Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F033605.432ON50947722700.0
NDAI0B056505.432ON46240117120.0
KAFR0E039205.432ON49743016670.0
YOR119C (RIO1)5.432ON48448616660.0
Skud_15.2825.432ON48548816530.0
Smik_15.2975.432ON48648916500.0
Suva_8.1725.432ON48648916390.0
KNAG0C049305.432ON49648616360.0
Kpol_1062.315.432ON51343316010.0
SAKL0G02486g5.432ON50050515940.0
TBLA0A037605.432ON50442915900.0
TPHA0E017805.432ON50843915750.0
CAGL0L11594g5.432ON50748715700.0
KLLA0E21121g5.432ON52650515720.0
TDEL0E019305.432ON50242315440.0
AER257W5.432ON47749515370.0
Kwal_55.214335.432ON47643315260.0
KLTH0F16104g5.432ON54049314990.0
Ecym_47635.432ON53850014680.0
ZYRO0F09988g5.432ON46042813161e-178
CAGL0H08019g2.44ON4251751341e-07
TPHA0H009202.44ON4291741197e-06
Smik_14.1252.44ON4201511188e-06
Skud_14.1292.44ON4251521161e-05
Suva_14.1362.44ON4261521161e-05
KNAG0F010602.44ON4281531142e-05
NCAS0G015802.44ON4241521143e-05
YNL207W (RIO2)2.44ON4251521115e-05
KAFR0A077602.44ON4251741107e-05
Ecym_64492.44ON4171391091e-04
TDEL0A008602.44ON4191361091e-04
ABL166W2.44ON4141431081e-04
NDAI0F036002.44ON4211511072e-04
Kpol_400.72.44ON4251391072e-04
Kwal_23.45632.44ON4251381036e-04
ZYRO0C10340g2.44ON416153980.002
SAKL0E13552g2.44ON419174970.003
TBLA0G003702.44ON444214870.044
KLTH0B07722g2.44ON428142850.075
KLLA0D19008g2.44ON422173850.080
TBLA0C058001.180ON98170790.58
KLLA0F15576g5.200ON51251770.72
Ecym_11191.104ON79149751.5
NDAI0C033405.73ON241477751.8
Kpol_2002.985.200ON56863714.5
NCAS0C011808.702ON77983697.9
KLTH0B03432g5.200ON50958689.5
Kwal_33.136651.144ON211948699.6
KAFR0D036401.509ON91645689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03360
         (509 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   879   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   664   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   646   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   646   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   641   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   640   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   635   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   634   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   621   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   618   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   617   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   611   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   609   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   610   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   599   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   596   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   592   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   582   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   570   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   511   e-178
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    56   1e-07
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    50   7e-06
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    50   8e-06
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    49   1e-05
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    49   1e-05
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    49   2e-05
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      49   3e-05
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    47   5e-05
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    47   7e-05
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    47   1e-04
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    47   1e-04
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    46   1e-04
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    46   2e-04
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    46   2e-04
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    44   6e-04
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    42   0.002
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    42   0.003
TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44 ...    38   0.044
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    37   0.075
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    37   0.080
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    35   0.58 
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    34   0.72 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    33   1.5  
NDAI0C03340 Chr3 complement(762096..769340) [7245 bp, 2414 aa] {...    33   1.8  
Kpol_2002.98 s2002 (234791..236497) [1707 bp, 568 aa] {ON} (2347...    32   4.5  
NCAS0C01180 Chr3 (219229..221568) [2340 bp, 779 aa] {ON} Anc_8.702     31   7.9  
KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {...    31   9.5  
Kwal_33.13665 s33 complement(339375..345734) [6360 bp, 2119 aa] ...    31   9.6  
KAFR0D03640 Chr4 (710080..712830) [2751 bp, 916 aa] {ON} Anc_1.5...    31   9.7  

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/477 (91%), Positives = 436/477 (91%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAK          
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180
                 LPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
           FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300
           PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360
           EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420
           VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420

Query: 421 SAAEQFDLKAQDATTXXXXXXXXXXXXXXXXXXXXXXXXXKVLKGKRYEDKDAKKLR 477
           SAAEQFDLKAQDATT                         KVLKGKRYEDKDAKKLR
Sbjct: 421 SAAEQFDLKAQDATTDEEDEISEEDFDGEDDDDEGYESEEKVLKGKRYEDKDAKKLR 477

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/401 (81%), Positives = 351/401 (87%), Gaps = 26/401 (6%)

Query: 38  MSFTRSKTNKDKANRATVENVLDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 97
           MSFT+ KTNKDKANRATVENVLDPRTM+FLKALTSRGVISDFNGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 98  DSKLHADVVLEAKXXXXXXXXXXXXXXXXLPIDHN------LKEKLETELRPEMLTKVSQ 151
           DSKLH+D   E                   P D N      LKEKLET++ PE  T++ +
Sbjct: 61  DSKLHSDDTDE-------------------PHDDNNIDEEALKEKLETQINPEE-TRLQK 100

Query: 152 DKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQS 211
           DKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQS
Sbjct: 101 DKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQS 160

Query: 212 GVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQI 271
            VIPVPKPIEVKNNVL+MEFL RGDGFASPRL+D+PYKDREE+ HYYH  +AYMRLMYQ+
Sbjct: 161 NVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQV 220

Query: 272 CRLVHADLSEYNILIHKDKMYIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFP 331
           CRLVHADLSEYNILIH + MYIIDVSQSVEPEHPMSLDFLRMDIKNIN YF++MGIDIFP
Sbjct: 221 CRLVHADLSEYNILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFP 280

Query: 332 ERVIFQFIISDTLENFNGDYRDYNDLRDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEG 391
           ERVIFQFIIS+TL+ F G+Y DYNDLRDYVA+ LPIKK+ QDEAEDEIFRSLYLVRNLEG
Sbjct: 281 ERVIFQFIISETLDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEG 340

