = 234/309 (75%), Gaps = 2/309 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           MT  LK  TAT KLNTGA IP + LGTWRS    +GY++ +AA+KAGYRHID AA+  NE
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRST-KENGYNATLAAIKAGYRHIDIAAVCMNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
             VG+AIRDSG+PREE+FVT+KLW TQ  +P  AL  +L RLGLDY+DLY+MHWPV F +
Sbjct: 60  QVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRS 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             VK T++M+IPK ++G+PD++ + W++VKTWELMQELPATG T A+GV+NFS++ LK+L
Sbjct: 120 EQVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKL 178

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           + SPGNK+ PAA+Q+E HP LP++ ++ FC++  I++EAYSPLGS  AP+L EP + EIS
Sbjct: 179 IDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREIS 238

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KKL V PAQL++SW +QRG+ VLVKS    RI AN   F + + D   I  LA+E+GT R
Sbjct: 239 KKLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298

Query: 301 VVDPDWSPF 309
           + +P W  F
Sbjct: 299 IHNPTWFSF 307

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  374 bits (960), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 180/311 (57%), Positives = 227/311 (72%), Gaps = 2/311 (0%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           VTL+ ST+TLKLNTG  IP++ LGTWRS    +GY +VI ALKAGYRHID AA+YGNE +
Sbjct: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122
           VGKAI+DSG+PR EIF+T+KLW TQQ NP  AL  +L RLGLDY+DLYL+HWPV   T N
Sbjct: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182
           +K  +     +  +G  D++++ WNF+KTWELMQ+L  +G TKA+GVSNFS+NNLK+LL 
Sbjct: 121 IKDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179

Query: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242
           +P  K+TPA NQ+E+HPLLP+ DLIKF +E GI+IEAYSPLG  NAPIL +P + EI+K 
Sbjct: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239

Query: 243 LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVV 302
             V    ++ISW VQ+G V L KS    RI+ N KV TLS  D   +  L K KG  R  
Sbjct: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299

Query: 303 DPDWSPFPLFK 313
             D+SPFP+F+
Sbjct: 300 YQDFSPFPIFQ 310

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 226/313 (72%), Gaps = 2/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+VT K    T  +     IP ++LGTW++    + Y +V+ ALKAGYRHID AAIY NE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKA-APNEVYTAVLEALKAGYRHIDGAAIYCNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           ++VGKAIRDSGIPR++IFVT+KLW T+Q NP  AL  +L RLGLDY+DLYLMHWPV    
Sbjct: 60  EEVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKA 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
            ++   D + IPK  +GK DI+++ WNF+KTWELMQELP T   KA+GVSNFSINNL EL
Sbjct: 120 DSITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNEL 178

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L +P  K  PAANQ EIHPLLP+++LIK+C++K I++EAY PLG  N P++  P I EI+
Sbjct: 179 LAAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIA 238

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
            KL V   QL+ISW +QRGYVVL KS  +ERI+ N +  T+  E+FE + NL KE G  R
Sbjct: 239 TKLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQR 298

Query: 301 VVDPDWSPFPLFK 313
            V+ D+SPFP ++
Sbjct: 299 SVNIDFSPFPTYQ 311

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  360 bits (925), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 227/311 (72%), Gaps = 3/311 (0%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           +TL  STA + LN G  +P + LGTW+S    D Y +V+AALKAGYRHIDTAAIYGNE++
Sbjct: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYRHIDTAAIYGNEEE 59

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122
           VG+AI+DSG+ R EIFVT+KLW TQ  +P  AL  +L RLGLDY+DLYLMHWPV  N   
Sbjct: 60  VGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQ 119

Query: 123 VK-GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181
            K   +++ IP NE+G  D+++ +W+F+KTWELMQ LP + + K++GVSNFSINN+K+LL
Sbjct: 120 CKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKV-KSIGVSNFSINNIKDLL 178

Query: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241
            SPGNK  P  NQ+E+HPLLP+ +L++FC+ K I++EAYSPLGS  APIL+   I E+SK
Sbjct: 179 ASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSK 238

Query: 242 KLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRV 301
           KL +PPA ++ SW +QR  VVL KS  E RII+N +   L  E+F  + N++ E G  R 
Sbjct: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRS 298

Query: 302 VDPDWSPFPLF 312
           V P+W+PF  F
Sbjct: 299 VKPNWTPFIPF 309

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/305 (55%), Positives = 224/305 (73%), Gaps = 1/305 (0%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR 68
           + +LKLNTGA+IP + LGTW+S    D Y++V++AL+ GYRHIDTAAIYGNE+ VGK IR
Sbjct: 7   SPSLKLNTGASIPVVGLGTWKS-PEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGIR 65

Query: 69  DSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDF 128
           DSG+PREEIFVT+KLW TQQ +P  AL  +L RLGLDY+DLYL+HWPV  N  ++   ++
Sbjct: 66  DSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGNY 125

Query: 129 MVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNKL 188
           +  P+  +GK DI+++ WNF+KTWE MQ LP +G TKA+GVSNFSI N++ LL +  + +
Sbjct: 126 LTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDFI 185

Query: 189 TPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPPA 248
            PAANQIEIHP LP+ +LI +C+ KGI+IEAYSPLGS ++ IL +P I  I+ K +  PA
Sbjct: 186 VPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEPA 245

Query: 249 QLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWSP 308
            ++ISW   RGYVVL KS + +RI  N K+  LS ED E I  L +  G  R V PD+SP
Sbjct: 246 NILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFSP 305

Query: 309 FPLFK 313
           F +F+
Sbjct: 306 FAIFE 310

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/306 (55%), Positives = 224/306 (73%), Gaps = 2/306 (0%)

Query: 5   LKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG 64
           LK +T   KLNTGA IP +  GTWRS    +GY++V++A+K GYRHID+AA+YGNE  VG
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRST-EEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVG 62

Query: 65  KAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVK 124
           +AIRDSG+PREE+FVT+KLWNTQQ  PA AL  +L RLGLDY+DLYL+HWP+   T  + 
Sbjct: 63  RAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRIT 122

Query: 125 GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSP 184
             +   IP  E+GKPD++ + W+++KTW+LMQELP+TG T+AVGVSN S++ L++LL   
Sbjct: 123 DGNLFSIPTKEDGKPDVDTE-WDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADK 181

Query: 185 GNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLD 244
           GNK+ PA  Q+E HPLLP++ L+ FC +  I++EAYSPLGS  +P++ EP I EI+KK +
Sbjct: 182 GNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYN 241

Query: 245 VPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDP 304
             PAQ+IISW ++RGYVVL KS    RI +N +   L  EDFE I  L  EKG  RV DP
Sbjct: 242 ADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDP 301

Query: 305 DWSPFP 310
           +W  FP
Sbjct: 302 EWFTFP 307

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 173/309 (55%), Positives = 226/309 (73%), Gaps = 3/309 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           MT  LK  TAT  LNTGA IP + LGTWR L    GY +++AALKAGYRHID+AA+  NE
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWR-LTKEGGYKAILAALKAGYRHIDSAAVCMNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
             +GKAIRDSG+ R+E+FVT+KLW+TQ  +P+ AL  +L RLGL+Y+DLY+MHWP+ F  
Sbjct: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K  +FM+IP+N  GKP ++ D W++VKTWELMQ+LP T  T+A+GV+NFS+  L  L
Sbjct: 120 DQIKAKNFMLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSL 177

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L SP NK+ PAA+Q+E HP LP  +++ FCREKGI++EAYSPLG    P++ EP I EIS
Sbjct: 178 LKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREIS 237

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KKL V PAQL+ISW ++RG  VL KS  + RI +N +VF LS ED+E I  +A+E+G  R
Sbjct: 238 KKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKR 297

Query: 301 VVDPDWSPF 309
             +P W  F
Sbjct: 298 THNPPWFSF 306

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 231/312 (74%), Gaps = 3/312 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+  LK ST TLKLN G+ IP + LGTW++    D Y++V AAL AGYRHIDTAAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
            QVG+AIRDSG+PREEIFVT+KLWN Q H P  AL ++L RLGLDY+DLYLMHWPV+ + 
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K +   ++ + +  +P +E D W F+ TWELMQ+LP   + +++GVSNFS+NNLK+L
Sbjct: 121 SYMKESPLELMKRPDGTRP-VETD-WTFINTWELMQKLPKNKV-RSIGVSNFSVNNLKDL 177

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L +P   + P  NQ+E+HPLLP+++L+ +C++  I +EAYSPLGS +AP+L EP +I+++
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           KK  V PA +++SW VQR  +VL KS H ER+ AN K FTL +EDF+AI  +++++G  R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 301 VVDPDWSPFPLF 312
           + +P++ PF  F
Sbjct: 298 INNPNFEPFKTF 309

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 220/302 (72%), Gaps = 2/302 (0%)

Query: 8   STATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI 67
           S+A  KL TGA IP +  GTWRS    DGY++V+ ALK GYRHIDTAA+YGNE  VG+AI
Sbjct: 7   SSAVGKLRTGATIPLLGFGTWRST-EEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 68  RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTD 127
           RDSG+PR+++FVT+KLWNTQ  +P  AL  +L RLGLDY+DLYL+HWP+   T+ +   +
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 128 FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK 187
              +P  E+GKPD++ + W++VKTWE+MQ+LP T  T+AVGVSNFS+  L+ LL + G K
Sbjct: 126 LFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 188 LTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPP 247
           + PA NQ+E HPLLP+  L KFC E  I++EAYSPLGS  +P+++EP + EI+ K +  P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 248 AQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWS 307
           AQ++ISW ++RGYV+L KS    RI +N K+  L+ +DF  I N+ KEKG  R+ DPDW 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 308 PF 309
            F
Sbjct: 305 HF 306

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  350 bits (899), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 222/304 (73%), Gaps = 3/304 (0%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65
           K ST+  KLNTGA+IP + LGT+ S   T GY +V+ A+K GYRHID AA+Y NED VG+
Sbjct: 5   KPSTSVGKLNTGASIPLVGLGTYLSEDET-GYKAVLHAIKVGYRHIDCAALYKNEDFVGR 63

Query: 66  AIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKG 125
           AIRDSG+PREE+FVT+K+WNTQ   PA AL+++LSRLGLDY+DL+LMHWP    T  +  
Sbjct: 64  AIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITD 123

Query: 126 TDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPG 185
            + + +PK E+ KPD++ + WN++KTW LMQ+LPA+G TKAVGVSNFS+  L++LL  PG
Sbjct: 124 GNMITVPKREDEKPDVDTE-WNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPG 182

Query: 186 NKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDV 245
           +K+ PA NQ+E+HPLLP+  L  FC++K IM+ AYSPLGS  AP+L +P I+EI+ K   
Sbjct: 183 SKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKA 242

Query: 246 PPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPD 305
            PAQ+II W V+RGYV L KS    RI +N ++  L+  + E I  + K KG  RVVDP+
Sbjct: 243 DPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPE 301

Query: 306 WSPF 309
           W  F
Sbjct: 302 WFDF 305

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  347 bits (890), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 225/306 (73%), Gaps = 1/306 (0%)

Query: 8   STATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI 67
           +T  L++NTG  IP + LGTW++    D Y +V+AAL++GYRHIDTAAIY NE  VG+AI
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADG-DTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI 60

Query: 68  RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTD 127
           RDSG+PRE+IFVT+KLW TQQ +P  AL  +L RLGLDY+DLYLMH+PV   T  +K  +
Sbjct: 61  RDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN 120

Query: 128 FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK 187
            + IP   +G  D+++D W+FVKTW+LMQ+LP +G TKA+GVSNFSI N++E+L      
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 188 LTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPP 247
             PAANQIEIHP LP+ +LI++C+ KGI++EAYSPLGS  + +L +P +I++++K  V P
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 248 AQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWS 307
           AQ++ISW V RGY +L KS + +R+ +N K+  LS  D + I  + ++ G+ R V P W+
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 308 PFPLFK 313
           PFP+++
Sbjct: 301 PFPMYE 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  347 bits (890), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 225/306 (73%), Gaps = 1/306 (0%)

Query: 8   STATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI 67
           +T  L++NTG  IP + LGTW++    D Y +V+AAL++GYRHIDTAAIY NE  VG+AI
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADG-DTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI 60

Query: 68  RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTD 127
           RDSG+PRE+IFVT+KLW TQQ +P  AL  +L RLGLDY+DLYLMH+PV   T  +K  +
Sbjct: 61  RDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN 120

Query: 128 FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK 187
            + IP   +G  D+++D W+FVKTW+LMQ+LP +G TKA+GVSNFSI N++E+L      
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 188 LTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPP 247
             PAANQIEIHP LP+ +LI++C+ KGI++EAYSPLGS  + +L +P +I++++K  V P
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 248 AQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWS 307
           AQ++ISW V RGY +L KS + +R+ +N K+  LS  D + I  + ++ G+ R V P W+
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 308 PFPLFK 313
           PFP+++
Sbjct: 301 PFPMYE 306

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  343 bits (881), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/303 (55%), Positives = 217/303 (71%), Gaps = 3/303 (0%)

Query: 11  TLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRDS 70
           +LKLNTGA+IP++  GTW S  A D Y +VI ALK GYRHID AA+YGNE  VGK IRDS
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHA-DAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDS 68

Query: 71  GIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDFMV 130
           GIPREEIFVT+KLWNTQQ +PA AL ++L RLGLDY+DL+L+HWPV    + V G + ++
Sbjct: 69  GIPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPL--KPVGGPENLL 126

Query: 131 IPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNKLTP 190
                  KP I+ + W+F+KTWELMQ LP TG T+AVGVSNFSI NL++LL S  + L P
Sbjct: 127 KYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVP 186

Query: 191 AANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPPAQL 250
           A NQ EIHP LP+ +LI +C+ KGI++EAY PLGS ++ +L +P I EI+ K  V PA +
Sbjct: 187 AVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANV 246

Query: 251 IISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWSPFP 310
           +I+W + RGY VL KS    RI +N+    LS+ED E I  L++  G  R V PD+ P+P
Sbjct: 247 LINWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYP 306

Query: 311 LFK 313
           LF+
Sbjct: 307 LFE 309

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 168/314 (53%), Positives = 220/314 (70%), Gaps = 3/314 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           MTVT    T + KLNTGA +P I LGTW+S    D Y +V++ALKAGY+HIDTAAIY NE
Sbjct: 1   MTVT-STKTPSFKLNTGALLPAIGLGTWKS-SEEDAYTAVLSALKAGYKHIDTAAIYRNE 58

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
             VGKAIRDSGIPR+E+F+T+KLW+TQ  +P  AL  +L RLGLDY+DLYL+H+PV F T
Sbjct: 59  RAVGKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKT 118

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             ++  +    P   NGK D+++  W+FVKTW L+Q LP +G  KAVGVSNFSINNLK L
Sbjct: 119 DRIEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTL 178

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L S      PA NQ+EIHP LP+ +LI FC+ K I++EAYSPLGS  + +L +  + +I+
Sbjct: 179 LESDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIA 238

Query: 241 KK-LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTL 299
           +K  D  PAQ++I+W + RGY VL KS   +RI AN ++  + KED   + NL    G  
Sbjct: 239 EKXXDAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPK 298

Query: 300 RVVDPDWSPFPLFK 313
           R ++PDWSPFP+F+
Sbjct: 299 RYLEPDWSPFPIFE 312

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  328 bits (840), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 160/313 (51%), Positives = 218/313 (69%), Gaps = 2/313 (0%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M VTLK  T T+ LN G  IP I LGT+ S    + Y++V+ A KAGYRH+DTAA Y NE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLS-KQNEVYEAVVTAAKAGYRHVDTAAFYKNE 59

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           +QVGKA++D G+PR E++VT+K+W T+  +P  AL  +L RLGL+Y+DLYLMHWPVT  T
Sbjct: 60  EQVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKT 119

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
             +K  + M IP+  +G  D++ D W FV+ WE MQ+L  +G  K++GVSNFSINN+KEL
Sbjct: 120 DTIKDGELMCIPRLPDGNADVDKD-WTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKEL 178

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L +P   + P  NQ+E+ PLLP  +LI+FCR K I+ +AY P G   AP++K+  ++EI+
Sbjct: 179 LAAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIA 238

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           K   V   Q+I SWHVQRGYVVL KS  E RII+N K FTLS  D   + N++K +G  R
Sbjct: 239 KGNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKR 298

Query: 301 VVDPDWSPFPLFK 313
           + + ++SPFP+F+
Sbjct: 299 LNNVNFSPFPIFE 311

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  322 bits (826), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 224/310 (72%), Gaps = 2/310 (0%)

Query: 4   TLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQV 63
           TLKAST T+ LNTGA IP   LGTW+S        +V AALK GY+HIDTA+ Y NE+ V
Sbjct: 6   TLKASTDTVTLNTGAKIPLFGLGTWQSTDDDA-SSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 64  GKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNV 123
           GKA+++SGIPREE+F+T+K+WN QQ +PAGAL  +L +LG +Y+DL LMHWPV F     
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183
              D   +P+  +GK   + + W+FVKTW LMQ+L  TG  KA+GVSNFSINNL+ELL +
Sbjct: 125 STLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNA 183

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
            G  + PA NQ+E+H  LP+ +L+++C++KGI++EAYSPLGS +AP+LK+  + ++++K 
Sbjct: 184 EGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY 243

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVD 303
            V PA +++++   RG VVL KS  E RII+N + F + +ED + + ++ K++G  R VD
Sbjct: 244 GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVD 303

Query: 304 PDWSPFPLFK 313
           PD+SPFPLF+
Sbjct: 304 PDFSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  202 bits (514), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 170/292 (58%), Gaps = 15/292 (5%)

Query: 12  LKLNTGANIPEISLGTWRSLGATDGY----DSVIAALKAGYRHIDTAAIYGNEDQVGKAI 67
             LN G  IP I LGT       D Y    ++V AA++AGYRHIDTA  Y  E  +G+A+
Sbjct: 11  FNLNNGTRIPAIGLGT---ASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQAL 67

Query: 68  RD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNV 123
           ++    + I REE+F+T+K+W T  +NP+ ++  +L  LG+DY+DL L HWPV F     
Sbjct: 68  KELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVEN 127

Query: 124 KGTDFMVIPKNENGKPDIEMDT-WNFV-KTWELMQELPATGMTKAVGVSNFSINNLKELL 181
              + + +P++++G    E D  W F  K  E +   P     +A+GVSN+ I  L+ L 
Sbjct: 128 SQGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLF 187

Query: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241
                K+TPA NQ+E+HP LP+ +L KFC +  I++ AYSPLGS  AP LK   + +++K
Sbjct: 188 KE--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAK 245

