Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F033705.433ON21121111201e-157
KAFR0E039305.433ON2112157581e-102
CAGL0A02794g5.433ON2162197511e-101
Suva_2.5395.433ON2272297471e-100
YDR367W (KEI1)5.433ON2212237441e-100
KNAG0C049205.433ON2172197373e-99
Smik_4.6335.433ON2212237364e-99
Skud_4.6365.433ON2342337253e-97
TDEL0E019205.433ON2202166462e-85
Kpol_1062.305.433ON2142086365e-84
SAKL0G02508g5.433ON2282256212e-81
TPHA0E017705.433ON2172046183e-81
ZYRO0F10010g5.433ON2082066095e-80
NDAI0B056605.433ON1611615726e-75
TBLA0A065205.433ON2062045602e-72
Kwal_55.214325.433ON2072075462e-70
TBLA0G020105.433ON2131985142e-65
AER256C5.433ON2392155041e-63
KLTH0F16082g5.433ON2062064993e-63
KLLA0E21099g5.433ON2242214752e-59
Ecym_47625.433ON2212184743e-59
NCAS0C055504.87ON853138711.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03370
         (211 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   436   e-157
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   296   e-102
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   293   e-101
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   292   e-100
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   291   e-100
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   288   3e-99
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   288   4e-99
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   283   3e-97
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   253   2e-85
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   249   5e-84
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   243   2e-81
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   242   3e-81
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   239   5e-80
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   224   6e-75
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   220   2e-72
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   214   2e-70
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   202   2e-65
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   198   1e-63
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   196   3e-63
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   187   2e-59
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   187   3e-59
NCAS0C05550 Chr3 (1126188..1128749) [2562 bp, 853 aa] {ON} Anc_4...    32   1.1  

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  436 bits (1120), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 211/211 (100%), Positives = 211/211 (100%)

Query: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60
           MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY
Sbjct: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60

Query: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEE 120
           LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEE
Sbjct: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEE 120

Query: 121 ALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDD 180
           ALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDD
Sbjct: 121 ALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDD 180

Query: 181 VEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211
           VEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA
Sbjct: 181 VEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  296 bits (758), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 143/215 (66%), Positives = 168/215 (78%), Gaps = 8/215 (3%)

Query: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60
           M   S +LPK   SF G++PLYL VEIVLGIT FNK SGA+GILALFTGHPL F+QWVFY
Sbjct: 1   MRTTSFSLPK---SFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFY 57

Query: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEE 120
           LWS  TL +FAQGL+EIHKP +LTFSQI VFYS+DT+C C FTLWFT  WF  E + TE 
Sbjct: 58  LWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVE-SQTEA 116

Query: 121 A----LQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLV 176
           A    + +R E + SQGA++ YEY MTIFITL +L FR YFN +LA+FVQELL HPKY+ 
Sbjct: 117 AVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMF 176

Query: 177 DQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211
           DQDD+EQDLKNK +WKRWW+K QK  YK+C +LLA
Sbjct: 177 DQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  293 bits (751), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 171/219 (78%), Gaps = 13/219 (5%)

Query: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60
           M  + I+ PK   SFFG +PLYLGVEIVLGITI NKCSGAYGILALFTGHPLD++QW+ Y
Sbjct: 1   MRLNKISFPK---SFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISY 57

Query: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQ-------- 112
           LWS+FTLI+F+QGL+ IHKP L+ FSQILV+++ DT+ TC FTLWF++QWFQ        
Sbjct: 58  LWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHE 117

Query: 113 -TEPTGTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHH 171
            + P G  +   RR+  L SQGA+E YEY +T+  TLVTL FR+YFN +LA+FVQELL H
Sbjct: 118 TSAPVGVSQNY-RRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRH 176

Query: 172 PKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
           PKY+VDQDDVEQDLKNK   KRWWIK+QK+ YK+C H L
Sbjct: 177 PKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  292 bits (747), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 167/229 (72%), Gaps = 22/229 (9%)

Query: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60
           M    + LPK   SF G +PLYL VEIVLGI+I NKCSGAYGILALFTGHPLDF+QWV Y
Sbjct: 1   MRSSLVALPK---SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAY 57