Query: 392 LEERDFDRYTDGKFDLLKSLIAHDNEKNFSAAEQFDLKAQD 432
           LEERDFDRYTDGKFDLLKSLIAHDNEKNFSAAEQF+++  D
Sbjct: 341 LEERDFDRYTDGKFDLLKSLIAHDNEKNFSAAEQFEIQDDD 381

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/430 (72%), Positives = 359/430 (83%), Gaps = 18/430 (4%)

Query: 1   MSLEDKFDRLNISN-EPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVL 59
           MS+EDKFD L IS     ++H NN+ILDKY HK KT+E S +R KTNKDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 60  DPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXX 119
           DPRTM+FL+AL SRGVIS F+GCLSTGKEANVYHAFAG  +    V    +         
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMS----- 115

Query: 120 XXXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEF 179
                  +P+D +     E   + +     +  ++EYA+KI+KTSILVFKDRERYVDGEF
Sbjct: 116 -------VPVDPS-----ELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEF 163

Query: 180 RFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFA 239
           RFRN+RSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIE+KNNVLVMEFL RGDGFA
Sbjct: 164 RFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFA 223

Query: 240 SPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQS 299
           SPRLKDHPYKDREEIFHYYHT+VAY+RL+YQ+C LVHADLSEYN L+H+ ++Y+IDVSQS
Sbjct: 224 SPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQS 283

Query: 300 VEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRD 359
           VEPEHPMSLDFLRMDIKN+NFYFEKMGIDIFPER+IFQF+IS+TL+ FNGDY+  +DLRD
Sbjct: 284 VEPEHPMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRD 343

Query: 360 YVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKN 419
           YV QNLPIK + QDEAEDEIFRSLYLVRNL GLEERDFDRYT+G+FDLLKSL+AHDNEKN
Sbjct: 344 YVRQNLPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKN 403

Query: 420 FSAAEQFDLK 429
           F+A+EQ++L+
Sbjct: 404 FAASEQYELE 413

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/486 (66%), Positives = 374/486 (76%), Gaps = 43/486 (8%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MSLEDKFD L++S +  ++H NN++L+KY HK KTDE+SF+R+KT+KDKANRATVENVLD
Sbjct: 1   MSLEDKFDSLSVS-QGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLD 59

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLK++ +RGVI+D NGCLSTGKEANVYHAFAG  K  A V+ E            
Sbjct: 60  PRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGK--APVIDE------------ 105

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180
                    +    E LET+            + EYA+KI+KTSILVFKDRERYVDGEFR
Sbjct: 106 ---------ETGQYEVLETD----------GSRAEYAIKIYKTSILVFKDRERYVDGEFR 146

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
           FRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGVIP PKPIEVKNNVLVMEFL RG+GFAS
Sbjct: 147 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFAS 206

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300
           P+LKD+PYK+R+EIFHYYHT+VAYMRL+YQ+CRLVHADLSEYN ++H DK+Y+IDVSQSV
Sbjct: 207 PKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSV 266

Query: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360
           EPEHPMSLDFLRMDIKN+N YFEKMGI IFPERVIFQF+IS+TLE F GDY + + L  Y
Sbjct: 267 EPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAY 326

Query: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420
           +A NLPIK +EQDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKSLIAHDNE+NF
Sbjct: 327 IASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNF 386

Query: 421 SAAEQFDLKAQDATTXXXXXX---------XXXXXXXXXXXXXXXXXXXKVLKGKRYEDK 471
           +A+EQF+    D                                     KVLKGK++EDK
Sbjct: 387 AASEQFEFDNADHECSSGTEEFSDDEEDGSSGSEEDDEEEGEYYDDDEPKVLKGKKHEDK 446

Query: 472 DAKKLR 477
           D KKLR
Sbjct: 447 DLKKLR 452

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/488 (66%), Positives = 376/488 (77%), Gaps = 46/488 (9%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MSLED+FDRL +S    ++H NN++L+KY HK KTDE+SF+++KT+KDKANRATVENVLD
Sbjct: 1   MSLEDRFDRLTVSQRA-SDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLD 59

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLK++ +RGVI+D NGCLSTGKEANVYHAFAG  K  A V+ E            
Sbjct: 60  PRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--APVIDEETGQY------- 110

Query: 121 XXXXXXLPIDHNLKEKLETE-LRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEF 179
                         E LET+ LR           KEYA+KI+KTSILVFKDRERYVDGEF
Sbjct: 111 --------------EVLETDGLR-----------KEYAIKIYKTSILVFKDRERYVDGEF 145

Query: 180 RFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFA 239
           RFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSGVIP P+P+EVKNNVLVMEFL RG+GFA
Sbjct: 146 RFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFA 205

Query: 240 SPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQS 299
           SP+L+D+PY+DREEIFHYYHT+VAYMRL+YQ+CRLVHADLSEYN +IH DK+Y+IDVSQS
Sbjct: 206 SPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQS 265

Query: 300 VEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRD 359
           VEPEHPMSLDFLRMDIKN+N YFEKMG+ IFPERVIFQF+IS++LE F GDY +  DL  
Sbjct: 266 VEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVG 325

Query: 360 YVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKN 419
           Y+A+NLPIK +EQDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKSLIAHDNE+N
Sbjct: 326 YIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERN 385

Query: 420 FSAAEQFDLKAQDATTXXXXXXXXXXXXXXXXXXXXXXXXX----------KVLKGKRYE 469
           F+A+EQF+    D  +                                   K+LKGK+YE
Sbjct: 386 FAASEQFEFDNADHESSSDLEESSDEEGDNSSGGEEDEESDDREYYEDDEPKILKGKKYE 445

Query: 470 DKDAKKLR 477
           DKD KKLR
Sbjct: 446 DKDIKKLR 453

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/489 (66%), Positives = 372/489 (76%), Gaps = 47/489 (9%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MSLED FD+L +S    ++H NN++L+KY HK KTDE+SF R+KT+KDKANRATVENVLD
Sbjct: 1   MSLEDNFDKLTVSQRA-SDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLD 59