Query: 242 KLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           K  V PA ++ S+H+ +G VVL +S + +RI AN     L+ +D   +  + 
Sbjct: 246 KYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVG 297

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  196 bits (499), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 183/307 (59%), Gaps = 14/307 (4%)

Query: 6   KASTATLKLNTGANIPEISLGTW---RSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           +A+     LNTGA IP + LGT      +  T   D+V  A+K GYR IDTA +YG+E  
Sbjct: 5   RATEIYFNLNTGAKIPSLGLGTVNPPEKMPQTK--DAVKHAVKNGYRLIDTAWMYGSEPY 62

Query: 63  VGKAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           +G+A+++      + RE++F+T+K+W    +    +L+++L +L LDY+DL L HWP+ F
Sbjct: 63  IGEALQELFEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCF 122

Query: 119 NTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQEL--PATGMTKAVGVSNFSINN 176
             +  +       P +      +  +  +++ TW+ ++++    +G  + +GVSN+ +  
Sbjct: 123 VKQYDEHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEY 182

Query: 177 LKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKI 236
           L+ LL     ++ P  NQ+E+HPLLP+ +L ++C   GI++E++SPLGS   P L+ P +
Sbjct: 183 LERLLKE--TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLV 240

Query: 237 IEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEK 296
            E+SKK D  P  +++++HV++G VV+ +S +  RII N     LS+ED + +  L +EK
Sbjct: 241 KELSKKYDCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREK 300

Query: 297 GTLRVVD 303
             +RV+D
Sbjct: 301 -PVRVMD 306

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  190 bits (482), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 104/290 (35%), Positives = 174/290 (60%), Gaps = 11/290 (3%)

Query: 12  LKLNTGANIPEISLGTWRSLGAT-DGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI--- 67
             LN G  IP I LGT    G   +   +V AA++AGYR IDTA  Y  E  +G+A+   
Sbjct: 11  FNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKEL 70

Query: 68  -RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGT 126
            RD  I RE++F+T+K+W     +P+ ++ ++L  LG+DY+D+ L HWP+ +     +  
Sbjct: 71  FRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKTYDENG 130

Query: 127 DFMVIPKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNFSINNLKELLTS 183
             +  P +++GK  I  +  +++ T++LM+++   P     +A+GVSN+ I  L+ ++  
Sbjct: 131 TIIGKPLDKDGKV-IFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVIKE 189

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              K+TP  NQ+E+HP LP+ +L  FC + GI++ AYSPLGS  AP  K P + E +KK 
Sbjct: 190 --CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAKKH 247

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           +V PA ++ S+HV++G VV+ +S + ER+ +N     L+K + +++ +  
Sbjct: 248 EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  190 bits (482), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 187/316 (59%), Gaps = 22/316 (6%)

Query: 6   KASTATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           K +  +  LN G  +P + LGT      +G T    +V AA+KAGYRHIDTA  YG+E  
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTK--QAVKAAVKAGYRHIDTAWAYGSEPF 65

Query: 63  VGKAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           VG+AI++      I RE+IF+TSK+W     +   +L ++L  LG+DY+DL+L HWP+ +
Sbjct: 66  VGEAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCY 125

Query: 119 ----NTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSN 171
               +T  + G      P+  NG+P  E+D  ++++T+  M+++   P+    +++GVSN
Sbjct: 126 VKQEDTHGING--LARNPETPNGEPYYEVDG-DWLETYVQMEKIYLDPSDNRVRSIGVSN 182

Query: 172 FSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPIL 231
           F +  L+  L     K  PA NQ+E+HP LP+ +L KFCR   I++EAYSPLGS NAP +
Sbjct: 183 FPVQYLERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNV 240

Query: 232 KEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKN 291
               + ++++K  + P+ ++ S+H+++G  V+ +S +  RI +N +   L++E+ + +  
Sbjct: 241 HLQLVQDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQ 300

Query: 292 LAKEKGTLRVVDPDWS 307
           L   K   R V+  W+
Sbjct: 301 LGITKPK-RFVNEKWN 315

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  187 bits (476), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 181/311 (58%), Gaps = 19/311 (6%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSLGAT-DGYDSVIAALKAGYRHIDTAAIYGNEDQVG 64
           K++    KLN G  IP +  GT+       +   +V AA+KAGYRHIDTA +Y +E  VG
Sbjct: 5   KSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVG 64

Query: 65  KAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF-- 118
           +AI++      + R ++FVT+K+W     N   +L ++L  LGLDY+DL L HWP+ F  
Sbjct: 65  EAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPR 124

Query: 119 ---NTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNF 172
                  V G   +  P+++ GKP +  +  +F++T+  ++++   P     +A+GVSN+
Sbjct: 125 VEDEKNGVNG--LVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSNY 181

Query: 173 SINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILK 232
           +I  L+ L      K+ P  NQ+EIHP LP+ +L KFC   GI++ AYSPLGS  AP LK
Sbjct: 182 AIEYLEALFKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLK 239

Query: 233 EPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNL 292
            P + ++++K D+    ++IS+H+++G  V+ +S +  RI +  +    ++E+ + + N+
Sbjct: 240 IPLVHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNV 299

Query: 293 AKEKGTLRVVD 303
             E+   R VD
Sbjct: 300 GIEEPA-RFVD 309

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  182 bits (463), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 107/315 (33%), Positives = 179/315 (56%), Gaps = 19/315 (6%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSL-GATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG 64
           K++    KLN G N+P + LGT        +   +V AA+KAGYRHIDTA  YG E  +G
Sbjct: 5   KSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIG 64

Query: 65  KAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF-- 118
            A+++      + R ++F+TSK+W     +   +L ++L  LGLDY+DLYL HWP+ F  
Sbjct: 65  DALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQK 124

Query: 119 ---NTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNF 172
              +   V G     I K+ N    + ++  +++ T++ M+++   P     +A+GVSN+
Sbjct: 125 IEDSKDGVNGLKGKPIDKDGNA---LIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNY 181

Query: 173 SINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILK 232
            +  L  LL     K  PA NQ+E+HP LP+ +L +FC    I + AYSPLGS  AP+LK
Sbjct: 182 PVEYLDRLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLK 239

Query: 233 EPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNL 292
            P + E+S+K  V    ++IS+H+++G  V+ +S +  R+       TL++ + + + ++
Sbjct: 240 LPLVKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDI 299

Query: 293 AKEKGTLRVVDPDWS 307
            + K ++R +D  ++
Sbjct: 300 GR-KDSIRYIDGSFA 313

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  182 bits (461), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 183/310 (59%), Gaps = 18/310 (5%)

Query: 6   KASTATLKLNTGANIPEISLGT---WRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           K +     LN G  IP + LGT      L  T    +V AA+KAGYRHIDTA  Y  E  
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETK--QAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 63  VGKAIR----DSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           VG+AI+    D  I RE++F+T+K+W         +L ++L  LGL+Y+DL L HWP+ F
Sbjct: 77  VGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCF 136

Query: 119 N-TRNVKGTDFMV-IPKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNFS 173
              ++ KG   +V  P +++GK     D  ++++T++ ++++   P     +A+GVSNFS
Sbjct: 137 EKIKDPKGISGLVKTPVDDSGKTMYAADG-DYLETYKQLEKIYLDPNDHRVRAIGVSNFS 195

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
           I  L+ L+     ++ P  NQ+E HP LP+ +L KFC    I++ AYSPLGS  AP LK 
Sbjct: 196 IEYLERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKI 253

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           P + ++++K +V    L+IS+H+++G +V+ +S +  RI ++ +  +L+K++ + + +  
Sbjct: 254 PLVKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFG 313

Query: 294 KEKGTLRVVD 303
            EK  +R +D
Sbjct: 314 -EKYPVRFID 322

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  180 bits (456), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 181/318 (56%), Gaps = 14/318 (4%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSLGAT-DGYDSVIAALKAGYRHIDTAAIYGNEDQVG 64
           K +     LN G  +P I LGT   +        +V AA+K+GYRHIDTA  Y  ED+VG
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 65  KAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           +A+++      + RE+IFVT+K+W T       ++  +L  LGLD++DL L HWP+ FN 
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 121 -RNVKGTDFMVI-PKNENGKPDIEMDTWNFVKTWELMQEL--PATGMTKAVGVSNFSINN 176
             +  G D +   P +E+G P    +  ++++T++ +++L        +A+GVSN+ +  
Sbjct: 125 LEDPDGIDGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEY 183

Query: 177 LKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKI 236
           L+ LL     ++ PA NQ+E HP LP+ +L  FC +  I +EAYSPLG+ NAP++    +
Sbjct: 184 LERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELV 241

Query: 237 IEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEK 296
            +I+ K       ++I++H+++G V + +S + + I +N +   LSKED + +     E 
Sbjct: 242 KKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVE- 300

Query: 297 GTLRVVD-PDWSPFPLFK 313
            T R+VD P  +  P F+
Sbjct: 301 NTKRIVDEPFAAAIPGFR 318

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  180 bits (457), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 171/289 (59%), Gaps = 17/289 (5%)

Query: 6   KASTATLKLNTGANIPEISLGTW---RSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           K++  +  LN G  +P I LGT      L  T    +V AA+KAGYR+IDTA  YG+E  
Sbjct: 5   KSTEISFLLNNGVRMPAIGLGTANPPEKLAETK--QAVKAAVKAGYRNIDTAWAYGSEPF 62

Query: 63  VGKAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           VG+AI++      I RE++F+TSK+W     +   +L+++L  LG+DY+DL+L HWP+ +
Sbjct: 63  VGEAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCY 122

Query: 119 NTR-NVKGTDFMVI-PKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNFS 173
           N R +  G + +   P+  +G PD   +  +++ T++ M+ +   P     +A+GVSNF 
Sbjct: 123 NRREDPHGINGLARNPEKADGSPDFN-EKADWLDTYKQMERIYSNPKDNRVRAIGVSNFP 181

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
           +  LK +L      + P  NQ+E+HP LP+ +L +FC +  I + AYSPLGS  AP++K 
Sbjct: 182 VEYLKRVLKE--CPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKH 239

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLS 282
           P I E+S+K       ++ S+H+++G  V+ +S +  RI +N +   LS
Sbjct: 240 PLIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLS 288

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  180 bits (457), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 114/320 (35%), Positives = 185/320 (57%), Gaps = 19/320 (5%)

Query: 6   KASTATLKLNTGANIPEISLGT---WRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           K +     LN G  IP + LGT      L  T    +V AA+KAGYRHIDTA  Y  E  
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETK--QAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 63  VGKAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           VG+AI++      I RE++F+T+K+W         +L ++L  LGLDY+DL L HWP+ F
Sbjct: 77  VGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICF 136

Query: 119 N-TRNVKG-TDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATG---MTKAVGVSNFS 173
              ++ +G + +M +P +++GK  +     ++++T++ ++++         +A+GVSNFS
Sbjct: 137 GKVKDPEGISGYMKLPVDDSGK-TVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFS 195

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
           I  L+ L+     K+ P  NQ+E HP LP+ +L KFC    I++ AYSPLGS  AP LK 
Sbjct: 196 IEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKI 253

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           P + ++ +K +V    L+IS+H+++G +V+ +S +  RI +N +   L+K++ + +    
Sbjct: 254 PLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFG 313

Query: 294 KEKGTLRVVD-PDWSPFPLF 312
            EK  +R +D P  +  P F
Sbjct: 314 -EKYPVRFMDVPSVAILPGF 332

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  179 bits (455), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 182/311 (58%), Gaps = 13/311 (4%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSLGAT-DGYDSVIAALKAGYRHIDTAAIYGNEDQVG 64
           K +     LN G  +P + LGT   +        +V AA+K+GYRHIDTA  Y  ED++G
Sbjct: 5   KNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIG 64

Query: 65  KAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           +A+++      I RE+IF+T+K+W T       ++  +L  LG+DY+DL L HWP+ FN 
Sbjct: 65  EALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNR 124

Query: 121 -RNVKGTDFMVI-PKNENGKPDIEMDTWNFVKTWELMQE--LPATGMTKAVGVSNFSINN 176
            ++ +G D +   P +E+G P    +  ++++T++ +++  L      +++GVSN+ +  
Sbjct: 125 LQDPEGIDGICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEY 183

Query: 177 LKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKI 236
           L+ LL     K+ PA NQ+E+HP LP+ +L  FC +  I +EA+SP G+  +P++K   +
Sbjct: 184 LERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELV 241

Query: 237 IEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEK 296
            ++++K    P  ++I++H+++G V + +S + + I +N +   LSKED + +     E 
Sbjct: 242 QKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGVEN 301

Query: 297 GTLRVVDPDWS 307
              R+VD +++
Sbjct: 302 PK-RLVDEEFA 311

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  178 bits (452), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 179/310 (57%), Gaps = 18/310 (5%)

Query: 6   KASTATLKLNTGANIPEISLGT---WRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           K +     LN G  IP + LGT      L  T    +V AA+KAGYRHIDTA  Y  E  
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETK--QAVKAAIKAGYRHIDTAWAYRTEPF 76

Query: 63  VGKAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           VG+AI++      I RE++F+T+K+W         +L ++L  LGLDY+DL L HWP+ F
Sbjct: 77  VGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCF 136

Query: 119 N-TRNVKGTDFMV-IPKNENGKPDIEMDTWNFVKTWELMQELPATG---MTKAVGVSNFS 173
              ++ KG   +V  P +++GK  +     ++++T++ ++++         +A+GVSNFS
Sbjct: 137 EKVKDPKGISGLVKTPVDDSGK-TVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFS 195

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
           I  L+ L+     K+ P  NQ+E HP LP+ +L KFC    I++ AYSPLGS  AP LK 
Sbjct: 196 IEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKI 253

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           P + ++ +K +V    L+IS+H+++G +V+ +S +  RI +N +   L+K++ + +    
Sbjct: 254 PLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFG 313

Query: 294 KEKGTLRVVD 303
            EK  +R +D
Sbjct: 314 -EKYPVRFID 322

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  178 bits (451), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 182/310 (58%), Gaps = 18/310 (5%)

Query: 6   KASTATLKLNTGANIPEISLGT---WRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           K +     LN G  IP + LGT      L  T    +V AA+KAGYRHIDTA  Y  E  
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETK--QAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 63  VGKAIR----DSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           VG+AI+    D  I RE++F+T+K+W         +L ++L  LGLDY+DL+L HWP+ F
Sbjct: 77  VGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCF 136

Query: 119 N-TRNVKGTDFMV-IPKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNFS 173
              ++ KG   +V  P +++GK  +     ++++T++ ++++   P     +A+GVSNFS
Sbjct: 137 EKVKDPKGLSGLVKTPVDDSGK-TMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFS 195

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
           I  L+ L+     ++ P  NQ+E HP LP+  + KFC    I++ AYSPLGS  AP LK 
Sbjct: 196 IEYLERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKI 253

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           P + ++++K ++    ++IS+H+++G +V+ +S +  RI ++ +   L+K++ + + +  
Sbjct: 254 PLVKKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFG 313

Query: 294 KEKGTLRVVD 303
            EK  +R +D
Sbjct: 314 -EKYPVRFID 322

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  177 bits (448), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 179/310 (57%), Gaps = 13/310 (4%)

Query: 14  LNTGANIPEISLGTW-RSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD--- 69
            N G  +P   LGT  +     +   +V AA+KAGYRHIDTA  YG E+ VG+A+++   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 70  -SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPV-TFNTRNVKGTD 127
              + RE++ +TSK+W+T  ++   +L ++L+RL +DY+DL+L HWP+ T    +  G D
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHGVD 132

Query: 128 FMVI-PKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNFSINNLKELLTS 183
            +   P ++ G P +  +  ++++T++ ++++         +A+GVSNF I  LK +L  
Sbjct: 133 KIAKEPVDDQGNP-LYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLKE 191

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              +  PA NQ+E+HP LP+ +L +FC E  I++ AYSPLG   AP+L+ P +  + +K 
Sbjct: 192 --CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEKY 249

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVD 303
           +  P  ++ S+H+++G +V+ +S +  RI +N +   LS+ED   +    ++     +  
Sbjct: 250 NASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKRYING 309

Query: 304 PDWSPFPLFK 313
              S  P FK
Sbjct: 310 AVSSVIPGFK 319

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  176 bits (447), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 177/340 (52%), Gaps = 50/340 (14%)

Query: 7   ASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG-- 64
           A T T  LN G  +P + LG W+ L A      V  A+K GYR  D A  YGNE ++G  
Sbjct: 2   ADTRTYTLNNGMKMPVVGLGCWK-LSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVG 60

Query: 65  --KAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
             +AI +  + RE++F+ SKLW    H  +   AL+ TL+ LGLDY+DLY +H+P+    
Sbjct: 61  IKQAINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIK- 119

Query: 121 RNVKGTDFMVIPKNENGKPDI---EMDTWN---------FVKTWELMQELPATGMTKAVG 168
                     +P  E   P++   E D  N          + T+  M++L   G+ K++G
Sbjct: 120 ---------YVPLEEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLG 170

Query: 169 VSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSIN- 227
           +SNF    +++LL   G ++ P A Q+E+HP L +  L+ + + K I + AYS  G ++ 
Sbjct: 171 LSNFQACLIQDLLR--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSF 228

Query: 228 -----------APILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIAN- 275
                       P+L+   ++ I+KK DV P+Q+I+ W  QRG  V+ KS+ +ER++ N 
Sbjct: 229 LELGNSAAKDVTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNL 288

Query: 276 --RKVFTLSKEDFEAIKNLAKEKGTLRVVDP-DWSPFPLF 312
              K  TLS  +   I +L K    LR +DP DW+  P F
Sbjct: 289 NSDKALTLSDSEMSDIFSLNK---NLRFLDPWDWARLPGF 325

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  176 bits (446), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 187/320 (58%), Gaps = 19/320 (5%)

Query: 6   KASTATLKLNTGANIPEISLGT---WRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           K +     LN G  +P + LGT      L  T    +V AA+KAGYRHIDTA  Y  E  
Sbjct: 19  KTTEIYFTLNNGVRVPALGLGTANPHEKLAETK--QAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 63  VGKAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
           VG+AI++      I RE++F+T+K+W         +L ++L  +GLDY+DL+L HWP+ F
Sbjct: 77  VGEAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCF 136

Query: 119 N-TRNVKGTDFMV-IPKNENGKPDIEMDTWNFVKTWELMQEL---PATGMTKAVGVSNFS 173
              ++ KG   +V  P +++G+  +  +  ++++T++ ++++   P     +A+GVSNFS
Sbjct: 137 EKVKDPKGISGLVKTPVHKSGEAMLASNG-DWMETYKQLEKIYLDPNDHRVRAIGVSNFS 195