Query: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEE 120
           LWS+FTLI+FAQGLY IHKP LL FSQI V Y++DTICTC FTLWFT+QWF  E   +  
Sbjct: 58  LWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIV 117

Query: 121 A-------------------LQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLL 161
           A                   L  R+     QGA+E+YEY +TI ITLV+L FR YFN +L
Sbjct: 118 ADASSTATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFIL 177

Query: 162 AAFVQELLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
           A+FVQELLHHPKYLVD+DDVEQDLKNKP+WKR W K+QK  YK+C +LL
Sbjct: 178 ASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  291 bits (744), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 167/223 (74%), Gaps = 16/223 (7%)

Query: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60
           M    +TLPK   SF G +PLYL VEIVLGI+I NKCSGAYGILALFTGHPLDF+QW+ Y
Sbjct: 1   MRSSLLTLPK---SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAY 57

Query: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGT-- 118
           LWS+FTLI+F+QGLY IHKP LL FSQI V Y++DTI TC FTLWFT+QWF  E T    
Sbjct: 58  LWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANID 117

Query: 119 -EEALQ----------RRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQE 167
              ALQ           R   +  Q ATE+YEY MTI ITLV+L FR YFN +LA+FVQE
Sbjct: 118 GNNALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQE 177

Query: 168 LLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
           LLHHPKYLVD+DDVEQ+LKNKP+WKR W K+QK  YK+C +LL
Sbjct: 178 LLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  288 bits (737), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 137/219 (62%), Positives = 171/219 (78%), Gaps = 12/219 (5%)

Query: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60
           M   S +LPK   +FFGI PLY+GVEIVLG+T+ NKCSGA+GILALFTGHPLD +QW  Y
Sbjct: 1   MTKLSSSLPK---TFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASY 57

Query: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPT---- 116
           LWS+FTL+++AQGLY+IHKP LLTFSQI+V +S+DT+ TC+FTLWFT  WF  E      
Sbjct: 58  LWSVFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAA 117

Query: 117 -GTEEA----LQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHH 171
            GT  +    L +R   +++QGATE+YEY+ TI IT+V+L FRLYFN LLA+FVQELL H
Sbjct: 118 MGTAASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRH 177

Query: 172 PKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
           P+YLVDQDD+EQDLKNK   +RWW+ +QK SY +C H+L
Sbjct: 178 PQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  288 bits (736), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 166/223 (74%), Gaps = 16/223 (7%)

Query: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60
           M    +TLPK   SF G +PLYL VEIVLGI+I NKCSG YGILALFTGHPLDF+QWV Y
Sbjct: 1   MRSFLLTLPK---SFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAY 57

Query: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTG--- 117
           LWS+FTLIIF+QGLY IHKP LL FSQI   Y+LDT+ TC FTLWFT+QWF  E T    
Sbjct: 58  LWSVFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGV 117

Query: 118 ----------TEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQE 167
                     + E L  RN  +  Q ATE+YEY +TI ITLV+L FR YFN +LA+FVQE
Sbjct: 118 ASQSNNSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQE 177

Query: 168 LLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
           LLHHPKYLVD+DDVEQ+LKNKP+WKR + K+QK  YK+C +LL
Sbjct: 178 LLHHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  283 bits (725), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 144/233 (61%), Positives = 169/233 (72%), Gaps = 23/233 (9%)

Query: 1   MAHHSITLPKCF-QSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVF 59
           M    +TLPK F +SF G +PLYL VEIVLGI+I NKCSGAYGILALFTGHPLDF+QWV 
Sbjct: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60

Query: 60  YLWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTE-PTG- 117
           YLWS+FTLI+F+QGLY IHKP LL FSQI + Y++DTI TC FTLWFT+QWF  E PT  
Sbjct: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDF 120

Query: 118 -------TEEALQ-------------RRNESLESQGATEAYEYMMTIFITLVTLTFRLYF 157
                   + AL+              R+     Q ATE YEY +TIFITL +L FR YF
Sbjct: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 158 NCLLAAFVQELLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
           N +L +FVQELLHHPKYLVD+DDVEQDLKNKP+WKR W K+QK  Y++C +LL
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  253 bits (646), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 123/216 (56%), Positives = 158/216 (73%), Gaps = 12/216 (5%)