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLK++ +RGVI+D NGCLSTGKEANVYHAFAG  K  A V+ E            
Sbjct: 60  PRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--APVIDEETGKY------- 110

Query: 121 XXXXXXLPIDHNLKEKLETE-LRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEF 179
                         E LET+  RP           EYA+KI+KTSILVFKDRERYVDGEF
Sbjct: 111 --------------EVLETDGPRP-----------EYAIKIYKTSILVFKDRERYVDGEF 145

Query: 180 RFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFA 239
           RFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGVIP PKPIEVKNNVLVMEFL RG+GFA
Sbjct: 146 RFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFA 205

Query: 240 SPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQS 299
           SP+LKD+PY+DR EIFHYY+T+VAYMRL+YQ+CRLVHADLSEYN +IH DK+++IDVSQS
Sbjct: 206 SPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQS 265

Query: 300 VEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRD 359
           VEPEHPMSLDFLRMDIKN+N YFEKMGI IFPERVIFQF+IS++LE F  DY +  DL  
Sbjct: 266 VEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVG 325

Query: 360 YVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKN 419
           Y+A+NLPIK +EQDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKSLIAHDNE+N
Sbjct: 326 YIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERN 385

Query: 420 FSAAEQFDLKAQDATTXXXXXXXXXXXXXXXXXXXXXXXXX-----------KVLKGKRY 468
           F+A+EQF+    D T+                                    K+LKGKRY
Sbjct: 386 FAASEQFEFDNADHTSGSGSEEFSDDEDDSSENDKEGNEESDDCAYYEDDEPKILKGKRY 445

Query: 469 EDKDAKKLR 477
           EDKD KKLR
Sbjct: 446 EDKDVKKLR 454

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/489 (65%), Positives = 375/489 (76%), Gaps = 47/489 (9%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MS EDKF++L +S    ++H NN++LDK+ HK KTDE+SF+++KT+KDK+NRATVENVLD
Sbjct: 1   MSFEDKFEKLTVSQRA-SDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLD 59

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLK++ +RGVI+D NGCLSTGKEANVYHAFAG  K  A VV E            
Sbjct: 60  PRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--APVVDEETGKY------- 110

Query: 121 XXXXXXLPIDHNLKEKLETE-LRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEF 179
                         E LET+ LR            EYA+KI+KTSILVFKDRE+YVDGEF
Sbjct: 111 --------------EVLETDGLRA-----------EYAIKIYKTSILVFKDREKYVDGEF 145

Query: 180 RFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFA 239
           RFRN+RSQHNPRKMIKIWAEKEFRNL+RI+QSGVIP PKP+EVKNNVLVMEFL RGDGFA
Sbjct: 146 RFRNARSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPKPVEVKNNVLVMEFLSRGDGFA 205

Query: 240 SPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQS 299
           SP+LKD+PYKDREEIFHYY+T+VAYMRL+YQ+CRLVHADLSEYN +IH D++Y+IDVSQS
Sbjct: 206 SPKLKDYPYKDREEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDQLYMIDVSQS 265

Query: 300 VEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRD 359
           VEPEHPMSLDFLRMDIKN+N YFEKMGI+IFPERVIFQF+IS+ LE F GDY++  DL  
Sbjct: 266 VEPEHPMSLDFLRMDIKNVNLYFEKMGINIFPERVIFQFVISEVLEKFKGDYKNVPDLIG 325

Query: 360 YVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKN 419
           Y+++NLPIK +EQDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKSLIAHDNE+N
Sbjct: 326 YISKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERN 385

Query: 420 FSAAEQFDLKAQD-----------ATTXXXXXXXXXXXXXXXXXXXXXXXXXKVLKGKRY 468
           F+A+EQF+    D            +                          K+LKGK+Y
Sbjct: 386 FAASEQFEFNDNDHGSAPESEESSGSEYEDLSGSEEDEDDSDDSEYYDDDEPKILKGKKY 445

Query: 469 EDKDAKKLR 477
           EDKD KKLR
Sbjct: 446 EDKDVKKLR 454

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/486 (65%), Positives = 368/486 (75%), Gaps = 31/486 (6%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTR-SKTNKDKANRATVENVL 59
           MS+E+KF++L+I +  + + ANNK+LDKY HK K D+ SF++  KT KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 60  DPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXX 119
           DPRTMRFL+AL +RG+ISDFNGCLSTGKEANVYHAFAGD    A                
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRA---------------- 104

Query: 120 XXXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEF 179
                  LP + +L  +L  E R   +      KKEYA+KIFKTSILVFKDRERYVDGEF
Sbjct: 105 ----SGTLPDEESLLARLTQEERA--VQASVGGKKEYAIKIFKTSILVFKDRERYVDGEF 158

Query: 180 RFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFA 239
           RFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSG +PVPKP+EVKNNVLVMEFL RGDGFA
Sbjct: 159 RFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFA 218

Query: 240 SPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQS 299
           SPRL+D+PYKD + I  YY T+VAYMRLMYQ+C LVHADLSEYN+L+H D++YIIDVSQS
Sbjct: 219 SPRLRDYPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQS 278

Query: 300 VEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRD 359
           V+PEHPMSLDFLRMDIKN+N YF KMGIDIFPER+IFQF+IS++L+ F GDY+   DL +
Sbjct: 279 VQPEHPMSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTE 338

Query: 360 YVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKN 419
           YV  NLP+KK+EQDE EDE+FRSLYLVRNLEGLEERDFDR+T+GKFDLLKSL+AHD EKN
Sbjct: 339 YVESNLPVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKN 398

Query: 420 FSAAEQ---FD-----LKAQDATTXXXXXXXXXXXXXXXXXXXXXXXXXKVLKGKRYEDK 471
           F+AAEQ   FD                                      KVLKGK+YEDK
Sbjct: 399 FTAAEQQFEFDDENDSSSGSQDDDGEDEDEEESDGEDEEDVYYTTDDEDKVLKGKKYEDK 458