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
           I  L+ L+     ++ P  NQ+E HP LP+ +L KFC    I++ AYSPLGS  AP LK 
Sbjct: 196 IEYLERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKI 253

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           P + ++ +K +V    ++IS+H+++G +V+ +S +  RI ++ +   L+K++ + + +  
Sbjct: 254 PLVKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFG 313

Query: 294 KEKGTLRVVD-PDWSPFPLF 312
            EK  +R +D P  +  P F
Sbjct: 314 -EKYPVRFIDEPFAASLPEF 332

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  174 bits (442), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 171/310 (55%), Gaps = 18/310 (5%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSLGATDGY----DSVIAALKAGYRHIDTAAIYGNED 61
           KA+     LN G  IP + LGT       D +    ++V AA+KAG+R IDTA  YG E+
Sbjct: 5   KATEIYFNLNNGTRIPAVGLGT---ANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEE 61

Query: 62  QVGKAIRD----SGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVT 117
            +G+A+++      + RE++F+T+K+W         +L ++L RL LDY+DL L HWP  
Sbjct: 62  YIGEALQELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFC 121

Query: 118 F-NTRNVKGTDFMV-IPKNENGKP--DIEMDTWNFVKTWELMQELPATGMTKAVGVSNFS 173
           F   ++ +G+  +V  P++E+G P  D   D     K  E +         +A+GVSN+ 
Sbjct: 122 FVKKQDPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYP 181

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
           I  L+ L      K  PA NQ+E+HP LP+ +L  +C + GI++ +YSPLGS  AP L+ 
Sbjct: 182 IEYLERLFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRI 239

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLA 293
           P + E++ K +     +++S+H+++G +V+ +S + ERI        L+KE+ + +    
Sbjct: 240 PLVQELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYG 299

Query: 294 KEKGTLRVVD 303
            E    R +D
Sbjct: 300 VEH-EYRYID 308

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  170 bits (431), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 116/336 (34%), Positives = 179/336 (53%), Gaps = 44/336 (13%)

Query: 9   TATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65
           ++ + LN G  +P + LG W+    + A   YD    A+K GYR  D A  YGNE +VG+
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYD----AIKIGYRLFDGAEDYGNEKEVGQ 57

Query: 66  AIR---DSGI-PREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
            IR   D G+  RE++FV SKLWN+  H  +   ALK TLS +GLDYLDL+ +H+P+ F 
Sbjct: 58  GIRKAIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFK 117

Query: 120 TRNVKGTDFMVIPKNENGKPD-----IEMDTWNFVKTWELMQELPATGMTKAVGVSNFSI 174
               +       P    GK D     I       + T+  +++    G+ K++G+SNFS 
Sbjct: 118 YVPFEEK---YPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSG 174

Query: 175 NNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----SINAP 229
           + +++LL     K+ P A Q+E HP L +  L+++C++ GI + AYS  G      +N P
Sbjct: 175 SLVQDLLRQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHP 232

Query: 230 ILK-------EPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---F 279
           + K          I +I+   +V  +Q+++ W  QRG  ++ KS+ +ER+  N  +    
Sbjct: 233 LAKNTPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKL 292

Query: 280 TLSKEDFEAIKNLAKEKGTLRVVDP-DW--SPFPLF 312
           TL+ ++ EAI  L K    LR+ DP DW    FP+F
Sbjct: 293 TLTHKELEAISKLNK---NLRLNDPWDWLDGKFPIF 325

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  170 bits (431), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 182/340 (53%), Gaps = 40/340 (11%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           + +  +  T+KLN GA++P + LG W+ +      + V  A+K GYR +D A  Y NE +
Sbjct: 24  IAMVMNVRTIKLNNGADMPLVGLGCWK-IPNEVAAEQVYEAIKLGYRLLDGAEDYANERE 82

Query: 63  VGKAIR---DSG-IPREEIFVTSKLWNTQQHNP---AGALKDTLSRLGLDYLDLYLMHWP 115
           VG+ IR   D G + REE+FV SKLWN   H P     AL+ TLS LGLDYLDL+ +H+P
Sbjct: 83  VGQGIRRAIDEGLVRREELFVVSKLWNNY-HRPEDVGKALQRTLSDLGLDYLDLFYIHFP 141

Query: 116 VTF-----NTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVS 170
           + F       R   G  +      + G+  +  +    ++T+  +++L   G  +A+G+S
Sbjct: 142 LAFKFVPLEERYPAGL-YTGAADEQAGR--LAQEPVPLIETYRALEQLVDEGRIRAIGLS 198

Query: 171 NFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSIN--- 227
           NF    +++LL   G ++ PAA QIE HP L +  L+++ + +G+ +  YS LG  +   
Sbjct: 199 NFQGCLVQDLLR--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLE 256

Query: 228 ---------APILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV 278
                    AP+L+   +  I+++    PA++++ W  QR   V+ KS+ +ER+  N +V
Sbjct: 257 LGNTAAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRV 316

Query: 279 ---FTLSKEDFEAIKNLAKEKGTLRVVDP-DWS--PFPLF 312
               TL+ ++   + +L      LR  DP DWS  P P F
Sbjct: 317 DEALTLADDELRELSSL---NCGLRFNDPWDWSAQPLPTF 353

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  169 bits (427), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 174/334 (52%), Gaps = 40/334 (11%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR 68
           + T+ LN G  +P + LG W+ +      + V  A+K GYR  D A  YGNE QVG  IR
Sbjct: 2   SETVTLNNGLTMPLVGLGCWK-ISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIR 60

Query: 69  ---DSGI-PREEIFVTSKLWNTQQHNPAG---ALKDTLSRLGLDYLDLYLMHWP-----V 116
              D GI  RE++FV SKLWNT  H+P     AL+ TL  + L+YLDLY +H+P     V
Sbjct: 61  RAIDEGIVKREDLFVVSKLWNTY-HDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFV 119

Query: 117 TFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINN 176
            F  R   G         +  K  +  +    + T+  M+EL   G+TK++G+SN++   
Sbjct: 120 PFEERYPPG---FYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGAL 176

Query: 177 LKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSIN--------- 227
           +++ L   G ++ P   QIE HP L +  L+++C+  GI + AYS  G  +         
Sbjct: 177 VQDTLR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLA 234

Query: 228 ---APILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FTL 281
               P+   P I +I+++  V  +Q+I+ W  QRG  V+ KS H+ R++ N ++    TL
Sbjct: 235 KHTPPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTL 294

Query: 282 SKEDFEAIKNLAKEKGTLRVVDP-DW--SPFPLF 312
           + +D E I +L K    LR  D  DW  S FP F
Sbjct: 295 TPKDLEEISSLNK---NLRFNDTWDWTISKFPSF 325

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 174/327 (53%), Gaps = 32/327 (9%)

Query: 12  LKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR--- 68
           L LN G  +P++ LG W+ +      D V  A+KAGYR  D A  Y NE +VGK ++   
Sbjct: 5   LTLNNGMKMPQVGLGCWK-IPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAM 63

Query: 69  DSGI-PREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFN--TRNV 123
           D GI  R+++FV SKLWN   H  +    LK  L  LGLDYLDLY +H+P+ F       
Sbjct: 64  DDGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEE 123

Query: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183
           +    M   K +  K  +  +    + T+  ++E    G+ K++G+SNF+   + ++L  
Sbjct: 124 RYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILR- 182

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSIN------------APIL 231
            G  + P A QIE HP L +  L+++C+   + +  YS  G  +             P+ 
Sbjct: 183 -GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLF 241

Query: 232 KEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FTLSKEDFEA 288
             P I +I++K +V  A++++ W  QRG  ++ KS+H++R+++N  +    TL++ED ++
Sbjct: 242 DHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLKS 301

Query: 289 IKNLAKEKGTLRVVDP-DW--SPFPLF 312
           I  L +    LR  DP DW  S FP+F
Sbjct: 302 ISGLNQ---NLRFNDPWDWNNSKFPIF 325

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/337 (35%), Positives = 185/337 (54%), Gaps = 46/337 (13%)

Query: 9   TATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65
           + T+KLN G  +P + LG W+    + A+  Y+    A+K GYR  D A  YGNE +VG+
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYE----AIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 66  AIR---DSGI-PREEIFVTSKLWNTQQHNPAG---ALKDTLSRLGLDYLDLYLMHWP--- 115
            IR   D GI  RE++FV SKLWN+  H+P     ALK TL  LGL+YLDL+ +H+P   
Sbjct: 61  GIRKAIDEGIVKREDLFVVSKLWNSY-HDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAF 119

Query: 116 --VTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFS 173
             V F  R   G  F    ++E  K  I ++    + T+  +++    G+ KA+GVSNF 
Sbjct: 120 KFVPFEERYPPG--FYTGAEDEK-KGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFR 176

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG--------- 224
              L +LL   G K+ PA  QIE HP L +  L+++C+++GI + AYS  G         
Sbjct: 177 GILLHDLLA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDS 234

Query: 225 --SINAPILKEPKII-EISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--- 278
             + + P L E  ++ +++    V  +++++ W  QR   ++ KS+ +ER++ N ++   
Sbjct: 235 QLAKSTPTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEK 294

Query: 279 FTLSKEDFEAIKNLAKEKGTLRVVDP-DW--SPFPLF 312
            TLS E+ + I +L K+   +R  DP +W    FP+F
Sbjct: 295 LTLSDEELQEISSLNKD---IRFNDPFNWLDMKFPVF 328

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  166 bits (419), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 114/328 (34%), Positives = 176/328 (53%), Gaps = 34/328 (10%)

Query: 12  LKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG----KAI 67
           + LN G  +P + LG W+    T     V  A+K GYR  D A  YGNE +VG    +AI
Sbjct: 5   ITLNNGLKMPIVGLGCWKIPNDTCA-AQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQAI 63

Query: 68  RDSGIPREEIFVTSKLWNTQQHNPAG---ALKDTLSRLGLDYLDLYLMHWPVTFNT--RN 122
            +  + REE+FV SKLWN+  H+P     AL+ TLS + LDYLDLY +H+P+ F      
Sbjct: 64  SEGIVKREELFVISKLWNSY-HDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPFE 122

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182
            K        K +  K  I  +    + T+  M++L   G+ K++G+SNF+   +++LL 
Sbjct: 123 EKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLLR 182

Query: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----------SINAPIL 231
           S   K+ P   QIE HP L +  LI++C+   I + AYS  G           +++A +L
Sbjct: 183 S--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKVL 240

Query: 232 KEPKIIE-ISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FTLSKEDFE 287
            E ++I+ I+    V P+Q+++ W  QRG  ++ KS+ +ER++ N  +    TLS+++  
Sbjct: 241 FEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQELS 300

Query: 288 AIKNLAKEKGTLRVVDP-DWS--PFPLF 312
            I +L      LR  DP DW+   FP+F
Sbjct: 301 TISDL---NIGLRFNDPWDWNNMKFPIF 325

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  164 bits (414), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 176/347 (50%), Gaps = 58/347 (16%)

Query: 5   LKASTATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNED 61
           + A + T+ LN G  +P I LG W+    + A+  Y+    A+K GYR  D A  YGNE 
Sbjct: 1   MSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYE----AIKLGYRLFDGAQDYGNEK 56

Query: 62  QVG----KAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWP 115
           +VG    KAI +  + RE++FV SKLWN+  H  N   ALK TL  +GLDYLDL+ +H+P
Sbjct: 57  EVGQGIKKAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFP 116

Query: 116 VTFNTRNVKGTDFMVIPKNENGKPD------------IEMDTWNFVKTWELMQELPATGM 163
           + F            +P  E   P             I  +    + T+  +++    G+
Sbjct: 117 LAFK----------FVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGL 166

Query: 164 TKAVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPL 223
            K++G+SNF+ + +++LL   G ++ P A QIE HP L + +L+K+C+  GI + AYS  
Sbjct: 167 IKSIGISNFNGSLVQDLLR--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSF 224

Query: 224 G------------SINAPILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEER 271
           G                 + +   +  I+    V  +Q+++ W  QRG  V+ KS+ +ER
Sbjct: 225 GPQSFIELDSELAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKER 284

Query: 272 IIANRKV---FTLSKEDFEAIKNLAKEKGTLRVVDP-DW--SPFPLF 312
           ++ N  +    TLS ++ +AI  L K+   +R  DP  W  S FP F
Sbjct: 285 LLENLTINDSLTLSDKELKAISALNKD---IRFNDPWTWLNSEFPTF 328

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  163 bits (412), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/328 (33%), Positives = 173/328 (52%), Gaps = 32/328 (9%)

Query: 11  TLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG----KA 66
           T+ LN G  +P + LG W+        D +  A+K GYR  D A  Y NE +VG    +A
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCA-DQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRA 65

Query: 67  IRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNT--RN 122
           I++  + RE++ V SKLWN+  H  N   AL+ TLS L LDY+D++ +H+P+ F     +
Sbjct: 66  IKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFD 125

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182
            K        K +  K  IE +    + TW  +++L   G  K++G+SNFS   +++LL 
Sbjct: 126 EKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLLR 185

Query: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----------SINAPIL 231
             G ++ P A QIE HP L +  LIK+ +  GI + AYS  G           ++N P L
Sbjct: 186 --GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTL 243

Query: 232 KEPKIIE-ISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FTLSKEDFE 287
            E   I+ I+ K  V P Q+++ W  Q G  ++ KS+ +ER++ N ++    TL+ ++ +
Sbjct: 244 FEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDELK 303

Query: 288 AIKNLAKEKGTLRVVDP-DW--SPFPLF 312
            I  L +    +R  DP +W  + FP F
Sbjct: 304 QISGLNQ---NIRFNDPWEWLDNEFPTF 328

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  162 bits (411), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 112/334 (33%), Positives = 173/334 (51%), Gaps = 39/334 (11%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG---- 64
            + + LN G  +P + LG W+    T     +  A+  GYR  D A  YGNE +VG    
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCS-QQIYDAISVGYRVFDGAQDYGNEKEVGEGVR 60

Query: 65  KAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122
           +AI+D  + REE+FV SKLWN+  H  N   ALK TLS +GLDYLDL+ +H+P+     +
Sbjct: 61  RAIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVS 120

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWN-----FVKTWELMQELPATGMTKAVGVSNFSINNL 177
            +       P    G+ D +    +      + T+  ++E    G+ K++GVSNFS + +
Sbjct: 121 FEEK---YPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIM 177

Query: 178 KELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG------------S 225
            +LL   G ++ PAA QIE+HP L +   +K+ + KGI + AYS  G             
Sbjct: 178 LDLLR--GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAK 235

Query: 226 INAPILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FTLS 282
              P+ +   + +I+ K +V  +Q+++ W  Q+   V+ KS+ +ER+  N  V    TL+
Sbjct: 236 ATPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLT 295

Query: 283 KEDFEAIKNLAKEKGTLRVVDP-DWS---PFPLF 312
            ++ + I  L K    LR  DP  WS   PFP+F
Sbjct: 296 GDEIKEISGLNK---NLRFNDPFTWSEKTPFPIF 326

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  161 bits (408), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/335 (32%), Positives = 176/335 (52%), Gaps = 39/335 (11%)

Query: 9   TATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65
           +A + LN G  +P + LG W+   S  A   YD    A+K GYR  D A  YGNE +VG+
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYD----AIKVGYRLFDGATDYGNEKEVGQ 57

Query: 66  AIR---DSG-IPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
            I+   D G + RE++F+ SKLWN   H  +    L+  L  LGLDY+DLY +H+P+ F 
Sbjct: 58  GIKRAIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFK 117

Query: 120 --TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNL 177
             + + +    M   K +  K  +  +    + T+  M++L   G+ K++G+SN++   +
Sbjct: 118 FVSPDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLV 177

Query: 178 KELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSIN---------- 227
            + L   G ++ P A QIE HP L +  L+++C+   + + AYS  G  +          
Sbjct: 178 ADTLR--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAK 235

Query: 228 --APILKEPKIIEISKKLD-VPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FTL 281
              P+   P I +I+ K + V  +Q+++ W  QRG  ++ KS+ +ER++ N  +    TL
Sbjct: 236 NTPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTL 295

Query: 282 SKEDFEAIKNLAKEKGTLRVVDP-DW--SPFPLFK 313
           ++ED   I  L +    LR  DP DW  S FP+F+
Sbjct: 296 AEEDLREISALNQ---NLRFNDPWDWNNSKFPIFQ 327

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  161 bits (407), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 177/340 (52%), Gaps = 49/340 (14%)

Query: 9   TATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65
           +  + LN G  +P + LG W+    + A+  Y+    A+K GYR  D A  YGNE +VG+
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYE----AIKIGYRLFDGAQDYGNEKEVGQ 57

Query: 66  AIR---DSGI-PREEIFVTSKLWNTQQHNPA---GALKDTLSRLGLDYLDLYLMHWPVTF 118
            IR   D GI  REE+FV SKLWN+  H+P     AL+ TL  + LDYLDL+ +H+P+  
Sbjct: 58  GIRKAIDEGIVKREELFVVSKLWNSF-HDPKNVKAALQRTLDDMKLDYLDLFYIHFPIAL 116

Query: 119 NTRNVKGTDFMVIPKNENGKPDIEMDTWN-----FVKTWELMQELPATGMTKAVGVSNFS 173
                K       P    G  D +  T +      + T+  +++L   G+ K++G+SNFS
Sbjct: 117 KFVPFKEK---YPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFS 173

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG--------- 224
            + + +LL   G ++ P A QIE HP L +  L+ + + +G+ + AYS  G         
Sbjct: 174 GSIIMDLLR--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGS 231

Query: 225 ---SINAPILKEPKIIEISKKL--DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV- 278
                  P+ + PKIIEI+K    ++ P+Q+++ W  Q    V+ KS+ +ER+  N  + 
Sbjct: 232 DLAKTTPPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHID 291

Query: 279 --FTLSKEDFEAIKNLAKEKGTLRVVDP----DWSPFPLF 312
              TL+ ++ + I  L K    +R  DP    D +PFP+F
Sbjct: 292 DKLTLTDQELKEISALNK---NIRFNDPYTWNDKNPFPIF 328

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  159 bits (402), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 160/307 (52%), Gaps = 45/307 (14%)

Query: 11  TLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI--- 67
           T KL++   IP ++LGT+  L +++  + V  AL  GYRH DTA +Y NE++V + I   
Sbjct: 8   TYKLSSNYYIPTVALGTY-DLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNW 66

Query: 68  --RDSGIPREEIFVTSKLWNTQ--QHNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNTRN 122
             R     R+EIF T+KLWN+Q    N   A+++ + ++  L Y+DL LMH P+      
Sbjct: 67  LIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------ 120