Query: 5   SITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSI 64
           S+ LPK   SF G +PLY+GVEI LGI+I NKCSGAYGILALFTGHPLD +QWV Y+WSI
Sbjct: 8   SMGLPK---SFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSI 64

Query: 65  FTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTE----- 119
           FTLII  QGLY+IHKP +LTFS I + + +DT+ T  FTLWFT+QW+  E          
Sbjct: 65  FTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTK 124

Query: 120 ----EALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYL 175
               +A    +  +  QGA+E +EY +T+FIT+++L  +LYF  ++A+FVQELL HP+Y+
Sbjct: 125 SSYSDAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYM 184

Query: 176 VDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211
           +DQDDVEQDLK++  WKRWWIK+QK  YK+   LLA
Sbjct: 185 LDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  249 bits (636), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 122/208 (58%), Positives = 150/208 (72%), Gaps = 6/208 (2%)

Query: 4   HSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWS 63
           H   LP+   SFFG +PLY+GVE VLGITI NKCSGAYGILALFTGHPL+  QWV YLWS
Sbjct: 13  HYSNLPR---SFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWS 69

Query: 64  IFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQ 123
           +FTLII++QGL+++H P+LLT+SQI V +S DT  TC+FT+ F+SQWF    +G  +   
Sbjct: 70  VFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDG-- 127

Query: 124 RRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQ 183
                   QGA+E YEY  TI IT+V L  R+YFN +LAAF QEL  HPKY+VD DDVEQ
Sbjct: 128 -SGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQ 186

Query: 184 DLKNKPVWKRWWIKNQKWSYKVCSHLLA 211
           DLKNK    +WWIK++K  Y +  H+L 
Sbjct: 187 DLKNKNKIVQWWIKSKKSCYNLARHILT 214

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  243 bits (621), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 154/225 (68%), Gaps = 22/225 (9%)

Query: 6   ITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIF 65
           + LPK   SF G +PLY+GVE+ LGI+IFNK SG YGILALFTGHPLDF+QW FY  S+ 
Sbjct: 7   VHLPK---SFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVL 63

Query: 66  TLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPT--------- 116
           TL+++  GL++I KP  LT+S +LV +++DT+  C FT+WF++QWF  E           
Sbjct: 64  TLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGT 123

Query: 117 ----------GTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQ 166
                     G  + L RRN SL SQ A++ YEY MT+  T++TL  R YFN +LAAFVQ
Sbjct: 124 SKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQ 183

Query: 167 ELLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211
           ++L HPKY+VD+DDVEQDLKNK +++R  IK++KW Y  C   LA
Sbjct: 184 QMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  242 bits (618), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 146/204 (71%), Gaps = 3/204 (1%)

Query: 8   LPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTL 67
           LPK   SFFG +PLY+GVE VLGITIFNKCSG YGILALFTGHPL  +QWV YLWS FTL
Sbjct: 17  LPK---SFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTL 73

Query: 68  IIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQRRNE 127
           +I+AQGL+++H P LLT+ QIL+ YS DTICTC FT++F S WF  E    +        
Sbjct: 74  LIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTV 133

Query: 128 SLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDLKN 187
              +QGA+E+ E+  T+ +TL+ L  R YFN +LA+F Q+L  HPKY++DQDDVEQDLKN
Sbjct: 134 DKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKN 193

Query: 188 KPVWKRWWIKNQKWSYKVCSHLLA 211
           K +  +WWIK++K  Y      LA
Sbjct: 194 KSIIVQWWIKSKKRCYYTSKRFLA 217

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  239 bits (609), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 153/206 (74%), Gaps = 4/206 (1%)

Query: 6   ITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIF 65
           + LPK    F G +PLY+GVE+ LG+TI NKCSG +GILALFTGHPL+F+QWV YLWSIF
Sbjct: 5   LNLPK---RFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIF 61

Query: 66  TLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEP-TGTEEALQR 124
           + +++AQGL+   KP+LL FSQI + +S+DT  TC+FTLWFT+QW+  E  T T++++  
Sbjct: 62  SFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAA 121

Query: 125 RNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQD 184
                 +QGA++++E++MTIFITL +L  RLYFN +LA+FVQ LL HP+Y+VD  DVEQ+
Sbjct: 122 AAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQE 181