Query: 472 DAKKLR 477
           DAKKLR
Sbjct: 459 DAKKLR 464

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/433 (69%), Positives = 356/433 (82%), Gaps = 9/433 (2%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MS ++KFDRL IS        N +IL+KY HK KTDE+SFT+ KTNKDKANRATVENVLD
Sbjct: 1   MSFDEKFDRLKISGN----DVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLD 56

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLKALT+RGVIS FNGCLSTGKEANVYHAFAGD     +  ++ +          
Sbjct: 57  PRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEV 116

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180
                    D+N    ++   +PE +    + +KEYA+KI+KTSILVFKDRERYVDGE+R
Sbjct: 117 NQDSEEDNGDNNNVADIDGS-KPEGV----ELRKEYAIKIYKTSILVFKDRERYVDGEYR 171

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
           FRNSRSQHNPRKMIKIWAEKEFRNLRRI+QSGVIP PKP+EVK+NVLVMEFL RG+GFAS
Sbjct: 172 FRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFAS 231

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300
           PRLKD+PYKDR+EIF YYH +VAYMRL+YQ+CRLVHADLSEYN ++H+ K+Y+IDVSQSV
Sbjct: 232 PRLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSV 291

Query: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360
           EPEHPMSLDFLRMDIKN+N YFEKMGIDIFPER+IFQF+IS+ LE F GD    +DLR++
Sbjct: 292 EPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREF 351

Query: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420
           V  NLPIK +++DEAEDE+FRSL+LVRNL GLEERDFDR+TDGKFDLLK+LIA DN+KNF
Sbjct: 352 VKNNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNF 411

Query: 421 SAAEQFDLKAQDA 433
           +A+EQ+ ++  DA
Sbjct: 412 TASEQYGMEDLDA 424

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/505 (62%), Positives = 372/505 (73%), Gaps = 65/505 (12%)

Query: 1   MSLEDKFDRLNISNEP--RTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENV 58
           MS+E  F +L++ + P    +H N++ILDKY H+ KTDE+S TR KTNKDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 59  LDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXX 118
           LDPRTMRFL+ L SRGV+SD NGCLSTGKEANVYHAFAG++                   
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNA------------------- 101

Query: 119 XXXXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGE 178
                       +   E+ E + + E++      K+EYAVKI+KTSILVFKDRERYVDGE
Sbjct: 102 ------------NQPSEEAEKDSKDELV------KREYAVKIYKTSILVFKDRERYVDGE 143

Query: 179 FRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGF 238
           FRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSGVIP P+PIEV++NVLVMEFL RG+GF
Sbjct: 144 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGF 203

Query: 239 ASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQ 298
           ASPRLKDHPYKDREEI +YYHT+VAYMRL+YQ+C+LVHADLSEYN ++H D++Y+IDVSQ
Sbjct: 204 ASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQ 263

Query: 299 SVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLR 358
           SV+PEHPMSLDFLRMDIKNIN YFEK GIDIFPERVIFQFIIS+TL+ F GDY +  DLR
Sbjct: 264 SVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLR 323

Query: 359 DYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK 418
           DYV++NLP+K + +DEAEDE+FRSL+LVRNL GLEERDFDR+TDGKFDLLKSLIAHDN+K
Sbjct: 324 DYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKK 383

Query: 419 ---NFSAAEQF--------------DLKAQD---------ATTXXXXXXXXXXXXXXXXX 452
              NF+A+EQF              DL  +D          +                  
Sbjct: 384 NATNFNASEQFEIDSSDEDSEDEFPDLDGEDLESDGGSECGSEQLDNGEEDDSEEDDDEE 443

Query: 453 XXXXXXXXKVLKGKRYEDKDAKKLR 477
                   K  KGK+YEDKDAK+LR
Sbjct: 444 YDDDRKNLKDPKGKKYEDKDAKRLR 468

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/429 (70%), Positives = 349/429 (81%), Gaps = 23/429 (5%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           M L+D F +L++SN     H NN+ILDK+ HK KTDE S +R KTNKDKANRATVENVLD
Sbjct: 1   MVLDDDFQKLDLSNN----HDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLD 56

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLKALTSRG+ISDFNGC+STGKEANVYHAFAGD+        E K          
Sbjct: 57  PRTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTI----SPFEPKTHDSF----- 107

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180
                      NL    +    P     + + +KEYA+KI+KTSILVFKDRERYVDGE+R
Sbjct: 108 ----------ENLVNTYDPYSNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYR 157

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
           FRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIPVPKPIEVKNNVLVMEFL RGDGFAS
Sbjct: 158 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFAS 217

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300
           PRLKD+PYKD  +I HYYHT++ Y+RL+YQ+CRLVHADLSEYN L+HK+K+Y+IDVSQSV
Sbjct: 218 PRLKDYPYKDHNDIVHYYHTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSV 277

Query: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360
           EPEHPMSLDFLRMDIKNIN YFE+MG+ IF ER+IFQF IS+TL+NFNG+Y + +DLR Y
Sbjct: 278 EPEHPMSLDFLRMDIKNINNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMY 337

Query: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420
           V  NLP+K   +D+AEDEIFRSL+LVRNL GLEERDFDRYTDGKFDLLKSLIAHDNEKNF
Sbjct: 338 VKNNLPLKVPGKDDAEDEIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 397

Query: 421 SAAEQFDLK 429
           SA+EQ++ +
Sbjct: 398 SASEQYNFE 406

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/439 (68%), Positives = 353/439 (80%), Gaps = 34/439 (7%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MSLE KFD+L +     +EH N+KIL+KY HK KTDE+S T+ KTNKDKANRATVENVLD
Sbjct: 1   MSLEGKFDKLKVH---ESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLD 57

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTM+ LK L +RGVI +FNGCLSTGKEANVYHAFAGD K+  +  +             
Sbjct: 58  PRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEV------------- 104