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182
                         G P I  +TW        MQE    G+ K++GVSNF I +LKEL  
Sbjct: 121 --------------GGPQIREETWR------AMQEAVDEGIVKSIGVSNFGIKHLKELFQ 160

Query: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242
             G K  P  NQIEI P L   +L  FC+ +G+++EAY+PL   +   +  P +I+IS +
Sbjct: 161 WDGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL--THGYKINHPDLIKISNE 218

Query: 243 LDVPP--AQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300
           L+      Q++I W +Q GYV L K+    R+ +N  V+     DFE  ++  K      
Sbjct: 219 LNNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVY-----DFELTEDQMKFLDHPE 273

Query: 301 VVDP-DW 306
             +P DW
Sbjct: 274 AYEPTDW 280

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  159 bits (402), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 160/304 (52%), Gaps = 26/304 (8%)

Query: 14  LNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR----D 69
           LN G  +P + LG W+ +  T   + V  A+K GYR  D A  YGNE +VG+ IR    +
Sbjct: 7   LNNGLKMPMVGLGCWK-IPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 70  SGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNV--KG 125
             + R ++F+ SKLWNT  H  +   A+K TLS LGLDYLDLY +H+P+ F    +  K 
Sbjct: 66  KIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPIEEKY 125

Query: 126 TDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPG 185
                  K +  +  I +    ++ T+  M+ L   G+ K++GVSN     L+++L   G
Sbjct: 126 PPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVLM--G 183

Query: 186 NKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSIN----APILKE-------- 233
            K+ P   QIE HP L +  L+ +C+ + I++ AYS  G  +       LKE        
Sbjct: 184 CKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPNLFDH 243

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FTLSKEDFEAIK 290
           P I  I+ K +V  +++++ W  Q G  V+ KS+ +ER++ N  +    TLS E+   I 
Sbjct: 244 PVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEELVEIS 303

Query: 291 NLAK 294
           N+ +
Sbjct: 304 NINR 307

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  157 bits (397), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 148/285 (51%), Gaps = 44/285 (15%)

Query: 13  KLNTGANIPEISLGTW---RSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI-- 67
           KL+ G  IP I+LGT+   RS  A   Y+ V    K GYRH DTA +YGNE +VG  I  
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGV----KCGYRHFDTAVLYGNEKEVGDGIIK 62

Query: 68  ---RDSG-IPREEIFVTSKLWNTQQ--HNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNT 120
               D G   REEIF T+KLWN+Q        A++  L+ + GL Y+DL L+H P+    
Sbjct: 63  WLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL---- 118

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
                         E  K  +E        TW  MQE    G+ K++GVSN+   ++ EL
Sbjct: 119 --------------EGSKLRLE--------TWRAMQEAVDEGLVKSIGVSNYGKKHIDEL 156

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240
           L  P  K  P  NQIEI P +   +L  +C+ KG+++EA++PL   +   +  P ++++ 
Sbjct: 157 LNWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVC 214

Query: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKED 285
           K++D  P Q++I W +Q GY+ L K+   +R+  N   +     D
Sbjct: 215 KEVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSD 259

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  157 bits (397), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 154/284 (54%), Gaps = 43/284 (15%)

Query: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD--- 69
           KL++G  +P I LGT+  +   +  + V  ALK+GYRH+DTA +YGNE +VG+ I+    
Sbjct: 18  KLSSGYILPSIGLGTY-DIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLE 76

Query: 70  ---SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLG-LDYLDLYLMHWPVTFNTRNV 123
                  R+++F T+KLWN+Q    N   A+K+ + ++  L Y+DL L+H P++   R +
Sbjct: 77  EDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRL 136

Query: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183
           +                          T++ MQE    G+ +++GVSN+  +++ ELLT 
Sbjct: 137 E--------------------------TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTW 170

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              K  P  NQIEI P +   DL  +C+ KG+++EA+SPL   +   LK P ++ ++K+ 
Sbjct: 171 KELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKET 228

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFE 287
                +++I W +Q GYV L KS   ER+  N K +     DFE
Sbjct: 229 GTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY-----DFE 267

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  158 bits (399), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/340 (32%), Positives = 176/340 (51%), Gaps = 53/340 (15%)

Query: 10  ATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR- 68
           + + LN G  +P + LG W+ +      + V  A+K GYR  D A  YGNE +VG+ I+ 
Sbjct: 3   SLVTLNNGQKMPLVGLGCWK-ISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKK 61

Query: 69  --DSG-IPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNV 123
             D G + R ++FV SKLWN+  H  +   ALK  L  LGLDY+DLY +H+P+ F     
Sbjct: 62  AIDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFK---- 117

Query: 124 KGTDFMVIPKNENGKPDIEMDTWN------------FVKTWELMQELPATGMTKAVGVSN 171
                  +P  E   P       +             + T+  ++E    G+ K++G+SN
Sbjct: 118 ------FVPFEEKYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISN 171

Query: 172 FSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----SI 226
           F+   +++LL   G ++ P A QIE HP L +  L+++C+ KGI + AYS  G      +
Sbjct: 172 FNGVLVQDLLN--GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIEL 229

Query: 227 NAPILKE-PKIIE--ISKKLDVP-----PAQLIISWHVQRGYVVLVKSTHEERIIANRKV 278
           ++ + K  P ++E  I KK+        P+++++ W  QRG  V+ KST +ER++ N  V
Sbjct: 230 DSQLAKSTPSLLEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNV 289

Query: 279 ---FTLSKEDFEAIKNLAKEKGTLRVVDP-DW--SPFPLF 312
               TL++E+   I +L K    +R  DP +W  S FP F
Sbjct: 290 EDSITLTEEELNEISSLNK---NIRFNDPWEWLNSKFPTF 326

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  157 bits (396), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 109/332 (32%), Positives = 173/332 (52%), Gaps = 35/332 (10%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG---- 64
           ++ + LN G  +P + LG W+ +      + +  A+K GYR  D A  YGNE +VG    
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWK-IDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIR 60

Query: 65  KAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNT-- 120
           KAI +  + R++IFV SKLWN   H  +   ALK TLS +GLDYLDLY +H+P+ F    
Sbjct: 61  KAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVP 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
              K         ++  K  I       + T+  ++E    G+ K++GVSNF  + +++L
Sbjct: 121 FEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDL 180

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----------SINAP 229
           L   G ++ P A QIE HP L +  L++FC+   I + AYS  G           +   P
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 230 ILKEPKII-EISKKL-DVPPAQLIISWHVQRGYVVLVKSTHEERIIAN---RKVFTLSKE 284
            L E  +I ++S+       +Q+++ W  QRG  V+ KS+ +ER++ N    K FTL+++
Sbjct: 239 TLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 285 DFEAIKNLAKEKGTLRVVDPDWS----PFPLF 312
           +   +K+++     +R  DP W+     FP F
Sbjct: 299 E---LKDISALNANIRFNDP-WTWLDGKFPTF 326

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  155 bits (392), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 154/285 (54%), Gaps = 38/285 (13%)

Query: 6   KASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65
           KA     KL++G  +P I LGT+  L +    + V  ALK GYRH+DTA +YGNE +VG+
Sbjct: 4   KAIPKAYKLSSGYTLPSIGLGTY-DLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGE 62

Query: 66  AI------RDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRL-GLDYLDLYLMHWPV 116
            I        S   RE++F  +KLWN+Q   +N   A+++   ++ GL Y+DL L+H P+
Sbjct: 63  GILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL 122

Query: 117 TFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINN 176
           + + + ++                          T++ MQE    G+ +++GVSN+ +++
Sbjct: 123 SGSRKRLE--------------------------TYKAMQEAVDKGIVRSIGVSNYGVHH 156

Query: 177 LKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKI 236
           + ELL     K  P  NQIEI P L   +L  +C+ +G+++EAY+PL   +   +  P +
Sbjct: 157 IDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNV 214

Query: 237 IEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTL 281
           + ++K+      Q++I W +Q GYV L K+   +R+ +N  V+ +
Sbjct: 215 LRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  154 bits (388), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 145/281 (51%), Gaps = 38/281 (13%)

Query: 11  TLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD- 69
           T  L  G  +P + LG + S+        V  ALK GYRH DTA  YGNE +VG+ I   
Sbjct: 5   TYTLTNGCLMPSLGLGCY-SIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAW 63

Query: 70  -----SGIPREEIFVTSKLWNTQQHNPAG--ALKDTLSRLG-LDYLDLYLMHWPVTFNTR 121
                S   R+++F  +KLWN+Q        A++  L ++  L Y+DL L+H P   + +
Sbjct: 64  LAEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAK 123

Query: 122 NVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181
            +                           T+E MQE    G+ K++GVSN+  ++L+EL 
Sbjct: 124 RLA--------------------------TYEAMQESVDAGIVKSIGVSNYERHHLQELY 157

Query: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241
             P  K  P  NQIE+ P LP +DL+ +C+  G+ I+AYSPLG  +   + +P I  ++ 
Sbjct: 158 AMPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLAT 215

Query: 242 KLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLS 282
           + +  PAQ++I+W + +GY  L K+ + +R+ +N   + +S
Sbjct: 216 QKNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVS 256

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  155 bits (392), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/333 (32%), Positives = 171/333 (51%), Gaps = 37/333 (11%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR 68
           ++ + LN G  +P + LG W+ +      + +  A+K GYR  D A  YGNE +VG+ IR
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWK-IDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIR 60

Query: 69  ----DSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNT-- 120
               +  + R+++FV SKLWN   H  +   ALK TL+ +GLDYLDLY +H+P+ F    
Sbjct: 61  RAISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVP 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
              K         ++  K  I       + T+  ++E    G+ K++G+SNF  + +++L
Sbjct: 121 FEEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDL 180

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----------SINAP 229
           L   G ++ P A QIE HP L +  L++FCR   I + AYS  G           +   P
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 230 ILKEPKIIEISKKLDVP---PAQLIISWHVQRGYVVLVKSTHEERIIAN---RKVFTLSK 283
            L E  +I+    L+ P    +Q+++ W  QRG  V+ KS+ +ER++ N    K FTL++
Sbjct: 239 TLFENDVIK-KISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTE 297

Query: 284 EDFEAIKNLAKEKGTLRVVDPDWS----PFPLF 312
           ++ + I  L      +R  DP W+     FP F
Sbjct: 298 QELKEISAL---NANIRFNDP-WTWLDGKFPTF 326

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  155 bits (392), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 109/341 (31%), Positives = 173/341 (50%), Gaps = 64/341 (18%)

Query: 9   TATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG- 64
           TA + LN G  +P + LG W+    + A+  Y+    A+K GYR  D AA YGNE +VG 
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYE----AIKLGYRLFDGAADYGNEKEVGQ 57

Query: 65  ---KAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
              KA+ +  + R ++F+ SKLWNT  H  +   AL+ TLS LGLDYLDLY +H+P+ F 
Sbjct: 58  GINKALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFK 117

Query: 120 TRNVKGTDFMVIPKNENGKP------------DIEMDTWNFVKTWELMQELPATGMTKAV 167
                      +P  E   P             I +    ++ T+  M++L   G+TK++
Sbjct: 118 ----------YVPFEEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSI 167

Query: 168 GVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGS-- 225
           GVSN   + L+++L   G ++ PAA QIE HP L +  L++FC+ + I + +YS  G   
Sbjct: 168 GVSNLQGSILQDVLM--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQS 225

Query: 226 ---------------INAPILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEE 270
                           + P++K+   I  +   DV  +++++ W  QR   ++ KS+ +E
Sbjct: 226 FLELGSKRAEDTPALFDHPVIKK---IAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKE 282

Query: 271 RIIANRKV---FTLSKEDFEAIKNLAKEKGTLRVVDP-DWS 307
           R++ N  V    TL++ +   I  L K    +R  D  DW+
Sbjct: 283 RLLLNLNVNEKLTLTEAELLEISALNK---NIRFNDTWDWN 320

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  154 bits (388), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 150/290 (51%), Gaps = 43/290 (14%)

Query: 14  LNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI------ 67
           L+ G  IP I+LGT+  +  +   + V   +K GYRH DTA +YGNE +VG  I      
Sbjct: 8   LSNGYRIPSIALGTY-DIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 68  RDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNTRNVK 124
                 RE+IF T+KLWN+Q        A++  L+ + GL Y+DL L+H P+        
Sbjct: 67  NPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 125 GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSP 184
                     E  K  +E        TW+ MQE    G+ K++GVSN+   ++ ELLT P
Sbjct: 119 ----------EGSKLRLE--------TWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWP 160

Query: 185 GNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLD 244
                P  NQIEI P +   +L  +C+ KG+++EA++PL   +   +  P ++++ K++D
Sbjct: 161 DLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCKEVD 218

Query: 245 VPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAK 294
             P Q++I W +Q GY+ L K+   +R+  N     L+  DFE +    K
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGN-----LAAYDFELLDKQMK 263

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  153 bits (386), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 163/289 (56%), Gaps = 40/289 (13%)

Query: 14  LNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD---- 69
           L+ G  IP ++LGT+  L  +   + V  ALK GYRH DTA +Y NE +VG+ I      
Sbjct: 9   LSNGVKIPSLALGTY-DLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQE 67

Query: 70  --SGIPREEIFVTSKLWNTQQ-HNPA-GALKDTLSRL-GLDYLDLYLMHWPVTFNTRNVK 124
                 RE++F T+KLWN+Q  + PA  A+K+ L ++  L Y+DL L+H P++ + + ++
Sbjct: 68  DPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRLE 127

Query: 125 GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSP 184
                                     T++ MQE    G+ K++GVSN+  ++L+ELL+  
Sbjct: 128 --------------------------TYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWE 161

Query: 185 GNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLD 244
           G K  P  NQIEI P     +L ++C+ +GI++E Y+PL   +   LK+P+++++++++ 
Sbjct: 162 GLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEEVG 219

Query: 245 VPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAIKN 291
               Q++I W +Q GY+ L K+++ +R+  N  V  F L++   +A ++
Sbjct: 220 KNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAFEH 268

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  152 bits (385), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 153/284 (53%), Gaps = 43/284 (15%)

Query: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD--- 69
           KL++G  +P + LGT+  +   +  + V  ALKAGYRH+DTA +YGNE +VG+ +     
Sbjct: 11  KLSSGYVLPSLGLGTY-DIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLK 69

Query: 70  ---SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLG-LDYLDLYLMHWPVTFNTRNV 123
                  R ++F T+KLWN+Q    N   A+++ L ++  L Y+D+ L+H P++   R +
Sbjct: 70  EDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRRL 129

Query: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183
           +                          T++ MQE    G+ +++GVSN+  +++ ELL  
Sbjct: 130 E--------------------------TYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAW 163

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              K  P  NQIEI P +   DL  +C+ KG+++EA+SPL   +   +K P ++ +++++
Sbjct: 164 EELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEEV 221

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFE 287
                Q++I W +Q GYV L KS   ER+  N +V+     DFE
Sbjct: 222 GRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY-----DFE 260

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  153 bits (387), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/342 (30%), Positives = 173/342 (50%), Gaps = 55/342 (16%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG---- 64
           ++ + LN G  +P + LG W+ +      + +  A+K GYR  D A  YGNE +VG    
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWK-IDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIR 60

Query: 65  KAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122
           KAI +  + R+++FV SKLWN   H  +   ALK TLS +GLDYLDLY +H+P+ F    
Sbjct: 61  KAIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFK--- 117

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWN------------FVKTWELMQELPATGMTKAVGVS 170
                   IP  E   P     T +             + T+  +++    G+ K++G+S
Sbjct: 118 -------YIPFEEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGIS 170

Query: 171 NFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----S 225
           NF  + +++LL   G ++ P A QIE HP L +  L++FC+   I + AYS  G      
Sbjct: 171 NFQGSLVQDLLR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIE 228

Query: 226 INAPILKEPKII---EISKKLD-----VPPAQLIISWHVQRGYVVLVKSTHEERIIAN-- 275
           ++  + K  + +   ++ KK+         +Q+++ W  QRG  V+ KS+ +ER++ N  
Sbjct: 229 MDLQLAKATQTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLE 288

Query: 276 -RKVFTLSKEDFEAIKNLAKEKGTLRVVDPDWS----PFPLF 312
             K F+L++++ + I  L      +R  DP W+     FP F
Sbjct: 289 IEKKFSLTEQELKKISAL---NANIRFNDP-WTWLDGKFPTF 326

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  152 bits (384), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 155/288 (53%), Gaps = 39/288 (13%)

Query: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60
           M+VT+       +L  G  IP ++LGT+    +      V  ALK GYRH DTA +YGNE
Sbjct: 1   MSVTVDVPK-YYELQDGRKIPSLALGTYDIPNSVTA-KVVTEALKCGYRHFDTAVLYGNE 58

Query: 61  DQVGKAIRD------SGIPREEIFVTSKLWNTQQ-HNPAG-ALKDTLSRL-GLDYLDLYL 111
            +VG+ I +      +   RE++F T+KLWN+Q  +N A  A+K+ + ++ GL Y+D+ L
Sbjct: 59  REVGQGIVNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLL 118

Query: 112 MHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSN 171
           +H P++   R ++                          TW+ MQE    G+ K++GVSN
Sbjct: 119 IHSPLSGQRRRLE--------------------------TWKAMQEAVDEGIVKSIGVSN 152

Query: 172 FSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPIL 231
           +  ++++ELL     K  P  NQIEI P +   +L  +C+   +++EAY+P+   +   +
Sbjct: 153 YGKHHIEELLGWDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMA--HGYKM 210

Query: 232 KEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVF 279
            +P + EISK+  + P QL+I W +Q GY+ L K+    R+ +N  V+
Sbjct: 211 NDPGLREISKETGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  152 bits (383), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 148/277 (53%), Gaps = 37/277 (13%)

Query: 11  TLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI--- 67
           + KL +G NIP I LGT+  L  ++    V AAL+ GYRH+DTA +YGNE +V +     
Sbjct: 6   SYKLASGFNIPTIGLGTY-DLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNF 64

Query: 68  --RDSGIPREEIFVTSKLWNTQ--QHNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNTRN 122
             R   + RE+IF T+KLWN+Q        A+++ +  + GL Y+DL LMH P+    + 
Sbjct: 65  LGRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPI--GGKQ 122

Query: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182
           V+                          TW+ MQE    G+ +++GVS++   +L++L  
Sbjct: 123 VR------------------------RGTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFE 158

Query: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242
               K  PA NQIEI P +    L  +C+ KGI++EAYSPL   +   L +P +++++++
Sbjct: 159 WSELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEE 216