Query: 185 LKNKPVWKRWWIKNQKWSYKVCSHLL 210
           L+ +PVWKR W + Q    +    LL
Sbjct: 182 LRTQPVWKRVWTRTQIRCLRYSKQLL 207

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  224 bits (572), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 130/161 (80%), Gaps = 4/161 (2%)

Query: 55  VQWVFYLWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQ-- 112
           +QWV YLWSIF LIIFAQGLY+IHKPTLLTFSQI VF++LDT+ TC FTLWFT+QWFQ  
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 113 --TEPTGTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLH 170
                  T   +Q+R+ SL SQGAT  YEY +T+ IT +TLTFR YFNC+LA+FVQELL 
Sbjct: 61  EGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLS 120

Query: 171 HPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211
           +PK+++DQDDVEQDLKNK + KRWWIKN+K+ Y++C  +L+
Sbjct: 121 NPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  220 bits (560), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 143/204 (70%), Gaps = 12/204 (5%)

Query: 8   LPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTL 67
           LPK    F G+ PLYLGVE+VLGITIFNKC GAYGILALF GHPL+F QWV Y WSI  L
Sbjct: 15  LPK---RFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCL 71

Query: 68  IIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQRRNE 127
            I+AQGL ++H+PTL TFSQ+ +F+S+DT+ TC FT++FT +WF    T    A      
Sbjct: 72  AIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPPA------ 125

Query: 128 SLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDLKN 187
              +QGA++AYEY +++ +TL +L  RLYFN ++ +F+QEL   P Y +D D+VE +L++
Sbjct: 126 ---AQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETELRH 182

Query: 188 KPVWKRWWIKNQKWSYKVCSHLLA 211
             + +R W++NQ + Y +   +L+
Sbjct: 183 SSLLRRLWLQNQHYCYILSRRILS 206

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  214 bits (546), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 138/207 (66%), Gaps = 18/207 (8%)

Query: 23  LGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQGLYEIHKPTL 82
           +GVEI LGIT+ NKCSG YGIL L TGH LDF+QWV YL SI T+I+++ GL  I+KP++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 83  LTFSQILVFYSLDTICTCIFTLWFTSQWFQ------TEPTGTE------------EALQR 124
           L++S IL+ ++ DT+ TC FTLWF+ QWF       T+P  T               + +
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 125 RNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQD 184
           R ++L SQ A++  EY  TI +T+  L  R YFN ++ AFVQ LL HPKY+VDQDDVEQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 185 LKNKPVWKRWWIKNQKWSYKVCSHLLA 211
           LK++   +RWWI+ +  SYK+C   LA
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  202 bits (514), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 100/198 (50%), Positives = 137/198 (69%), Gaps = 8/198 (4%)

Query: 2   AHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYL 61
           + +S  LP    SFF + PLYLGVE++LGI I NKCSG YGILALFTGHPL  VQW+ Y+
Sbjct: 7   SSYSKVLP---NSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYI 63

Query: 62  WSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTG--TE 119
           WSIFTL+I+ QG++ I KP +  FSQI   +SLDTI T   TL+F   WF ++ +   +E
Sbjct: 64  WSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSE 123

Query: 120 EALQRRNESLE---SQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLV 176
            +LQR  + +E    QGA+  YE  + + +TL TL  R Y+N +LA+F+ +L  +PK+++
Sbjct: 124 NSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183

Query: 177 DQDDVEQDLKNKPVWKRW 194
           DQDDVE DLKNK  +K++
Sbjct: 184 DQDDVETDLKNKSFFKKF 201

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  198 bits (504), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 101/215 (46%), Positives = 137/215 (63%), Gaps = 16/215 (7%)

Query: 8   LPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTL 67
           LPK   SFFG+ PLY+GVE+ LGI IFNK  G +G+LALFTGHPLD +QW+FYLWS  TL
Sbjct: 29  LPK---SFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTL 84

Query: 68  IIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWF------------QTEP 115
           +++  GL +I++P L  +  +LV YS DTI TC++TLWFT  WF            + + 
Sbjct: 85  LVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDDA 144