Query: 121 XXXXXXLPIDHNLKEKLETELRP-----------EMLTKVSQDKKEYAVKIFKTSILVFK 169
                 LP    L++ L  EL P           E  T++ Q +KEYA+KI+KTSILVFK
Sbjct: 105 ------LPQISELEDVLNKELIPGQIEVPTIKSEEEQTQLKQ-RKEYAIKIYKTSILVFK 157

Query: 170 DRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVM 229
           DRERYVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLRRI+QSG+IP P+P+EVK N+LVM
Sbjct: 158 DRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVM 217

Query: 230 EFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKD 289
           EFLGRGDGFASPRL+DH YK REEI +YYHT+VAY+RL+YQ+CRLVHADLSEYN ++H D
Sbjct: 218 EFLGRGDGFASPRLRDHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD 277

Query: 290 KMYIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNG 349
           K+Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMGIDIFPER+IFQF+IS  L+ F G
Sbjct: 278 KLYVIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTG 337

Query: 350 DYRDYNDLRDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLK 409
           D R   DLR+Y+A  LP+K +++DE +DEIFRSL+LVRNL+GLEERDFDR+TDGKFDLLK
Sbjct: 338 DPRSSVDLRNYIAHYLPVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLK 397

Query: 410 SLIAHDNEKNFSAAEQFDL 428
           +LIA DN+KNF+A+ QFD 
Sbjct: 398 TLIASDNQKNFTASTQFDF 416

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/487 (62%), Positives = 363/487 (74%), Gaps = 27/487 (5%)

Query: 3   LEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLDPR 62
           L DKF  + +S    T+H NN+I+DKY HK KTDE+S  ++KTNKDKANRATVENVLDPR
Sbjct: 4   LSDKFRNVKVS----TDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPR 59

Query: 63  TMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXXXX 122
           TMRFL AL +RGVI+  NGCLSTGKEANVYHAFAG SK+  +   ++             
Sbjct: 60  TMRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAG-SKMATE--QQSDEPKEDIDANAIP 116

Query: 123 XXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFRFR 182
               + I  N  +  E  +R        + +KEYA+KI+KTSIL+FKDRERYVDGEFRFR
Sbjct: 117 SKGNIDISENRAKTAEDLIR--------EGRKEYAIKIYKTSILIFKDRERYVDGEFRFR 168

Query: 183 NSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASPR 242
           NSRSQHNPRKMIKIWAEKEFRNL+RIYQ GVIP P+PIEVKNNVLVMEFL RGDGFASP+
Sbjct: 169 NSRSQHNPRKMIKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPK 228

Query: 243 LKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSVEP 302
           L+D+PYKDREEI++YYH +V+YMRL+YQ+CRLVHADLSEYN ++HK+K+Y+IDVSQSVEP
Sbjct: 229 LRDYPYKDREEIYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEP 288

Query: 303 EHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDYVA 362
           EHPMSLDFLRMDIKN+N YFEKMGI+IF E+ IFQF+I+DTL+ F+GD   Y DLR YVA
Sbjct: 289 EHPMSLDFLRMDIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVA 348

Query: 363 QNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSA 422
            N+PIK++++DEAEDE+FRSL+LVRNLEGLEERDFDR+TDGKFDLLKSL+A DN+KN+ A
Sbjct: 349 TNIPIKRTQEDEAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIA 408

Query: 423 AEQFDLKAQDA------------TTXXXXXXXXXXXXXXXXXXXXXXXXXKVLKGKRYED 470
           A+   +    +                                       K LKGK+YED
Sbjct: 409 AQASKINVDSSDENISDSEDEGSDDGSDDDTDGSDEEEQYSEAESYEEVPKELKGKKYED 468

Query: 471 KDAKKLR 477
           KD KK R
Sbjct: 469 KDLKKQR 475

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/505 (61%), Positives = 375/505 (74%), Gaps = 40/505 (7%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           M+++DK ++LN++N  R EH N +IL++Y +  KTDE+S TR KT+KDKANRATVENVLD
Sbjct: 2   MNIDDKLEKLNLAN--RDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLD 59

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLK++ +RG++S FNGCLSTGKEANVYHAFAG+ +    +++E            
Sbjct: 60  PRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHE-ERHLLVEGHDDTIGAPQN- 117

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQD----KKEYAVKIFKTSILVFKDRERYVD 176
                   I+   ++ L  E      T  + D    KKEYAVKI+KTSILVFKDRERYVD
Sbjct: 118 --------IESTKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVD 169

Query: 177 GEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGD 236
           GEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGVIP PKPIEV++NVLVMEFL RGD
Sbjct: 170 GEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGD 229

Query: 237 GFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDV 296
           GFASPRLKDHPYKDREEI HYY+ ++AYMRL+YQ+CRLVHADLSEYN ++H+DK+YIIDV
Sbjct: 230 GFASPRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDV 289

Query: 297 SQSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYND 356
           SQSV+PEHPMSLDFLRMDIKN+N YF+K+GIDIFPERVIFQFIIS+ L+ F GDYR  +D
Sbjct: 290 SQSVQPEHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDD 349

Query: 357 LRDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDN 416
           L  YVA NLP+K +++DEAEDE+FRSL+L+RNL GLEERDFDR+TDGKFDLLKSLIA++N
Sbjct: 350 LETYVADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANEN 409

Query: 417 EK---NFSAAEQFDLKA---------------------QDATTXXXXXXXXXXXXXXXXX 452
            K   NF+A+EQ++L +                     +D                    
Sbjct: 410 RKYSENFTASEQYELSSSDDEEDDVDGDDLPNLVTDINEDDIAGSDEDDDSDETNDSSDG 469

Query: 453 XXXXXXXXKVLKGKRYEDKDAKKLR 477
                     LKGK+YEDKDAKK R
Sbjct: 470 DGWVSDKDTPLKGKKYEDKDAKKQR 494

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/423 (69%), Positives = 342/423 (80%), Gaps = 43/423 (10%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           MSLED+FDRL+IS+    EHAN +ILDK+ +  KTDE+SFTRSK++KDKANRATVENVLD
Sbjct: 1   MSLEDQFDRLDISHG--REHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLD 58