Query: 243 LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVF 279
               P Q+++ W +Q GYV L K+    R+  N  VF
Sbjct: 217 TGKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF 253

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  150 bits (380), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 153/292 (52%), Gaps = 46/292 (15%)

Query: 14  LNTGANIPEISLGTW---RSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD- 69
            N G  IP I+LGT+   +S+ A   Y+    ALKAGYRH DTA +YGNE QVG+ I   
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYE----ALKAGYRHFDTAVLYGNEHQVGEGILQW 65

Query: 70  -----SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNTR 121
                    R ++F T+KLWN+Q   H    A+K+ L+++ GL Y+D+ L+H P+   T+
Sbjct: 66  IQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTK 125

Query: 122 NVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181
            ++                          TW  MQE   +G+ K +GVSN+   +++ELL
Sbjct: 126 RLE--------------------------TWRAMQEAVESGLVKNIGVSNYGRQHVEELL 159

Query: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241
                 + P  NQIEI P +   +L  +C+  G+++EA++PL   +   L +  ++ +SK
Sbjct: 160 QWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSK 217

Query: 242 KLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAIKN 291
           ++     Q++I W +Q GY+ L K+   +R+  N +   F L+ E  + I +
Sbjct: 218 EVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  150 bits (378), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 158/300 (52%), Gaps = 44/300 (14%)

Query: 17  GANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD------S 70
           G  IP ++LG +  +  +   + V  ALK GYRH DTA +YGNE +VG+ I        +
Sbjct: 12  GIKIPSLALGCY-DIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPA 70

Query: 71  GIPREEIFVTSKLWNTQQ-HNPAG-ALKDTLSRLG-LDYLDLYLMHWPVTFNTRNVKGTD 127
              RE++F T+KLWN+Q  ++PA   + + ++++  L Y+DL L+H P++   R ++   
Sbjct: 71  NNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLSGPRRRLE--- 127

Query: 128 FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK 187
                                  T++ MQE    G+ K++GVSN+   +++EL      K
Sbjct: 128 -----------------------TYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKLK 164

Query: 188 LTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLDVPP 247
             P ANQIEI P     DL  +C+ KG+++EA+SPL   +   LKEP ++ ++KKL    
Sbjct: 165 HKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKKLGRDT 222

Query: 248 AQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVVDP-DW 306
            Q++I W +QRG + L K+ +  R+ +N +V+     DFE      KE       +P DW
Sbjct: 223 GQVLIRWSLQRGLLPLPKTQNPARLSSNLEVY-----DFELTPEDVKELDHPEAYEPTDW 277

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  149 bits (375), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 145/282 (51%), Gaps = 38/282 (13%)

Query: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD--- 69
           K + G  +P I+LGT+  +  +   + V   +K GYRH DTA +YGNE +VG  I     
Sbjct: 7   KFSNGYKVPSIALGTY-DIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLH 65

Query: 70  ---SGIPREEIFVTSKLWNTQQHNPAG--ALKDTLSRL-GLDYLDLYLMHWPVTFNTRNV 123
                  RE++F T+KLWN+Q        A++  L+ + GL Y+DL L+H P+       
Sbjct: 66  EDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL------- 118

Query: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183
                      E  K  +E        TW+ MQE    GM K++GVSN+   ++ ELL  
Sbjct: 119 -----------EGSKLRLE--------TWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNW 159

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              K  P  NQIEI P +   +L  +C+ K +++EA++PL   +   + +P ++++ K++
Sbjct: 160 SQLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKEV 217

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKED 285
           D  P Q++I W +Q GY+ L K+   +R+ +N   +     D
Sbjct: 218 DRNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSD 259

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  149 bits (376), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 148/276 (53%), Gaps = 36/276 (13%)

Query: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR---- 68
           KLN G  +P I  G +  +   +    V  AL+ GYRHIDTA +Y N+ Q  + +     
Sbjct: 14  KLNNGTEVPVIGFGVY-DIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLE 72

Query: 69  DSGIPREEIFVTSKLWNTQQHNPAG--ALKDTLSRLG--LDYLDLYLMHWPVTFNTRNVK 124
           ++G PREE++ T+KLWNTQQ   A   AL++  + +   + Y+DL L+H P+T   R   
Sbjct: 73  ETGTPREEVWFTTKLWNTQQGRDATPRALEEIAADVKEFIGYVDLLLLHSPLTDAQRR-- 130

Query: 125 GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMT-KAVGVSNFSINNLKELLTS 183
                             ++TW  ++    +QE  ++ +  +A+GVSNF + +L+ELL  
Sbjct: 131 ------------------LETWAVLE--RAVQEPASSALEIRAIGVSNFGVRHLQELLEV 170

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              K  P  +Q+E+HP LP  +L  F RE GI+ EAYSPL       L++P+++ +  K 
Sbjct: 171 ATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELLALEAKS 226

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVF 279
            +   ++++ W   +G+ VLVKS + +RI  N  V 
Sbjct: 227 GLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVL 262

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  148 bits (374), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 148/289 (51%), Gaps = 39/289 (13%)

Query: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD--- 69
           KL+ G  IP I+LGT+  +  +   + V   +K GYRH DTA +YGNE +VG  I     
Sbjct: 7   KLSNGIKIPSIALGTY-EIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLN 65

Query: 70  ---SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNTRNV 123
                  R +IF T+KLWN+Q        A++  L+ + GL+Y+DL L+H P+       
Sbjct: 66  EDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL------- 118

Query: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183
                      E  K  +E        TW  MQE    G+ K++GVSN+   ++ ELL  
Sbjct: 119 -----------EGSKLRLE--------TWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNW 159

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              +  P  NQIEI P +   +L  +C+ KG+++EA++PL   +   +  P ++ + K++
Sbjct: 160 SELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKEV 217

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNL 292
           D  P Q++I W +Q GY+ L K+   +R+  N   ++    D E +K L
Sbjct: 218 DRNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSD-EQMKTL 265

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  149 bits (377), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 105/334 (31%), Positives = 170/334 (50%), Gaps = 39/334 (11%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG---- 64
           ++ + LN G  +P + LG W+ +      + +  A+K GYR  D A  YGNE +VG    
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWK-IDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIR 60

Query: 65  KAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLMHWPVTFNT-- 120
           KAI +  + R++IFVTSKLWN   H  +   ALK TL  +GLDYLDLY +H+P+ F    
Sbjct: 61  KAISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVP 120

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
              K          ++ +  I       + T+  ++     G+ K++G+SNF  + +++L
Sbjct: 121 FEEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDL 180

Query: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG-----------SINAP 229
           L   G ++ P A QIE HP L +  L+ +C+   I + AYS  G           + + P
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTP 238

Query: 230 ILKEPKIIEISKKLDVPP----AQLIISWHVQRGYVVLVKSTHEERIIAN---RKVFTLS 282
            L E  +++  K  +  P    +Q+++ W  QRG  V+ KS+ +ER++ N    K  TL+
Sbjct: 239 TLFENDVVK--KVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLT 296

Query: 283 KEDFEAIKNLAKEKGTLRVVDPDWS----PFPLF 312
            ++ + I +L      +R  DP W+     FP+F
Sbjct: 297 DQELKEISSL---NANIRFNDP-WTWLDGKFPIF 326

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  149 bits (376), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 107/335 (31%), Positives = 174/335 (51%), Gaps = 40/335 (11%)

Query: 8   STATLKLNTGANIPEISLGTWR---SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG 64
           ++ T+KLN G  +P + LG W+    + A+  Y+    A+K GYR  D A  YGNE +VG
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYE----AIKLGYRLFDGAQDYGNEKEVG 59

Query: 65  ----KAIRDSGIPREEIFVTSKLWNTQQHNPAG---ALKDTLSRLGLDYLDLYLMHWPVT 117
               KAI +  + RE++FV SKLWN+  H+P     ALK TL  + L+YLDL+ +H+P+ 
Sbjct: 60  QGIHKAIDEGIVKREDLFVVSKLWNSY-HDPKNVKKALKRTLEDMELEYLDLFYIHFPLA 118

Query: 118 FNT--RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSIN 175
           F       K          +  K  I ++    + T+  ++E    G+ K++G+SNF   
Sbjct: 119 FKYVPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGI 178

Query: 176 NLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLG----------- 224
            + +LL   G  + P   QIE HP L +  LI++C ++ I + AYS  G           
Sbjct: 179 LIHDLLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSEL 236

Query: 225 SINAPILKEPKIIE-ISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV---FT 280
           + + P L E + I+ I+    V  +Q+++ W  QR   ++ KS+ +ER++ N ++    T
Sbjct: 237 AKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLT 296

Query: 281 LSKEDFEAIKNLAKEKGTLRVVDP-DW--SPFPLF 312
           L++ + + I  L K+   +R  DP  W    FP+F
Sbjct: 297 LTEAELQEISALNKD---IRFNDPFTWLGMKFPVF 328

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 145/280 (51%), Gaps = 38/280 (13%)

Query: 11  TLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD- 69
           + KL++G  IP + LGT+        Y  V  AL+ GYRH DTA +YGNE +VG+ I+  
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAY-LVHQALEVGYRHFDTAVLYGNEYEVGQGIKKW 66

Query: 70  -----SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNTR 121
                +   R ++F T+KLW++Q        A+   L  +  L Y+DL L+H P+     
Sbjct: 67  LNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL----- 121

Query: 122 NVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181
                          G   + ++      T+E MQE    G  +++GVSN+   +++ELL
Sbjct: 122 ---------------GGKKLRLE------TYEAMQEAVDAGKVRSIGVSNYGFQHIEELL 160

Query: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241
                K  P  NQIEI P     +L  FC++KGI++EAY+PL   +   LK+P +++++ 
Sbjct: 161 NWEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVAN 218

Query: 242 KLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTL 281
           ++     Q +I W +Q+GY+ L K+    R+ +N  VF+ 
Sbjct: 219 EVGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  146 bits (369), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 142/279 (50%), Gaps = 38/279 (13%)

Query: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD--- 69
           KL+ G +IP + LGT+         + V  ALKAGYRH DTA +YGNE++VG+ I     
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTA-NVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLL 68

Query: 70  ---SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRL-GLDYLDLYLMHWPVTFNTRNV 123
                  RE +F T+KLWN+Q        A+K+ L ++  L+Y+DL L+H P       +
Sbjct: 69  EDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSP-------L 121

Query: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183
            GT                      ++TW+ MQE    GM K++GVSN+ ++++ ELLT 
Sbjct: 122 GGTKLR-------------------LETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTW 162

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              K  P  NQIEI P L   +L  +C+   I +E YSPL   +   L +  + +++ + 
Sbjct: 163 QYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANET 220

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLS 282
                Q++I W +Q GY+ L K+    R+  N  V+  +
Sbjct: 221 GKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFN 259

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  144 bits (364), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 153/294 (52%), Gaps = 43/294 (14%)

Query: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI- 67
           + T  L  G  IP ++LG + +    +   +V  ALK+GYRH+D A +YGNE +VG  I 
Sbjct: 6   STTKTLTNGVKIPVLALGVYEA-PKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64

Query: 68  ----RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRL----GLDYLDLYLMHWPVTFN 119
                   + R EIF T+K+ +   H    A K  +  L     ++Y+DL L+H P+   
Sbjct: 65  KFLKETPNVSRSEIFYTTKV-SGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA-- 121

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKE 179
                                    T   + TW+ +QE  A G  +A+GVSN+SI +L+E
Sbjct: 122 ------------------------ATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157

Query: 180 LLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEI 239
           L    G K+ P  NQ E++P L   +L ++C +KG+++EA+SPL         +P++ E+
Sbjct: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQEL 215

Query: 240 SKKL--DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAI 289
            K    +  PAQ++I W +Q G++ L KS++ +R I+N +   F +S +D +A+
Sbjct: 216 IKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 165/313 (52%), Gaps = 49/313 (15%)

Query: 10  ATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ----VGK 65
            T  L  G  +P + LG +++    +  + V  ALK GYR +D+A +YGNE +    + K
Sbjct: 7   TTHALKNGVKMPCLGLGLYQT-PKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITK 65

Query: 66  AIRDS-GIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLG-LDYLDLYLMHWPVTFNTR 121
            + +S  + R +IF T+K+    Q   +   +++++L+R+  LDY+DL+L+H P+T   +
Sbjct: 66  FLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEK 125

Query: 122 NVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181
                                      + TW+  QE   TG  KA+GVSN+ I +L+E+ 
Sbjct: 126 R--------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159

Query: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241
              G K+ P  NQ E++P L   +L  +C +KG++I+AYSPL    A  L++P+++++ +
Sbjct: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVE 217

Query: 242 KLDVPP----AQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAIKNLAKE 295
             D  P    AQ++++W +Q G+V LVK+ HE+R+  N K   F LS  D + + +    
Sbjct: 218 --DSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH---- 271

Query: 296 KGTLRVVDPDWSP 308
                +  P W P
Sbjct: 272 DDQYYLSQPKWDP 284

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  144 bits (364), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 149/293 (50%), Gaps = 41/293 (13%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           V  K      +L+ G  IP + LG ++ +      D V  AL+ GYR  D+A  Y NED 
Sbjct: 4   VMQKEDCHFRRLSDGTQIPSVGLGVYQ-VSEQTVQDLVYEALEVGYRLFDSAQAYHNEDG 62

Query: 63  VGKAI-----RDSGIPREEIFVTSKLWNTQQHNPAG---ALKDTLSRLG-LDYLDLYLMH 113
           V + I        G  RE+++ T+K+ NTQ H       +L+ +L   G L Y+DL L+H
Sbjct: 63  VARGIAAWLKHAPGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVH 121

Query: 114 WPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFS 173
            P++  TR +                           TW+ ++E    G  +++GVSN+ 
Sbjct: 122 APMSDRTRRLG--------------------------TWQALEEAVVEGQVRSIGVSNYG 155

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKE 233
             +L ELL   G K+ P  NQ+EI+P L   +L+++CRE  I ++A+SPL  +    L +
Sbjct: 156 QQHLSELLGWEGLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDD 213

Query: 234 PKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKE 284
           P + +++ + D   AQ+++ W +Q G++VL K+  +ER+  N  +  F LS E
Sbjct: 214 PILQKVAHQYDKGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAE 266

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  144 bits (364), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/316 (32%), Positives = 163/316 (51%), Gaps = 58/316 (18%)

Query: 14  LNTGANIPEISL---GT-WRSLGATDG------YDSVIAALKA--GYRHIDTAAIYGNED 61
           L+ G  IP +++   GT W     TD        D V   L    G  HID A IY    
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTYP 68

Query: 62  QVGKAIRDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
           ++G A++D+  PR+EIF+T K    +Q   NP  AL+ +L +LG+DY+DLYL+H P+   
Sbjct: 69  ELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPII-- 126

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKE 179
                          +  K D+E +       W+ ++EL  +G  K +GVSNF++ +L++
Sbjct: 127 ---------------KESKLDVEAN-------WKYLEELYKSGKAKNIGVSNFAVKDLEK 164

Query: 180 LLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSPLGSINAPILKEPK-- 235
           LL     ++ P  NQIE  P L      +++F ++ GI++EAYSPLG    P+ + P+  
Sbjct: 165 LLAVA--EVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLG----PLQRRPEDA 218

Query: 236 --------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKED 285
                   I E+SKK +   AQ+++SW  +RG + +  S+  ERI   + +  F+L+ E+
Sbjct: 219 DKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEE 278

Query: 286 FEAIKNLAKEKGTLRV 301
            + I  L  +   LR+
Sbjct: 279 VQKITQLGLQHPALRL 294

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  143 bits (361), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 150/276 (54%), Gaps = 36/276 (13%)

Query: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIR---- 68
           KLN G  IP I  G +  +   D  D V +ALK GYRHIDTA +Y N+ +  + +R    
Sbjct: 14  KLNNGQQIPVIGFGVY-EIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLD 72

Query: 69  DSGIPREEIFVTSKLWNTQ--QHNPAGALKDTLSRLG--LDYLDLYLMHWPVTFNTRNVK 124
           ++G  RE I+ T+KLW++Q  +     AL++  + +   + Y+DL L+H P         
Sbjct: 73  ETGEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSP--------- 123

Query: 125 GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMT-KAVGVSNFSINNLKELLTS 183
                       G     ++TW  ++  + +QE  +  +  K++GVSNF +++L+ELL  
Sbjct: 124 -----------RGGAKRRLETWAILE--QAVQEPGSKALEIKSIGVSNFGVDHLEELLKV 170

Query: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243
              K+ P  +Q+E+HP LP  +L K+ +EK I  EAYSPL       L++P+++ +  K 
Sbjct: 171 A--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPELLALEAKT 226

Query: 244 DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVF 279
            +  A +++ W   +G+VVLVKS++ ERI  N  V 
Sbjct: 227 GINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVL 262

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  140 bits (354), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 161/302 (53%), Gaps = 48/302 (15%)

Query: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVI-AALKAGYRHIDTAAIYGNED 61
           +++ AST T  L  G  IP +  GT+ +    +  +S++ AA K GYRH+DTA +Y NE 
Sbjct: 1   MSITAST-TKTLTNGVKIPVLGFGTYET--PKEKAESIVHAAFKQGYRHVDTAQLYENER 57

Query: 62  Q----VGKAIRDS-GIPREEIFVTSKLWNTQQHNPAGALKDTLSRLG----LDYLDLYLM 112
           +    V K +++S  + R+++F T+K+     H    A K  +  L     L+Y+DL+L+
Sbjct: 58  ECATAVAKFLKESPKVSRDQVFYTTKVAG-DNHGYEKAKKSIIESLEMAKELEYVDLFLI 116

Query: 113 HWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNF 172
           H P                            +T   + T++ +QE    G  KA+GVS++
Sbjct: 117 HNPCA--------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSY 150

Query: 173 SINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILK 232
           SI +L+EL +  G ++ P  NQ E++P L   DL+K+C+E+ ++IEA+SP+    +    
Sbjct: 151 SIKHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFS 208

Query: 233 EPKIIEISKKLDVP---PAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFE 287
           +P + ++ K+   P   PAQL+I W +Q G+V L KS HE+R  +N     F +S ED +
Sbjct: 209 DPVVQKLLKE-SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMK 267

Query: 288 AI 289
            +
Sbjct: 268 TL 269

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  138 bits (348), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/326 (31%), Positives = 163/326 (50%), Gaps = 59/326 (18%)

Query: 12  LKLNTGANIPEISL---GT--WRSLGATDGY-DSVIAALKA-----GYRHIDTAAIYGNE 60
             LN G  IP IS+   GT  ++  G+   + D ++  +K      G  HID A  YG  
Sbjct: 8   FDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTY 67