Query: 116 TGTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYL 175
             T+ ++   NE +  Q A+++YEY  T+  TL  L+ R Y N L+A+FVQ +  H K+ 
Sbjct: 145 DATQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFA 204

Query: 176 VDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
              DDVEQDLK+K V  R + K Q+W Y +C   L
Sbjct: 205 AGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  196 bits (499), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (68%), Gaps = 17/206 (8%)

Query: 23  LGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQGLYEIHKPTL 82
           +GVEI LGITI NKCSG YGIL L TGH LDF+QWV YL S+FTL++++ GL  ++KP L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 83  LTFSQILVFYSLDTICTCIFTLWFTSQWF---QTEPTGTEEALQR--------------R 125
            T++ +L+ ++ DT+ TC FTLWF+  WF   ++E +    A Q+              R
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 126 NESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDL 185
            E+L SQ A++A EY  TI ++L+ L  R YFN ++ AFVQ L  HPKYLVDQDDV+QDL
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 186 KNKPVWKRWWIKNQKWSYKVCSHLLA 211
           K+K +W+RWWI+ + WSY+VC H LA
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  187 bits (475), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 134/221 (60%), Gaps = 20/221 (9%)

Query: 6   ITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIF 65
           + LP+ F S+    PLY+GVE+ LG+  FNK SG YG+LALFTGHPLDFVQW FY+WSIF
Sbjct: 8   VHLPQTFLSY----PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIF 63

Query: 66  TLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQRR 125
            L++F  G+ +++KP +L  S +   +S+DTI +CI+ LWFT+ WF  E +     L+  
Sbjct: 64  CLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSA 123

Query: 126 NESL----------------ESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELL 169
             +L                 S+ A+  YE+ + I +TLV L  R YFN ++ AF Q+LL
Sbjct: 124 GTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLL 183

Query: 170 HHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
              K+  DQ+D+E +L N+ +  +W  K +KW + +C   L
Sbjct: 184 RSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  187 bits (474), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 93/218 (42%), Positives = 128/218 (58%), Gaps = 22/218 (10%)

Query: 13  QSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQ 72
           QSFFG+ PLY+GVE+ LG+ IFNK  G YGILALFTG PLD +QW FY+WS   L++F +
Sbjct: 6   QSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTK 64

Query: 73  GLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPT---------------- 116
           GL +++KP L+T+  +L  YSLDT+  C F + FT  WF  E T                
Sbjct: 65  GLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVD 124

Query: 117 ----GTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHP 172
               GT+    RR    ++Q A+  YEY  TI +TL+    R Y N ++A+FV+ ++   
Sbjct: 125 VGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQN 183

Query: 173 KYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210
           +Y+ + DDVE DLKN  V  R ++  Q+W Y  C   L
Sbjct: 184 RYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>NCAS0C05550 Chr3 (1126188..1128749) [2562 bp, 853 aa] {ON} Anc_4.87
           YGR150C
          Length = 853

 Score = 32.0 bits (71), Expect = 1.1,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 60/138 (43%), Gaps = 37/138 (26%)

Query: 62  WSIFTLIIFAQGLYEIHKPTLLTFSQIL--------------VFY---------SLDTIC 98
           W+IF+ + F   L + H P ++T++++L              +F+         S+DT+ 
Sbjct: 341 WNIFSTMKF---LSKEHSPDIITYNKMLQICMQERDYARAIDLFHEVSDMKLIPSVDTLT 397

Query: 99  TCIFTLWFTSQWFQTEPTGTEEALQ----RRNESLESQGATEAYEYMMTIFITL------ 148
             I  L   S     E  G +E+L+    +    L   G  E  E +++  +TL      
Sbjct: 398 ILIKVLAVCSG-NTMESDGKQESLRLMGWKYCHELIKLGGWEENEKILSAMLTLSAYDGD 456

Query: 149 VTLTFRLYFNCLLAAFVQ 166
           V+LT  LYF C++  F Q
Sbjct: 457 VSLTRALYFKCIMKRFFQ 474

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.141    0.470 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,155,161
Number of extensions: 948498
Number of successful extensions: 3091
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3135
Number of HSP's successfully gapped: 27
Length of query: 211
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 106
Effective length of database: 41,441,469
Effective search space: 4392795714
Effective search space used: 4392795714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)