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFLK++ +RGVIS+FNGCLSTGKEANVYHAFAG+S      + ++K          
Sbjct: 59  PRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES------IEDSKD--------- 103

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180
                                       V  +KKE A+KI+KTSILVFKDRERYVDGEFR
Sbjct: 104 --------------------------GHVQGEKKELAIKIYKTSILVFKDRERYVDGEFR 137

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
           FRNSRSQHNPRKMIKIWAEKEFRNLRRI QSGVIP PKP+EVKNNVLVMEFL RGDGFAS
Sbjct: 138 FRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFAS 197

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300
           PRLKDH + DR EI+HYYHT++AY+RL+YQ+CRLVHADLSEYN ++H  K+YIIDVSQSV
Sbjct: 198 PRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSV 257

Query: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360
           EPEHPMSLDFLRMDIKNIN YFEKMGIDIFPER+IFQF+IS+TLE F+G+ +   DL +Y
Sbjct: 258 EPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNY 317

Query: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420
           V++ LP+K +  D  EDEIFRSL+LVRNLEGLEERDFDR+TDGKFDLLKSLIAHDNE++ 
Sbjct: 318 VSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHL 377

Query: 421 SAA 423
            AA
Sbjct: 378 RAA 380

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/495 (61%), Positives = 357/495 (72%), Gaps = 68/495 (13%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           M LED+  +L + ++  T+H N +IL+K+ ++ KTDE+S T+ KTNKDKANRATVENVLD
Sbjct: 1   MDLEDQLRKLKLRDD--TDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLD 58

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFL+AL +RGV+S+FNGCLSTGKEANVYHA +G                       
Sbjct: 59  PRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG----------------------- 95

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180
                             TE  PE        K EYAVKI+KTSILVFKDRERYVDGEFR
Sbjct: 96  -----------------ATEGAPE--------KSEYAVKIYKTSILVFKDRERYVDGEFR 130

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
           FRN+RS HNPRKMIKIWAEKEFRNL+RIYQSGVIP P+P+E+K+NVLVMEFL RGDGFAS
Sbjct: 131 FRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFAS 190

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300
           PRLKD+P+KDR+EI+HYYH +V+Y+RL+YQ+C+LVHADLSEYN ++H+ K+YIIDVSQSV
Sbjct: 191 PRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSV 250

Query: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360
           +PEHPMSLDFLRMDIKNIN YFE+MGIDIFPERVIFQF+IS+TL+ F GD R   DLR Y
Sbjct: 251 QPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSY 310

Query: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK-- 418
           VA NLP K++ QDEAED++FRSL+LVRNL GLEERDFDR+TDGKFDLLKSLIA DN K  
Sbjct: 311 VAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKIS 370

Query: 419 -NFSAAEQFDLKAQDATTXXXXXXXXXXXXXXXXXXXXXXXXX---------------KV 462
             F+A+EQ+DL   D                                           KV
Sbjct: 371 NTFTASEQYDLSDSDDAEDEDEDADEGQDEDGSESGTDSDSSSDDESGDDKDDYELRPKV 430

Query: 463 LKGKRYEDKDAKKLR 477
           L GK+YEDKDAKKLR
Sbjct: 431 LVGKKYEDKDAKKLR 445

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/433 (66%), Positives = 347/433 (80%), Gaps = 42/433 (9%)

Query: 1   MSLEDKFDRLNISN--EPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENV 58
           MSL+D+ D L + +  EP+ +H N +ILDK+ H  K DE+S +R KT+KDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 59  LDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXX 118
           LDPRTMRFL+ALTSRGVIS FNGC+STGKEANVYHAFA   ++ A    EA         
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFA---EIGAKNTEEA--------- 108

Query: 119 XXXXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGE 178
                                E+ P +     ++++E A+KIFKTSILVFKDRERYVDGE
Sbjct: 109 --------------------GEVLPNL-----EERRELAIKIFKTSILVFKDRERYVDGE 143

Query: 179 FRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGF 238
           FRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSG++P P+P+EV++NVLVMEFL RG+GF
Sbjct: 144 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGF 203

Query: 239 ASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQ 298
           ASPRLKD+PYKDREE  HYY+T+VAY+RL+YQ C+LVHADLSEYN ++H  ++YIIDVSQ
Sbjct: 204 ASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQ 263

Query: 299 SVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLR 358
           SV+PEHPMSLDFLRMDIKN+N YFE+M +D+FPERVIFQF+IS+TL+ F+GDY    DLR
Sbjct: 264 SVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLR 323

Query: 359 DYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK 418
           DYV++NLP+K   QDEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSLIAHDNE+
Sbjct: 324 DYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNER 383

Query: 419 ---NFSAAEQFDL 428
               F+A+EQF+L
Sbjct: 384 VASTFTASEQFEL 396

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/493 (60%), Positives = 356/493 (72%), Gaps = 53/493 (10%)

Query: 1   MSLEDKFDRLNISNEPRTE--HANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENV 58
           MSLED   +L++  +   +  H N +ILDK+ H  KTDE+S TR+KT+KDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 59  LDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXX 118
           LDPRTMRFL+AL SRGVIS+FNGCLSTGKEANVYHAFAG     ++              
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEE------------- 159

Query: 119 XXXXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGE 178
                              E ++ P        +++EYA+KI+KTSILVFKDRERYVDGE
Sbjct: 160 -------------------EQKVLPNQ-----GERREYAIKIYKTSILVFKDRERYVDGE 195

Query: 179 FRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGF 238
           FRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGV+P P+PIEVK+NVLVMEFL RGDGF
Sbjct: 196 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGF 255

Query: 239 ASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQ 298
           ASP+LKD PYKDR+E  +YYHT+VAY+RL+YQ C+LVHADLSEYN ++H  K+Y+IDVSQ
Sbjct: 256 ASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQ 315