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQ---QHNPAGALKDTLSRLGLDYLDLYLMHWPVT 117
            ++ KA+++S  PR EIF+T K ++TQ    ++P   L   L  LGLDY+DLYL+H P  
Sbjct: 68  PELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSP-- 124

Query: 118 FNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNL 177
           F     KG                   +    K W+ M+ L   G  K++GVSNFS+ N+
Sbjct: 125 FFDPEFKG-------------------SLTLEKVWKDMETLYKEGKAKSIGVSNFSVKNI 165

Query: 178 KELLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAPILKEPK 235
           +E+L   G  + P  NQIE +  L      ++ +C++  I +EAYSPLG    P+ K P+
Sbjct: 166 EEILKIAG--IKPQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPE 219

Query: 236 ----------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSK 283
                     I E++ K     +Q++++W   RG + +  S+  +RII  + +F+  L+K
Sbjct: 220 NSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTK 279

Query: 284 EDFEAIKNLAKEKGTLRVVDPDWSPF 309
           ++ + +  L  E+  LR+    W+ F
Sbjct: 280 DEVDTLTKLGLEQPALRIY---WTNF 302

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 147/301 (48%), Gaps = 53/301 (17%)

Query: 12  LKLNTGANIPEISL---GT-WRSLGATDG------YDSVIAALKA-GYRHIDTAAIYGNE 60
            KLN G  +P +++   GT W  +  TD        D +  AL   G  H+D A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLMHWPVTF 118
            +VG+A+ ++  PR+EIF+T K W   +   NP   L+  L RLGL+Y+DLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSP--- 123

Query: 119 NTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLK 178
                       I K  NG        ++  + W +M+EL  +G  K +GVSNF+  +L+
Sbjct: 124 -----------FISKETNG--------FSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 179 ELLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAPILKEPK- 235
            +L     K+ P  NQIE +  L      +  FC++  I + AYSPLG    P+ K+P  
Sbjct: 165 RVLKVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPAD 218

Query: 236 ---------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDF 286
                    I ++++  +  P Q+++ W  +RG V +  S  +ERI   +++F    +D 
Sbjct: 219 GNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDD 278

Query: 287 E 287
           E
Sbjct: 279 E 279

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 155/314 (49%), Gaps = 49/314 (15%)

Query: 12  LKLNTGANIPEISL---GT-WRSLGATDG------YDSVIAALK-AGYRHIDTAAIYGNE 60
           + LN G  IP I++   GT W     TD        + ++ ALK  G  HID A IY   
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQ---QHNPAGALKDTLSRLGLDYLDLYLMHWPVT 117
            +VGKA+  +  PR EIF+T K ++TQ     +PA  L   L ++G DY+DLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSP-- 124

Query: 118 FNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNL 177
                        + K  NG        +   + W+ M++L  +G  K +GVSNF++ +L
Sbjct: 125 ------------FVSKETNG--------FTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDL 164

Query: 178 KELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSPLGSINAPILKEPK 235
           + +L     ++ P  NQIE  P L      + KFC+E  I++EAYSPLG +     K+  
Sbjct: 165 ERILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDES 222

Query: 236 ------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSKEDFE 287
                 + E+S+K     AQ+ + W  +RG + +  S+  +RI   + +F+  L+ E+  
Sbjct: 223 LPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVN 282

Query: 288 AIKNLAKEKGTLRV 301
            I  L  E   LR+
Sbjct: 283 QITELGLEHEPLRL 296

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  134 bits (336), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 153/305 (50%), Gaps = 57/305 (18%)

Query: 14  LNTGANIPEISL---GT-WRSLGAT------DGYDSVIAALKA-GYRHIDTAAIYGNEDQ 62
           LN G  +P I++   GT W     T      +  D +  AL   G  HID A +Y    +
Sbjct: 11  LNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPE 70

Query: 63  VGKAIRDSG--IPREEIFVTSKLWNTQ---QHNPAGALKDTLSRLGLDYLDLYLMHWPVT 117
           VGKA+R+S    PR+EIF+T K ++TQ     NP   L + L +LGLDY+DLYL+H P  
Sbjct: 71  VGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSP-- 127

Query: 118 FNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNL 177
                        I K +NG        +   + W+ M++L   G  K +GVSNFS+ +L
Sbjct: 128 ------------FISKEKNG--------FTMEEAWKYMEDLYKAGKVKNIGVSNFSMADL 167

Query: 178 KELLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAPILKEPK 235
           + +L S   ++ P  NQIE +  L      ++ FCRE  I + AY+PLG    P+ ++ K
Sbjct: 168 QRILKSC--EVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLG----PLQRKSK 221

Query: 236 ----------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKED 285
                     + ++++K D   AQ+++ W  +RG + +  S+ E+RI   + +FT    D
Sbjct: 222 NFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTD 281

Query: 286 FEAIK 290
            E  K
Sbjct: 282 SEVEK 286

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  133 bits (334), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 147/309 (47%), Gaps = 55/309 (17%)

Query: 15  NTGANIPEISLGT---WR---SLGATDG------YDSVIAALKAGYRHIDTAAIYGNEDQ 62
            T  +IP +  GT   WR     G T G       D ++ A+  G+ HIDTA  Y   ++
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 63  VGKAIRDSGIPREEIFVTSKL----W-NTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVT 117
           VG+A+R S +PR+++F+T K     W       P  A K  L  LG+ Y DLY++H P  
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRPDI 132

Query: 118 FNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNL 177
                            EN   D++       + W  ++EL   G+ KA+GVSNF +  L
Sbjct: 133 ---------------TKENAGIDLQ-------EAWRQVEELYEAGIAKAIGVSNFPLETL 170

Query: 178 KELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSPLGSINAPILK--- 232
           K++ +    +  P  +Q+E HP L      ++++C+ K I++EAYSPL    AP+ +   
Sbjct: 171 KQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFRARP 224

Query: 233 ---EPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERI--IANRKVFTLSKEDFE 287
              +  +  + KK      Q+++ W + RG V L  S+ EERI  I     F L K D E
Sbjct: 225 GPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVE 284

Query: 288 AIKNLAKEK 296
            I  +  +K
Sbjct: 285 LINEVGSKK 293

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 157/316 (49%), Gaps = 48/316 (15%)

Query: 5   LKASTATLKL-NTGANIPEISLGT---WRSLGA---------TDGYDSVIAALKAGYRHI 51
           + +   TL+L  +G  IP I  G+   WR   A         T+  D V +A+ AG+ HI
Sbjct: 1   MNSKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHI 60

Query: 52  DTAAIYGNEDQVGKAIRDSGIPREEIFVTSKL----WNTQQH-NPAGALKDTLSRLGLDY 106
           D A  Y    +VG+ +++SG+PR+++++T K     W+ ++   P  +L  +L ++ + Y
Sbjct: 61  DAAEAYKTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSY 120

Query: 107 LDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKA 166
           +DLYL+H P  F T    G D                      + W  M+E+   G+ K 
Sbjct: 121 VDLYLLHVP--FITVQTAGIDLK--------------------EAWRQMEEIYDRGLAKN 158

Query: 167 VGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSPLG 224
           +GVSNF + +L E +T  G K  P  NQIE +  L +    +I +C++  I++E YSPL 
Sbjct: 159 IGVSNFDVESL-EYITKIG-KYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLV 216

Query: 225 SINA--PILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FT 280
            +    P   +  +  +++K      Q+++ W  Q G VV+  S  + R+  +  +  F 
Sbjct: 217 PLTKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFE 276

Query: 281 LSKEDFEAIKNLAKEK 296
           L+ EDF++I  + +EK
Sbjct: 277 LTAEDFDSITKIGREK 292

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  130 bits (328), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 155/312 (49%), Gaps = 49/312 (15%)

Query: 14  LNTGANIPEISL---GT-WRSLGATDG------YDSVIAALK-AGYRHIDTAAIYGNEDQ 62
           LN G  IP I++   GT W     TD        + ++ ALK  G  HID A IY    +
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQ---QHNPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
           VGKA+  +  PR  IF+T K ++ Q     +PA  L   L ++G DY+DLYL+H P  F 
Sbjct: 70  VGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSP--FV 126

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKE 179
           ++ V G                     +  + W+ M++L  +G  K +GVSNF++ +L+ 
Sbjct: 127 SKEVNGL--------------------SLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQR 166

Query: 180 LLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAPILKEPK-- 235
           +L     ++ P  NQIE  P L      + KFC+E  I++EAYSPLG +     ++    
Sbjct: 167 ILKVA--EVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQP 224

Query: 236 ----IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSKEDFEAI 289
               + E+S+K     AQ+I+ W  +RG + +  S+  +RI   + +F+  L+ E+ + I
Sbjct: 225 FFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKI 284

Query: 290 KNLAKEKGTLRV 301
             L  E   LR+
Sbjct: 285 TELGLEHEPLRL 296

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  129 bits (324), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/312 (31%), Positives = 157/312 (50%), Gaps = 49/312 (15%)

Query: 14  LNTGANIPEISL---GT-WRSLGATDG------YDSVIAALK-AGYRHIDTAAIYGNEDQ 62
           LN G  IP I++   GT W     TD        + ++ AL+  G  HID A IY    +
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQ---QHNPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
           VGKA+  +  PR+EIF+T K ++TQ     +PA  L+ +L ++G DY+DLYL+H P    
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSP---- 124

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKE 179
                      + K  NG        +   + W+ M++L   G  K +GVSNF++ +L++
Sbjct: 125 ----------FVSKEANG--------FTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDLEK 166

Query: 180 LLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSPLGSINAPILKEPK-- 235
           +L     ++ P  NQIE  P L      + KFC++  I++EAYSPL  +     ++    
Sbjct: 167 ILKIA--EVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKP 224

Query: 236 ----IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSKEDFEAI 289
               + E+S+K     AQ+I+ W  +RG + +  S+  +RI   + +F+  L+ E+ + I
Sbjct: 225 FFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVDEI 284

Query: 290 KNLAKEKGTLRV 301
             L      LR+
Sbjct: 285 TELGLAHEPLRL 296

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  128 bits (321), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 146/300 (48%), Gaps = 52/300 (17%)

Query: 14  LNTGANIPEIS-LGT---WRSLGATDGYDS--VIAALKA-----GYRHIDTAAIYGNEDQ 62
           LN G  IP I+ +GT   W     TD   S  ++  LK      G  HID A IY    +
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQ---QHNPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
           V  A+R+S  PR+EIF+T K ++TQ     +P   L  +L  LGLDY+DLYL+H P   N
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPFIKN 128

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKE 179
              ++                         + W+ M++L  +G  K +GVSNF + +L++
Sbjct: 129 GSTLE-------------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDLEK 163

Query: 180 LLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSPLGSINAPILKEPK-- 235
           +L      + P  NQIE +  L      ++KFC+E  I +EAY+PLG     I   P+  
Sbjct: 164 ILKIAT--IKPQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQR-IQDTPEAK 220

Query: 236 -----IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIK 290
                I E+SKK +   AQ+++ W  +RG + +  S+  +R+   + +F+   E  E  K
Sbjct: 221 PFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDK 280

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  128 bits (321), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 96/313 (30%), Positives = 152/313 (48%), Gaps = 56/313 (17%)

Query: 11  TLKLNTGANIPEISLGT---WR---SLGATDGY------DSVIAALKAGYRHIDTAAIYG 58
           TLK  +G  +P I  G+   WR   S G T G       D V  A++ G+ HIDTA  Y 
Sbjct: 10  TLK-GSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYK 68

Query: 59  NEDQVGKAIRDSGIPREEIFVTSKL--WNTQQHNPAGALKD---TLSRLGLDYLDLYLMH 113
              +VG  I ++ +PRE +++T K   W+ +    +G L+    +L  + LDY+DLY++H
Sbjct: 69  TYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH 128

Query: 114 WPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFS 173
            P    T    G D                      + W  M+E+    M + +GVSNF 
Sbjct: 129 VPNI--TTKTAGIDLK--------------------EAWLQMEEIYTRKMARNIGVSNFD 166

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSPLGSINAPIL 231
           + +L+ + +    K  P  NQIE    + +    ++K+CRE  I++E YSPL     P+ 
Sbjct: 167 VESLEYIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLT 220

Query: 232 K-EPKIIE-----ISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSK 283
           K +P  ++     I+ K      Q+++ W  Q G VV+  +  +ER+  +  +  F LSK
Sbjct: 221 KGKPGPLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSK 280

Query: 284 EDFEAIKNLAKEK 296
           EDF+ I N+ +EK
Sbjct: 281 EDFDQITNVGREK 293

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  127 bits (319), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 156/315 (49%), Gaps = 43/315 (13%)

Query: 5   LKASTATLKLNTGANIPEISL---GT-WRSLGATDGY-DSVIAALK-----AGYRHIDTA 54
           +   T+ + LN G  IP IS+   GT W      D Y D+++  ++      G  HID A
Sbjct: 1   MSYQTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCA 60

Query: 55  AIYGNEDQVGKAIRDSGIPREEIFVTSKLWNTQQH--NPAGALKDTLSRLGLDYLDLYLM 112
            +Y    +VG+A+R+S  PR+EIF+T K    ++   NP   LK  L ++GL+Y+DLYL+
Sbjct: 61  EMYQTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLL 120

Query: 113 HWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNF 172
           H+P+                       D ++  +   + W++M++L   G+ K +GVSNF
Sbjct: 121 HFPII----------------------DPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNF 158

Query: 173 SINNLKELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYS---PLGSIN 227
            + +L++L  S    + P  NQIE +  L      +  +C +  I +EA+    PL  +N
Sbjct: 159 RVEDLEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVN 216

Query: 228 APILKEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSKED 285
              L    + ++++K      Q+++ W  QR  + +  S+  ER+     +F+  L++++
Sbjct: 217 EKDLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDE 276

Query: 286 FEAIKNLAKEKGTLR 300
            E I  L  +  T+R
Sbjct: 277 VEFITKLGSQHDTIR 291

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  127 bits (319), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 150/310 (48%), Gaps = 48/310 (15%)

Query: 8   STATLKLNTGANIPEISL---GT-WR--SLGATDGYDSVIAALKA-----GYRHIDTAAI 56
           S     LN G  IP IS+   GT W    L +    D ++  L+      G  HID A +
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEM 63

Query: 57  YGNEDQVGKAIRDSGIPREEIFVTSKLWNTQ---QHNPAGALKDTLSRLGLDYLDLYLMH 113
           Y    +V KA++ +   R+EIF+T K ++       NP   L  +L  L LDY+DLYL+H
Sbjct: 64  YNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLH 123

Query: 114 WPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFS 173
            P  F T+   G                    +   + W+ M++L   G  K +GVSNFS
Sbjct: 124 SP--FITKESCG--------------------YTMEEAWKQMEKLYKDGKAKNIGVSNFS 161

Query: 174 INNLKELLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSIN-API 230
           +++LK +L     ++ P  NQIE +  L      ++KFC++  I++EAYSPLG +   P 
Sbjct: 162 VDDLKRILKI--CEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLRKKPT 219

Query: 231 LKEP-----KIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSK 283
            ++P      I E++KK      Q+++ W  +R  + +  S  EERI   + +F+  L+ 
Sbjct: 220 DRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLTS 279

Query: 284 EDFEAIKNLA 293
           E+ E I  L 
Sbjct: 280 EEVEKITKLG 289

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  126 bits (317), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 144/307 (46%), Gaps = 45/307 (14%)

Query: 5   LKASTATLKLNTGANIPEISL---GT-WRSLGATDGYDS--VIAALK-----AGYRHIDT 53
           +  + A + LN G  +P +++   GT W      D   S  +I  L+      G  HID 
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 54  AAIYGNEDQVGKAIRDSGIPREEIFVTSK--LWNTQQHNPAGALKDTLSRLGLDYLDLYL 111
           A +YG   ++  A+R +  PR EIF+T K  L      +P   L+D+L    LDY+DLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 112 MHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSN 171
           +H P                      KP + ++       W  M++L   G  K +GVSN
Sbjct: 121 LHSPFVAKE-----------------KPGLTLEG-----AWRQMEQLYKDGKAKNIGVSN 158

Query: 172 FSINNLKELLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAP 229
           FS+ +LK +L+    ++ P  NQIE HP L      ++KFC+++ I +EA++PLG +   
Sbjct: 159 FSVEDLKRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVK 216

Query: 230 ILKEPK------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSK 283
             ++        I  +S K     AQ+I+ W  +RG + +  S   +RI   + +F    
Sbjct: 217 TQEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDL 276

Query: 284 EDFEAIK 290
           ED E  K
Sbjct: 277 EDEEVTK 283

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  125 bits (314), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 99/322 (30%), Positives = 151/322 (46%), Gaps = 63/322 (19%)

Query: 2   TVTLKASTATLKLNTGANIPEISLGT---WRSLGA----TDGY-----DSVIAALKAGYR 49
           TV LK S        G  +P I  G+   WR   A     D +     D V  A+KAG+ 
Sbjct: 7   TVELKGS--------GDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFN 58

Query: 50  HIDTAAIYGNEDQVGKAIRDSGIPREEIFVTSKL----WNTQQ-HNPAGALKDTLSRLGL 104
           HID A  Y    +VG  I +SG+PRE+++VT K     W  ++   P  +L+ +L ++ +
Sbjct: 59  HIDAAEAYKTHPEVGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQM 118

Query: 105 DYLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMT 164
            Y+DLYL+H P  F      G D                      + W  M+E+   G  
Sbjct: 119 QYVDLYLVHVP--FINPETAGIDLK--------------------EAWRQMEEIYDRGWA 156

Query: 165 KAVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSP 222
           K +GVSNF + +L+ + T    K  P  NQIE    + +    +I +C++ GI IE YSP
Sbjct: 157 KNIGVSNFDVESLEYIRTI--GKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSP 214

Query: 223 LGSINAPILK-EPKIIE-----ISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANR 276
           L     P+ K +P  ++     ++KK      Q+++ W VQ G + +  S  ++RI  + 
Sbjct: 215 L----VPLTKGKPGPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESL 270

Query: 277 KV--FTLSKEDFEAIKNLAKEK 296
            +  F LS EDF +I  + K K
Sbjct: 271 DIFDFELSSEDFTSITEVGKTK 292

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 136/279 (48%), Gaps = 49/279 (17%)

Query: 47  GYRHIDTAAIYGNEDQVGKAIRDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGL 104
           G  H+D A  Y    ++ KA+++S  PR EIF+T K     +   NP  AL   L  LGL
Sbjct: 53  GIVHVDAAEYYRTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGL 112

Query: 105 DYLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMT 164
           DY+DLY++H+P                      + D E    +    W  M+ L   G  
Sbjct: 113 DYVDLYVLHFP----------------------EFDPEYKDLSIETAW--MELLYKEGKA 148

Query: 165 KAVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYSP 222
           K +GVSNFSI +L+ ++     K  P  NQIE +  L      ++K+C++ G  +EAYSP
Sbjct: 149 KNIGVSNFSIEHLERVMKIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSP 206

Query: 223 LGSINAPILKEPK----------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERI 272
           L    AP+ ++PK          I E+S K     +++++ W  +RG V +  S+  ERI
Sbjct: 207 L----APLQRKPKNFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERI 262

Query: 273 IANRKVFT--LSKEDFEAIKNLAKEKGTLRVVDPDWSPF 309
           +  + +F+  L+ E+ + I  L  E+  LR+    W+ F
Sbjct: 263 VNAQNLFSFDLTDEEVDKITKLGLEQPALRLY---WNEF 298

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  117 bits (292), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 91/315 (28%), Positives = 149/315 (47%), Gaps = 55/315 (17%)

Query: 14  LNTGANIPEIS-LGT---WRSL--GATDGYDSVIAALKA-----GYRHIDTAAIYGNEDQ 62
           LN G  IP ++ +GT   W      A+   D ++  +K      G  HID A IY    +
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
           +GKA+R++  PR EI++T K   + +   NP    ++ L  LG+DY+DLYL+H P     
Sbjct: 70  LGKALRETKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPFITEG 129

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180
           RN                       +   + W+ ++EL  +G  K +GVSNF+  +L+ +
Sbjct: 130 RN----------------------GFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERI 167

Query: 181 LTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAPILKEPK--- 235
           L     ++ P  NQIE    L      +  F +E  I++EAYSPLG    P+ + P+   
Sbjct: 168 LKIA--EIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLG----PLQRRPEEAD 221

Query: 236 -------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSKEDF 286
                  I E+++K     AQ+++ W  +RG + +  S+   R+   + +FT  L+  + 
Sbjct: 222 SLPFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEV 281

Query: 287 EAIKNLAKEKGTLRV 301
           E I  L  +   LR+
Sbjct: 282 EKITELGLKHEALRL 296

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  114 bits (286), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 90/314 (28%), Positives = 154/314 (49%), Gaps = 55/314 (17%)

Query: 14  LNTGANIPEISL----GTWRSLGATDGYDS--VIAALKA-----GYRHIDTAAIYGNEDQ 62
           LN G  IP +++     TW     T+   S  ++  +K      G  H+D A  Y    +
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGAL---KDTLSRLGLDYLDLYLMHWPVTFN 119
           +G+A+R+S  PR+EIF+T K   T + N  G L   +  + ++G+DY+DLYL+H P    
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPK-NHGGVLERFESGIKKMGVDYVDLYLIHSP---- 143

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKE 179
                     +I K +NG            + W+ +++L   G  K +GVSNF + +L+ 
Sbjct: 144 ----------LIEKEKNG--------VTLEEVWKDLEKLYEAGKAKNIGVSNFRVEDLQR 185

Query: 180 LLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAPILKEPK-- 235
           +L     K+ P  NQIE H  L      ++KF ++  I +EAY+PLG    P+ ++    
Sbjct: 186 ILKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQSDA 239

Query: 236 ------IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFT--LSKEDFE 287
                 + E++KK     AQ+++ W  +R  + +  S+  +RI A + +F+  L+ E+ +
Sbjct: 240 GDFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVK 299

Query: 288 AIKNLAKEKGTLRV 301
            I  L  +   LR+
Sbjct: 300 KITELGLKHKPLRL 313

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  108 bits (271), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 92/320 (28%), Positives = 148/320 (46%), Gaps = 52/320 (16%)

Query: 14  LNTGANIPEIS-LGT---WRSLGATDGYDS-------VIAALKAGYRHIDTAAIYGNEDQ 62
           LN G  IP ++ +GT   W     TD   S         A    G  H+D A +Y    +
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 63  VGKAIRDSGIPREEIFVTSKLWNTQQ---HNPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
             +A++++  PR EIFVT K ++ Q+   ++P   L   L R GL+Y+DLYL+H P    
Sbjct: 70  FSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFA-- 126

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKE 179
                        K +NG        +   + W  ++EL   G  K +GVSNF + +L++
Sbjct: 127 ------------SKEKNG--------FTIEEAWAQLEELYHEGKAKNIGVSNFRVEDLEK 166

Query: 180 LLTSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPLGSINAPILKEPK-- 235
           +L     K+ P  NQIE    L      ++KF ++  I +EAY+PLG ++     E    
Sbjct: 167 ILKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKP 224

Query: 236 ----IIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERI--IANRKVFTLSKEDFEAI 289
               I ++++K     AQ+++ W  +RG + +  S   +RI    N   F L+K++ + I
Sbjct: 225 FYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEI 284

Query: 290 KNLAKEKGTLRVVDPDWSPF 309
             L      LR+    W+P 
Sbjct: 285 TKLGLAHPALRLY---WNPL 301

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score = 99.8 bits (247), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 147/306 (48%), Gaps = 51/306 (16%)

Query: 14  LNTGANIPEISL----GTWRSL-GATDGYDSVIAALKA-----GYRHIDTAAIYGNEDQV 63
           LN G +IP I+       W  + G  DG  +++  LK      G+ HI TA  Y N   +
Sbjct: 11  LNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNGLL 70

Query: 64  GKAIRDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTR 121
             A++ S  PR EI++T K  +  +   +P  AL+ +L RLG DY+DLYL+H P      
Sbjct: 71  SAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNP------ 124

Query: 122 NVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181
                    +  + NG   I ++     K W+ M+ L  TG  K +GVSNF I +L+ L 
Sbjct: 125 --------CLDSSPNG---ISLE-----KAWKQMELLYKTGKVKNIGVSNFRIEDLERLK 168

Query: 182 TSPGNKLTPAANQIEIHPLLPEH--DLIKFCREKGIMIEAYSPL--------GSINAPIL 231
            +   ++ P  N+IE H  L     ++ ++ +   +++  YSPL          ++ P  
Sbjct: 169 DA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPFY 225

Query: 232 KEPKIIEISKKLDVPPAQLIISWHVQRGYVVLVKSTHEE--RIIANRKVFTLSKEDFEAI 289
           +   II +++K +   AQ+++ W    G + ++ +T  +  +  ++   F L+ E+ + I
Sbjct: 226 R--YIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMI 283

Query: 290 KNLAKE 295
             L K+
Sbjct: 284 TELGKK 289

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (58%), Gaps = 6/92 (6%)

Query: 1  MTVTLKASTAT-LKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGN 59
          MT T+  +  T  KLN G  IP I  G +  +   D  D V +ALK GYRHIDTA +Y N
Sbjct: 1  MTHTIDINRETRYKLNNGQQIPVIGFGVY-EIPKEDTADRVYSALKDGYRHIDTAVLYRN 59

Query: 60 EDQVGKAIR----DSGIPREEIFVTSKLWNTQ 87
          + +  + +R    ++G  RE I+ T+KLW++Q
Sbjct: 60 QKEAAQGVRKYLDETGEARENIWFTTKLWDSQ 91

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 66/148 (44%), Gaps = 41/148 (27%)

Query: 43  ALKAGYRHIDTAAIYG-NEDQVGKAIRD--SGIPREEIFVTSKL-------WNTQQHNPA 92
           A+  G   IDT+  YG +E   GKA+++     PREE F+ +K+       +N  + N  
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 93  GALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTW 152
            ++K +  RL  DYLDL  +H                          DIE   ++  K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH--------------------------DIEYVEYD--KIW 141

Query: 153 ELMQELPA---TGMTKAVGVSNFSINNL 177
           E ++EL      G+ + +G+S + ++ L
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL 169

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 119/307 (38%), Gaps = 55/307 (17%)

Query: 15  NTGANIPEISLGT----------WRSLGATDGYDSVIAALKAGYRHIDTAAIYGN---ED 61
           NTG  +  + +G           W      + +  +  A   G R  DTA +Y N   E 
Sbjct: 11  NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 62  QVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTR 121
            +G+ +R   IPRE + + +KL      N     K+    + L+ +++  +     F++ 
Sbjct: 71  ILGEFLRKYNIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSS 130

Query: 122 NVK----GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNL 177
                  GT ++ I +   G PD       F +T   + ++   G+T+ VG S       
Sbjct: 131 RASVKRLGT-YIDILQIHRGDPDTP-----FEETMGALNDVVIEGLTRYVGASLMLATEF 184

Query: 178 KEL-LTSPGNKLTPAANQIEIHPLL---PEHDLIKFCREKGIMIEAYSPL--GSINAPIL 231
            E+   +  +      N    + L+    E +LI F +   I +  +SPL  G +  P+ 
Sbjct: 185 AEMQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLG 244

Query: 232 KEP--------------------------KIIEISKKLDVPPAQLIISWHVQRGYVVLVK 265
            E                           ++ ++S K ++P + + ++W +Q+G   +V 
Sbjct: 245 TETTRSNSDSVIKTKNLKNYTDWEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVG 304

Query: 266 STHEERI 272
            +  ER+
Sbjct: 305 FSSIERV 311

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 82/188 (43%), Gaps = 35/188 (18%)

Query: 51  IDTAA--IYGNE-DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKD--TLSRLGLD 105
           ID AA  IY     +VG+A+  +  P+ EIF+T K     + +   A++    L ++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 106 YLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTK 165
           Y+D++ +H P  F   NV                   ++  + + T  L +   A     
Sbjct: 67  YVDMHFLHSPFVFKQANV-------------------LNLKDAMHTDHLRRSNKANNR-- 105

Query: 166 AVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHD--LIKFCREKGIMIEAYS-- 221
             G S+ ++  L+ +L +   +  P  NQI++   L      + K C+E  I++  YS  
Sbjct: 106 --GASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

Query: 222 -PLGSINA 228
            PL   NA
Sbjct: 162 DPLQRKNA 169

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 119/321 (37%), Gaps = 83/321 (25%)

Query: 15  NTGANIPEISLGTWRSLGAT-------DGYDSVIAALKAGY----RHIDTAAIYGNEDQ- 62
           NTG  +  I +G   S G+        D  + +   LK  Y    R  DTA +Y N +  
Sbjct: 11  NTGLKVSPIIIGCM-SFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESE 69

Query: 63  --VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
             +G+ +++  IPRE + + +KL+     N              DY D++ M      N 
Sbjct: 70  IILGEFLKNYKIPRETVIIMTKLYFPTNDNA-------------DY-DIFSMTPEAILNN 115

Query: 121 RNVKGTD-----------------FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGM 163
            N+ G                   +  I +     PD       F +T   + ++   G+
Sbjct: 116 VNITGLSRKNIINSARDSVRRLGTYADIIQIHRADPDTP-----FEETMRALNDIVVDGL 170

Query: 164 TKAVGVSNFSINNLKEL-LTSPGNKLTPAANQIEIHPLL---PEHDLIKFCREKGIMIEA 219
           T+ +G S+       E+   +  N      N    + LL    E +LI F +   I +  
Sbjct: 171 TRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAKRHNIALTP 230

Query: 220 YSPL--GSINAPI-----------------LKE---------PKIIEISKKLDVPPAQLI 251
           +SPL  G +  P+                 +K+          ++ EI+KK +   A + 
Sbjct: 231 WSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKRNTKMATVA 290

Query: 252 ISWHVQRGYVVLVKSTHEERI 272
           + W +Q+G   +V  +  +RI
Sbjct: 291 LYWVIQKGCFPIVGMSKIDRI 311

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 91/207 (43%), Gaps = 38/207 (18%)

Query: 26  GTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRDSGIP-REEIFVTSKLW 84
           G   SL +    + ++  LKAG + IDTA IY + +   KAI +  +P R  I   +  +
Sbjct: 7   GYTFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLPDRFTIHTKASGF 63

Query: 85  N---TQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDI 141
           +     + N   +++++LS LG+  ++ +L+H P                       P+I
Sbjct: 64  SGGCLTRDNINKSIEESLSLLGVPSVETFLLHSP----------------------DPEI 101

Query: 142 EMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK--LTPAANQIEIHP 199
            ++     +T + +  L   G  +  G+SNFS  ++K +     +K  + P   Q   + 
Sbjct: 102 PLE-----ETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNA 156

Query: 200 LLPE--HDLIKFCREKGIMIEAYSPLG 224
           L     +DL    +E  I + AYSP+ 
Sbjct: 157 LSRAIVNDLFPLLKELHISLYAYSPIA 183

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 12/82 (14%)

Query: 43  ALKAGYRHIDTAAIYGNEDQV-GKAIRD--SGIPREEIFVTSKLWN--------TQQHNP 91
           A++ G R IDT+  YG+ +++ GKA+      IPRE  F+ +K+          +++H  
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIPRENYFICTKVGRIRLDEFDYSREHVR 111

Query: 92  AGALKDTLSRLGLDYLDLYLMH 113
           +  L+ +  RL  DYLD+  +H
Sbjct: 112 SSVLR-SCERLRTDYLDVVFLH 132

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 102/264 (38%), Gaps = 77/264 (29%)

Query: 15  NTGANIPEISLGTWRSLGATDGYDSVI-----------AALKAGYRHIDTAAIYGN---E 60
           NTG  I  I +G   S G+ D +  +I            A  +G R  DTA  Y N   E
Sbjct: 11  NTGLKISPIIVGCM-SYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSE 69

Query: 61  DQVGKAIRDSGIPREEIFVTSKLW----------------NTQQH----NPAG------- 93
             +G+ +++  IPRE + + +K+W                N  Q     N  G       
Sbjct: 70  ILLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHII 129

Query: 94  -ALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTW 152
            A K+++ RLG  Y+D+Y +H                          D  M+     +T 
Sbjct: 130 EACKNSVRRLGT-YIDVYQIH----------------------RADQDTPME-----ETM 161

Query: 153 ELMQELPATGMTKAVGVSNFSINNLKEL-LTSPGNKLTPAANQIEIHPLL---PEHDLIK 208
             + ++   G+T+ +G S+       E    +  N  +   N  + + LL    E ++I 
Sbjct: 162 RALNDVVQQGLTRYIGASSMLGTEFAEYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIP 221

Query: 209 FCREKGIMIEAYSPL--GSINAPI 230
           + ++ GI    +SPL  G ++ P+
Sbjct: 222 YIKKHGIAQTPWSPLQRGLLSRPV 245

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 67/158 (42%), Gaps = 49/158 (31%)

Query: 40  VIAALKAGYRHIDTAAIYGNEDQVG----KAIRDSGIPREEIFVTSKL-------WNTQQ 88
           V  AL+AG   IDT+  YG  +++      A+RD   PRE  F+ +K+       ++   
Sbjct: 60  VRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEH-PRETYFICTKVGREGPSDFDYSA 118

Query: 89  HNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNF 148
            +   ++  + +RL  +YLDL  +H                          DIE     F
Sbjct: 119 AHVRASVHRSCARLHTEYLDLVYLH--------------------------DIE-----F 147

Query: 149 VKT---WELMQELPA---TGMTKAVGVSNFSINNLKEL 180
           V+    WE +QEL      G+ +  G+S + +  L+E+
Sbjct: 148 VEAAGIWEALQELRRLKDEGVIRFFGISGYPVELLQEV 185

>Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]
           {ON} complement(243219..244247) [1029 nt, 343 aa]
          Length = 342

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 82/200 (41%), Gaps = 24/200 (12%)

Query: 47  GYRHIDTAAIYGN---EDQVGKAIRDSGIPREEIFVTSKL-WNTQQHNPAGALKDTLSRL 102
           G R  DTA +Y N   E  +G+ ++   IPRE + + SKL + T        LK+    L
Sbjct: 53  GMRTFDTANVYSNGLSETLLGEFLKHYNIPRETVVIMSKLNFATDDKVSFETLKERSEEL 112

Query: 103 GLDYLDLY------LMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQ 156
            L ++++       +M        R     D + I + +   P        + +T   + 
Sbjct: 113 NLHFVNMSGLSRKNIMASAKESVRRLGTYIDVLQIHRADRDTP--------YEETMRALN 164

Query: 157 ELPATGMTKAVGVSNFSINNLKEL-LTSPGNKLTPAANQIEIHPLL---PEHDLIKFCRE 212
           +L  +G+T+ +G S+       E+  T+         N    + LL    E +L+ F + 
Sbjct: 165 DLVESGITRYIGASSMLATEFAEMQFTAEKYGWFKFINSQSCYNLLYREDERELMPFAKR 224

Query: 213 KGIMIEAYSPL--GSINAPI 230
             I +  +SPL  G +  P+
Sbjct: 225 HNIALTPWSPLQRGLLTRPV 244

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 70/157 (44%), Gaps = 37/157 (23%)

Query: 45  KAGYRHIDTAAIYGNEDQ-VGKAIRDSGIPREEIFVTSKL-------WNTQQHNPAGALK 96
           +  +  +DT+  YG+ +  VG+A+R+  IPR EI+V +K+       ++  + N   ++ 
Sbjct: 38  RRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVM 97

Query: 97  DTLSRLGLD--YLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWN-FVKTWE 153
            ++ RL  +  YLD+  +H                          D+E       +   +
Sbjct: 98  RSVERLVGEGGYLDVVYLH--------------------------DVEFQPQEACLAALD 131

Query: 154 LMQELPATGMTKAVGVSNFSINNLKELLTSPGNKLTP 190
            +Q+L   G+ + VGVS + ++ L  L++   +  TP
Sbjct: 132 ELQKLKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTP 168

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 89/248 (35%), Gaps = 43/248 (17%)

Query: 15  NTGANIPEISLGT----------WRSLGATDGYDSVIAALKAGYRHIDTAAIYGN---ED 61
           NTG  I     GT          W      D Y  +  A   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 62  QVGKAIRDSGIPREEIFVTSKLW----NTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVT 117
            +G  ++   IPRE + + +K++    +T + NP   L      L L  +          
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLV---------- 120

Query: 118 FNTRNVKGTDFMVIPKNENGKPDIEMDTWN---------FVKTWELMQELPATGMTKAVG 168
            N + +     +   KN   +    +D +          F +T   + ++   G  + +G
Sbjct: 121 -NQKGLSRKHILEAAKNSVRRLGTYIDVYQIHRCDHETPFEETMRALNDVVEQGYARYIG 179

Query: 169 VSNFSINNLKEL-LTSPGNKLTPAANQIEIHPLL---PEHDLIKFCREKGIMIEAYSPL- 223
            S+       E    +  +      N    + LL    E +++ FC++  + I  +SPL 
Sbjct: 180 ASSMLGTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREMLPFCKKNNVAITPWSPLQ 239