Query: 299 SVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLR 358
           SV+PEHPMSLDFLRMDIKNIN YFE+M IDIFPER IFQF+ISD LE F G+Y +  DLR
Sbjct: 316 SVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLR 375

Query: 359 DYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK 418
            YVA+ L  K   +DEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSLIAHDN+K
Sbjct: 376 QYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQK 435

Query: 419 ---NFSAAEQFDLKAQ-----------DATTXXXXXXXXXXXXXXXXXXXXXXXXXKVLK 464
              NF+A+EQ++L +            + +                          K +K
Sbjct: 436 VASNFTASEQYELSSSSDEEVSEDEDYNESGSGSEDDDGDDESGESSDEEEWLEKSKEIK 495

Query: 465 GKRYEDKDAKKLR 477
           GK++EDKD+KK R
Sbjct: 496 GKKHEDKDSKKQR 508

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/500 (57%), Positives = 357/500 (71%), Gaps = 57/500 (11%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60
           M LE+K  RL + +   +EH N++ILDK+ ++ KTDE+S TR KT+KDKANRATVENVLD
Sbjct: 33  MDLENKLGRLKLLD--HSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLD 90

Query: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXXXXX 120
           PRTMRFL++L  RG+I++FNGCLSTGKEANVYHAF        D+V              
Sbjct: 91  PRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGN----AVDIV-------------- 132

Query: 121 XXXXXXLPIDHNLKEKLETELRPEMLTKVSQD---KKEYAVKIFKTSILVFKDRERYVDG 177
                         EK    +R   +   S+    K EYA+KI+KTSILVFKDRERYVDG
Sbjct: 133 --------------EKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDG 178

Query: 178 EFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDG 237
           EFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIY +GVI  PKPIE+K+NVLVMEFL RGDG
Sbjct: 179 EFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDG 238

Query: 238 FASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVS 297
           FASP+LKD+PY DR+EI+++YH +VAY+RL+YQ+C+LVHADLSEYN ++H+ K+YIIDVS
Sbjct: 239 FASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVS 298

Query: 298 QSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDL 357
           QSV+PEHPMSLDFLRMDIKNIN YF K+GI++F ER IFQF+IS+ LE F GDYR Y+ L
Sbjct: 299 QSVQPEHPMSLDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHL 358

Query: 358 RDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNE 417
           + Y ++ LP+K +E+DE EDEIFRSL+LVRNL GLEE DFDR+T+GKFDLLKSL++ DN+
Sbjct: 359 QKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQ 418

Query: 418 K---NFSAAEQF-----------------DLKAQDATTXXXXXXXXXXXXXXXXXXXXXX 457
           K    F+A+EQF                 DL + ++ +                      
Sbjct: 419 KVAKTFTASEQFELSDSGTDSVDHGDSDEDLSSDESNSETENDSDDSQSSDEEPDEDTRE 478

Query: 458 XXXKVLKGKRYEDKDAKKLR 477
              K  KGK+YEDKD +KLR
Sbjct: 479 HRIKEPKGKKYEDKDTRKLR 498

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  511 bits (1316), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 258/428 (60%), Positives = 312/428 (72%), Gaps = 63/428 (14%)

Query: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNK---DKANRATVEN 57
           MSLE +FDRL++S        N +IL+KYE++ +     FT  K NK   DK++RATVEN
Sbjct: 1   MSLETEFDRLHVSKH----QDNTRILEKYENRIENG--GFTSGKGNKTYKDKSDRATVEN 54

Query: 58  VLDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKXXXXXXX 117
           VLDPRTM+FL ALT+RGVIS+FNGC+S+GKEANVYHAF                      
Sbjct: 55  VLDPRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFG--------------------- 93

Query: 118 XXXXXXXXXLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDG 177
                                    PE         +E A+KI+KTSILVFKDRERYVDG
Sbjct: 94  -------------------------PE--------GQELAIKIYKTSILVFKDRERYVDG 120

Query: 178 EFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDG 237
           EFRFRNSRSQHNPRKMIKIWAEKEFRNLRRI+ SGV+P   P+EVK+NVLVM+FL RGDG
Sbjct: 121 EFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVVPTACPVEVKSNVLVMQFLNRGDG 180

Query: 238 FASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVS 297
             SPRLKD+ YKD  E+ HYY+  +AYMRL+YQ+CRLVHADLSEYNI++H++ ++IIDVS
Sbjct: 181 APSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRLVHADLSEYNIVVHQNALHIIDVS 240

Query: 298 QSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDL 357
           QSVEP HPMSLDFLRMDIKNIN YF KMG+ +F ER+IFQFII++TLE F GDY+  +DL
Sbjct: 241 QSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQERMIFQFIIAETLEGFQGDYKTADDL 300

Query: 358 RDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNE 417
            +Y+ ++LP+K   +   EDEIFRSL+LVR+L GLEERDFDR+TDGKFDLLKSLIA+DNE
Sbjct: 301 VEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLEERDFDRFTDGKFDLLKSLIANDNE 360

Query: 418 KNFSAAEQ 425
           +N    +Q
Sbjct: 361 RNLQRPQQ 368

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 25/175 (14%)

Query: 159 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPK 218
           ++ +TS    K+   Y+      RNSR   N   + K+ A KEF  +  +Y  G I VP+
Sbjct: 126 RLGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQ 178

Query: 219 PIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHAD 278
                 +V+VM+ +   DG+   RL++H     + I   Y  ++ ++  +     L+H D
Sbjct: 179 AYGCSRHVVVMDLI---DGYPMRRLREH-----KNIPKLYSDLMTFIVKLAN-SGLIHCD 229

Query: 279 LSEYNILIHKDK---------MYIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
            +E+NI+I  D+           +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 230 FNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 83/174 (47%), Gaps = 25/174 (14%)

Query: 159 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPK 218
           ++ +TS    K+   Y+      R S    N   + K+ A KE++ +  +Y  G   VP+
Sbjct: 126 RLGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPE 178