Query: 224 -GSINAPI 230
            G +  PI
Sbjct: 240 MGFLARPI 247

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 43  ALKAGYRHIDTAAIYGN-EDQVGKAIRDSG--IPREEIFVTSKL-------WNTQQHNPA 92
           A + G   IDT+  YGN E  +GKA+ + G   PR+   + +K+       ++    N  
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 93  GALKDTLSRLGLDYLDLYLMH 113
            ++  +  RL  DYLDL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 108/287 (37%), Gaps = 92/287 (32%)

Query: 37  YDSVIAALKAGYRHIDTAAIYGNEDQ----VGKAIRDSGIPREEIFVTSKLW-----NTQ 87
           Y  +  A   G R  DTA +Y N       +G+ +++  I RE + + +KL+        
Sbjct: 20  YKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEYNISRETVVIMTKLFAPVDDTLP 79

Query: 88  QHNPAGAL-----------------------KDTLSRLGLDYLDLYLMHWPVTFNTRNVK 124
            + P G L                       K++L RLG  Y+D+Y +H           
Sbjct: 80  DYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGT-YIDVYQVH----------- 127

Query: 125 GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL-LTS 183
                         PD  M+     +T   + ++   G+T+ +G S+       E    +
Sbjct: 128 -----------RADPDTPME-----ETMRALNDVVQQGLTRYIGASSMLGTKFAEYQFIA 171

Query: 184 PGNKLTPAANQIEIHPLL---PEHDLIKFCREKGIMIEAYSPL--GSINAPI-------- 230
             N  +   N  + + LL    E ++I + ++ GI    +SPL  G ++ P+        
Sbjct: 172 EKNGWSKFVNMQDCYNLLYREEEREMIPYIKKHGIAQTPWSPLQRGLLSRPVEGSSYRED 231

Query: 231 ----LK----------EPKII----EISKKLDVPPAQLIISWHVQRG 259
               LK          E +II    EISKK + P A +  +W + +G
Sbjct: 232 NDRVLKGQRLNQYEDFEIEIIKRVEEISKKRNNPMAVISTAWVLSKG 278

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 110/285 (38%), Gaps = 84/285 (29%)

Query: 18  ANIPEISLGTWRSLG-ATDGYDSVIAALKA-GYRHIDTAAIY-GNEDQVGKAIRDSGIPR 74
           A +P+I  G +       D +  + + L+  G    DTA IY G+E    K+I D GI  
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSE----KSIGDLGIA- 56

Query: 75  EEIFVTSKLWNTQQHNPAGAL---------KDTLSRLGLDYLDLYLMHWPVTFNTRNVKG 125
           +++ + +K  + ++    GAL         K +   L +D +++Y +H P          
Sbjct: 57  DDLVIDTKARSFEE----GALTRDGIFESIKQSFDELKVDSVEIYYLHAPDP-------- 104

Query: 126 TDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL--TS 183
               + P  E               T + + EL   G  K  G+SN++ +++K++     
Sbjct: 105 ----ITPIEE---------------TIDAINELYKQGKFKKFGLSNYTPDDVKKIYEYAK 145

Query: 184 PGNKLTPAANQIEIHPLLP--EHDLIKFCREKGIMIEAYSPL------------------ 223
             N + P   Q   +      E DL    R+ GI   AYSP+                  
Sbjct: 146 SKNYVLPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSPIAGGFLVKSVQQIEEGAGR 205

Query: 224 -------GSINAPILKEPKII-------EISKKLDVPPAQLIISW 254
                  G + + +   PK++       +I+KK D+P + L   W
Sbjct: 206 FKKGTMIGDLYSKLYNTPKLLKGLEKWDDIAKKYDIPKSHLAYRW 250

>TBLA0D02640 Chr4 (648703..655077) [6375 bp, 2124 aa] {ON} Anc_8.69
           YFL007W
          Length = 2124

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 41/95 (43%), Gaps = 6/95 (6%)

Query: 29  RSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVG----KAIRDSGIPREEIFVTSKLW 84
            S   +D  DS+    K G      A I GNED       K ++ S   +  +  T KLW
Sbjct: 3   HSRNCSDTSDSIPKRFKIGTAASPIATINGNEDINSTVDYKTLQKSSRSQSPLKPTDKLW 62

Query: 85  NTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFN 119
           N    N    LK+ L+  GLDY+   L H+   F+
Sbjct: 63  NA--FNSERLLKERLAHYGLDYVKDPLEHYKNIFD 95

>KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 340

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 12/87 (13%)

Query: 38  DSVIAALKAGYRHIDTAAIYGNEDQVGKAIRDS---GIPREEIFVTSKLWN--------T 86
           D +  A++ G R IDT+  YG+ + +  A  +S    +PRE  F+ +K+          +
Sbjct: 47  DMIRFAMQFGVRAIDTSPYYGDSEVLYGAALESLKEELPRENYFICTKVGRIRLEEFDYS 106

Query: 87  QQHNPAGALKDTLSRLGLDYLDLYLMH 113
           + H     L+ +  RL   YLD+  +H
Sbjct: 107 RSHIHFSVLR-SCERLKTKYLDVVFLH 132

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 53/118 (44%), Gaps = 21/118 (17%)

Query: 17  GANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ---VGKAIRDSGIP 73
           GA+I +   G   S+     ++ + A  +AG   IDTA  Y NE+    +G+ +    + 
Sbjct: 36  GASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL- 94

Query: 74  REEIFVTSKLWNTQQHNPAG-----------------ALKDTLSRLGLDYLDLYLMHW 114
           R++I + +K     +    G                 +++D+L +L  D++D+  +HW
Sbjct: 95  RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 18/90 (20%)

Query: 40  VIAALKAGYRH----IDTAAIYG-NEDQVGKA---IRDSGIPREEIFVTSKLWNTQ---- 87
           ++  LK G+ H    IDT+  YG +E   G+A   IRD   PR   ++ +K+   Q    
Sbjct: 42  LVDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICTKVGRIQLDEF 100

Query: 88  ----QHNPAGALKDTLSRLGLDYLDLYLMH 113
               +H     L+ +  RL  DYLDL  +H
Sbjct: 101 DYSREHVRFSVLR-SCQRLKTDYLDLVYLH 129

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 82/195 (42%), Gaps = 39/195 (20%)

Query: 38  DSVIAAL-KAGYRHIDTAAIYGNEDQVGKAIRDSGIP-REEIFVTSKLWNT---QQHNPA 92
           D + A L KAG + IDTA IY + +++   I +  +P R  I   +  ++     + N  
Sbjct: 23  DEISAILEKAGVKDIDTARIYPDSEKI---IGELQLPNRFTIHTKASGFSGGCLTKDNIN 79

Query: 93  GALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTW 152
            +++++LS LG+  ++ + +H P                       P+  ++     +T 
Sbjct: 80  KSIEESLSLLGVPSVETFFLHSP----------------------DPETPIE-----ETL 112

Query: 153 ELMQELPATGMTKAVGVSNFSINNLKELLTSPGNK--LTPAANQIEIHPL--LPEHDLIK 208
             +  L   G  K  G+SNF+  ++K +     +K  + P   Q   +      E+DL  
Sbjct: 113 GAINSLYEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFP 172

Query: 209 FCREKGIMIEAYSPL 223
             RE      AYSP+
Sbjct: 173 LLRELHFSFYAYSPI 187

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 30.4 bits (67), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 254 WHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIK 290
           W   +G+VVLVKS++ ERI  N  V   SK+D   +K
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVLP-SKDDSWKVK 37

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 70/322 (21%), Positives = 124/322 (38%), Gaps = 63/322 (19%)

Query: 15  NTGANIPEISLGTWRSLGATD-------GYDSVIAALKAGY----RHIDTAAIYGN---E 60
           NTG  I  I +G   S G+ D         + V   LK  Y    R  DTA +Y N   E
Sbjct: 11  NTGIKISPIIVGC-MSYGSKDWAKWVEDDKEKVFKILKHCYDQGLRTFDTADVYSNGLSE 69

Query: 61  DQVGKAIRDSGIPREEIFVTSKLW----NTQQHNPAGALKDTLSRLGLDYLDLYLMHWPV 116
             + + ++   I RE + + SK++     T        L+D L++L L           +
Sbjct: 70  KLLKEFMQKYNIRRETVVIMSKVFFPVDETLDLGLGSGLEDELAQLDLTNQQGLSRKHII 129

Query: 117 TFNTRNVK--GT--DFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNF 172
               ++V+  GT  D + I + +   P  E        T   + ++   G+T+ +G S+ 
Sbjct: 130 DAAKKSVERLGTYMDVLQIHRFDPNTPVKE--------TMRALNDVVEMGLTRYIGASSM 181

Query: 173 SINNLKEL-LTSPGNKLTPAANQIEIHPLL---PEHDLIKFCREKGIMIEAYSP--LGSI 226
               L EL  T+         N    + L+    E + I F ++  +M+  +SP   G +
Sbjct: 182 LGTQLAELQFTADKYNWFQFVNVQSCYNLVYREDERETIPFAKKHNLMLTPWSPNHQGLL 241

Query: 227 NAPILKEP--------------------------KIIEISKKLDVPPAQLIISWHVQRGY 260
             P+  E                           ++ E++KK +V  A +  +W +Q+G 
Sbjct: 242 TRPVGVESTRSSSDIIINAWGLKNLKPWEVTVINRVEEMAKKKNVSMAVIATAWVIQKGC 301

Query: 261 VVLVKSTHEERIIANRKVFTLS 282
             ++  +   R+  N K   +S
Sbjct: 302 APILGMSSIARVDDNIKALDVS 323

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 49/105 (46%), Gaps = 21/105 (20%)

Query: 30  SLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ---VGKAIRDSGIPREEIFVTSKL--- 83
           S+     ++ + A  +AG   IDTA  Y NE+    +G+ ++   + R++I + +K    
Sbjct: 3   SMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGD 61

Query: 84  --------------WNTQQHNPAGALKDTLSRLGLDYLDLYLMHW 114
                             +H+   +++D+L +L  D++D+  +HW
Sbjct: 62  YKKYEVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>KAFR0A05360 Chr1 complement(1056443..1057483) [1041 bp, 346 aa]
           {ON} Anc_3.462 YPR127W
          Length = 346

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 150 KTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPL-LPEHDLIK 208
           +++E + +L   G+   + +S  +   ++ +    G  LT    ++ +  L + E+D+ K
Sbjct: 144 ESFEALAKLVDGGLIGGISLSEVTSPQIRAIAKDFGKYLTCVEVELSLFSLNIFENDVAK 203

Query: 209 FCREKGIMIEAYSPLG 224
            C +  ++I  YSPLG
Sbjct: 204 ACSDLNLIIICYSPLG 219

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 60/132 (45%), Gaps = 25/132 (18%)

Query: 7   ASTATLKLN----TGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62
           + TA++K++     G +I +   G   ++     +  + A  +AG   IDTA  Y NE  
Sbjct: 22  SKTASVKVSPLILGGMSIGDAWSGYMGTMDKERAFKLLDAFYEAGGNFIDTANTYQNEQS 81

Query: 63  ---VGKAIRDSGIPREEIFVTSKL-----W------------NTQQHNPAGALKDTLSRL 102
              +G+ +    + R++I + +K      W               +H+   +++D+L +L
Sbjct: 82  EAWIGEWMESRKL-RDQIVIATKFSTDYKWYDVGKNRSANFCGNSKHSLHVSVRDSLRKL 140

Query: 103 GLDYLDLYLMHW 114
             D++D+  +HW
Sbjct: 141 QTDWIDILYIHW 152

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 31/133 (23%)

Query: 12  LKLNTGANIPEISLGT------WR-SLGATD---GYDSVIAALKAGYRHIDTAAIYGN-- 59
           L  N G  +  + LG       W  +LG+ D    ++ + A  +AG   IDTA  Y N  
Sbjct: 21  LSKNAGIRVSPLVLGAMSIGDAWEETLGSMDKQRSFELLDAFYEAGGNFIDTANNYQNGQ 80

Query: 60  -EDQVGKAIRDSGIPREEIFVTSK---------LWNTQQHNPAG--------ALKDTLSR 101
            E+ +G+ +    I R++I + +K         +   +  N +G        +++D+L +
Sbjct: 81  SEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSANFSGNHRRSLQLSVRDSLRK 139

Query: 102 LGLDYLDLYLMHW 114
           L  D++D+  +HW
Sbjct: 140 LQTDWIDILYVHW 152

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 49/117 (41%), Gaps = 19/117 (16%)

Query: 17  GANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ--------VGKAIR 68
           G +I +   G   S+     ++ + A  +AG   IDTA  Y NE          V + +R
Sbjct: 36  GMSIGDAWSGFMGSMNKERAFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLR 95

Query: 69  DSGIPREEIFVTSKLW-----------NTQQHNPAGALKDTLSRLGLDYLDLYLMHW 114
           D  +   +     K +              +H+   +++D+L +L  D++D+  +HW
Sbjct: 96  DQIVIATKFTTDYKKYEVGKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
           YLR309C (REAL)
          Length = 916

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 28/164 (17%)

Query: 71  GIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKGTDFMV 130
           G+  EEIF    L + +++   G LK+ L  L   + D     W   ++    K  +   
Sbjct: 311 GVNEEEIF--DNLISAEEY---GKLKEDLQTLQEKHKDCE--DWKHQYDEIKTKIENANG 363

Query: 131 IPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNKLTP 190
           +  ++ GK + E++  N         EL AT   K++   N  +  ++++L + GN+L  
Sbjct: 364 LEDSQLGKLEKELEKLNV--------ELSATK--KSLKEKNSELEEVRDMLRTVGNELVD 413

Query: 191 AANQI---------EIHPLLPEHDLIKFCREKGIMIEAYSPLGS 225
           A N+I         E+  +  E D ++   +   MIEAY    S
Sbjct: 414 AKNKIKESTSQQNEEVKAVKLELDDLRH--KNATMIEAYETKNS 455

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 119/313 (38%), Gaps = 65/313 (20%)

Query: 15  NTGANIPEISLGTWRSLGA-------TDGYDSVIAALKAGY----RHIDTAAIYGN---E 60
           NTG  I  I +G   S G+        D  + V   LK  Y    R  DTA +Y N   E
Sbjct: 12  NTGIKISPIIVGCM-SYGSKQWAEWVQDDKEKVFEILKHCYDRGLRTFDTADVYSNGISE 70

Query: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120
             +G+ ++   I RE + + +K +     + + AL + +S    D LDL         N 
Sbjct: 71  RLLGEFLKKFNIKRETVVILTKTFFPVDESLSLALGE-MSFSESDTLDLT--------NQ 121

Query: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVK---------TWELMQELPATGMTKAVGVSN 171
           R +     +   KN   +    +D     +         T + + ++  +G  + +G S+
Sbjct: 122 RGLSRKHILQSVKNSVERLGTYIDVLQIHRFDPTTPIKETMKALNDVVESGDVRYIGASS 181

Query: 172 FSINNLKELLT-SPGNKLTPAANQIEIHPLL---PEHDLIKFCREKGIMIEAYSP--LGS 225
                  E+ + +  +      N    + LL    E DL+++C +  I +  +SP   G 
Sbjct: 182 MLPTQFVEMQSVADKHDWFQFVNVQSCYNLLYREDERDLMQYCEKHNIALTPWSPNHQGL 241

Query: 226 INAPILKEP------KII--------------------EISKKLDVPPAQLIISWHVQRG 259
           +  PI  E       KII                    E+SKK +V  A +  +W + +G
Sbjct: 242 LTRPIGVESERSTTDKIINGWNMKDLKPSEIEIINRVEELSKKKNVSMAVISTAWVLSKG 301

Query: 260 YVVLVKSTHEERI 272
              +V  +   R+
Sbjct: 302 CAPIVGMSSISRV 314

>TPHA0D03090 Chr4 (644272..645297) [1026 bp, 341 aa] {ON} Anc_3.462
           YPR127W
          Length = 341

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 150 KTWELMQELPATGMTKAVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLI-K 208
           +T+E + E+   G    V +S  +   ++ +       LT    ++ +      H+ I K
Sbjct: 141 ETFEALAEMVDNGFIGGVSLSEVTEKQIRAINKDWHKYLTCVEVELSLFSTQILHNNIAK 200

Query: 209 FCREKGIMIEAYSPLG 224
            C E G++I AYSPLG
Sbjct: 201 TCGELGLIIIAYSPLG 216

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 68/162 (41%), Gaps = 33/162 (20%)

Query: 74  REEIFVTSK-LWNTQQHNPAG-------ALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKG 125
           RE++ +++K   + Q  +PAG       ++++TL      Y+D+Y    P   +   +K 
Sbjct: 81  REKVIISAKGAVDLQTLSPAGDAKSVSASIENTLKVFN-GYVDIY---EPARLDLELIKK 136

Query: 126 TDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSPG 185
           T   V P+                +T++ + E    G    + +S  +   ++ +    G
Sbjct: 137 TGESVFPR----------------ETFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYG 180

Query: 186 NKLTPAANQIEIHPLLPE---HDLIKFCREKGIMIEAYSPLG 224
             L     ++E+     E   + ++  C E G+ I AYSPLG
Sbjct: 181 EYLVCV--EVELSMFSAEILSNGIVDTCNELGLPIVAYSPLG 220

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 82/223 (36%), Gaps = 32/223 (14%)

Query: 18  ANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRDSGIPREEI 77
           +N+P+I+L T+   G       VI  L     H+D A      D V  AI D       I
Sbjct: 242 SNLPKITLATY--FGTVVPNLDVIKGLPVSALHVDFARAPQQFDDVIAAIGDKQTLSVGI 299

Query: 78  FVTSKLWNTQQHNPAGALKDTLSRLGLDYLDL----YLMHWPVT--------------FN 119
                +W       +  +   + +LG D + +     L+H PV               F+
Sbjct: 300 VDGRNIWKNDFKKSSAFVNKAIEKLGADRVVVATSSSLLHTPVDLTNETKLDAEIKGFFS 359

Query: 120 TRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNF-----SI 174
               K  + +VI KN +G+ D+        K+ E      + G +K +  S+      SI
Sbjct: 360 FATQKLDEVVVITKNVSGQ-DVAAALEANAKSVE------SRGKSKLIHDSSVKARVASI 412

Query: 175 NNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMI 217
           +       SP  +  P   +I   PL P   +  F + K I I
Sbjct: 413 DQKMSTRASPFEQRLPEQKKIFNLPLFPTTTIGSFPQTKDIRI 455

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,247,459
Number of extensions: 1521703
Number of successful extensions: 4559
Number of sequences better than 10.0: 158
Number of HSP's gapped: 4253
Number of HSP's successfully gapped: 158
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)