Query: 219 PIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHAD 278
           P +   +V+VME +    G+   RL+ H     ++I   Y  ++ ++ L      L+H D
Sbjct: 179 PFDNSRHVIVMELI---RGYPMRRLRKH-----KDIPKLYSDLMKFI-LQLANSGLIHCD 229

Query: 279 LSEYNILIHKDKM--------YIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
            +E+NI+I KD++         +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 230 FNEFNIMI-KDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 74/151 (49%), Gaps = 17/151 (11%)

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
            RNS    N   + ++ A KE++ +  +Y  G   VP+P +   +++VME +   +G+  
Sbjct: 142 LRNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMELI---EGYPM 197

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILI------HKDKMY-I 293
            RL+ H     + I   Y  ++ ++  +     L+H D +E+NI+I       KD  + +
Sbjct: 198 RRLRKH-----KNIPKLYSDLMCFIVELAN-SGLIHCDFNEFNIMIKNEVEDEKDCGFVV 251

Query: 294 IDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
           ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 252 IDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 75/152 (49%), Gaps = 19/152 (12%)

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
            +NS    N   + ++ A KE++ +  +Y  G   VP+P +   +++VME +   +G+  
Sbjct: 142 LKNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMELI---EGYPM 197

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKM--------Y 292
            RL+ H     + I   Y  ++ ++  +     L+H D +E+NI++ KDK+         
Sbjct: 198 RRLRKH-----KNIPKLYSDLMCFVVELAN-SGLIHCDFNEFNIMV-KDKVEDEQDCGFV 250

Query: 293 IIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
           +ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 251 VIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 74/152 (48%), Gaps = 19/152 (12%)

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
            R S    N   + ++ A KE++ +  +Y  G   VP+P +   +++VME +   +GF  
Sbjct: 142 LRKSSQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMELI---NGFPM 197

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKM--------Y 292
            RL+ H     + I   Y  ++ ++ +      L+H D +E+N++I KD++         
Sbjct: 198 RRLRKH-----KNIPKLYSDLMCFI-VQLGNSGLIHCDFNEFNVMI-KDELEDENDCGFV 250

Query: 293 IIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
           +ID  Q V  +H  +  + + D+  I  +F+K
Sbjct: 251 VIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 76/153 (49%), Gaps = 21/153 (13%)

Query: 182 RNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASP 241
           +NS++  N   + K+ A KE++ +  ++  G   VP+P +   ++++ME +    GF   
Sbjct: 144 KNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRVPEPFDHSRHIIIMELI---KGFPMT 199

Query: 242 RLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKM---------- 291
           RL+ H     + +   Y  ++ ++ L      L+H D +E+NI+I KDK+          
Sbjct: 200 RLRKH-----QNVPKLYSDLMKFI-LELGNSGLIHCDFNEFNIMI-KDKLDGSDPNDTGF 252

Query: 292 YIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
            +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 253 IVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 74/152 (48%), Gaps = 19/152 (12%)

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
            RN++   N   + ++ A KE++ +  +Y  G   VP+P +   +++VME +    G+  
Sbjct: 142 LRNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIVMELI---KGYPM 197

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDK--------MY 292
            RL+ H     + I   Y  ++ ++  +     L+H D +E+NI+I KDK          
Sbjct: 198 RRLRKH-----KNIPKLYSDLMNFIVKLGN-SGLIHCDFNEFNIMI-KDKPEDENDCGFV 250

Query: 293 IIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
           +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 251 VIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 74/152 (48%), Gaps = 19/152 (12%)

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
            + S    N   + ++ A KE++ +  +Y  G   VP+P +   +++VME +   +G+  
Sbjct: 142 LKKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMELI---EGYPM 197

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKM--------Y 292
            RL+ H     + I   Y  ++ ++  +     L+H D +E+NI+I KDK+         
Sbjct: 198 RRLRKH-----KNIPKLYSDLMCFIVDLAN-SGLIHCDFNEFNIMI-KDKLEDENDCGFV 250

Query: 293 IIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
           +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 251 VIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 85/174 (48%), Gaps = 24/174 (13%)

Query: 159 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPK 218
           ++ +TS    K++  Y+      +N+++  N   + KI A KE++ +  ++  G   VP+
Sbjct: 126 RLGRTSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPE 179

Query: 219 PIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHAD 278
             +   + +VME +    G+   RL+ H     + I   Y  +++++  +     L+H D
Sbjct: 180 AFDCSRHCIVMELI---KGYPMRRLRKH-----KNIPKLYSDLMSFIVKLGN-SGLIHCD 230

Query: 279 LSEYNILIHKDKM--------YIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
            +E+NI+I KDK+         +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 231 FNEFNIMI-KDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 71/139 (51%), Gaps = 23/139 (16%)

Query: 196 IWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIF 255
           + A KE++ +  +Y  G   VP+P +   ++++ME++    G+   RL++H  KD   ++
Sbjct: 156 LAANKEYQFMNLLYSKG-FKVPRPYDNSRHIILMEYI---KGYPMRRLREH--KDLPRLY 209

Query: 256 HYYHTIVAYMRLMYQICR--LVHADLSEYNILIHKDK--------MYIIDVSQSVEPEHP 305
                    M+ + Q+    L+H D +E+NI+I KDK          +ID  Q +  +H 
Sbjct: 210 S------ELMKFIVQLGNHGLIHCDFNEFNIMI-KDKTDGPDDLGFIVIDFPQCISIQHK 262

Query: 306 MSLDFLRMDIKNINFYFEK 324
            +  + + D++ I  +F+K
Sbjct: 263 DAEYYFQRDVECIRRFFKK 281

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 68/136 (50%), Gaps = 17/136 (12%)

Query: 196 IWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIF 255
           + A+KE++ +  +Y  G I VP+P +   ++++ME +   DGF    L++H       I 
Sbjct: 157 LAAQKEYQFMSLLYSKGFI-VPQPYDNSRHIVLMELI---DGFPMRNLRNH-----SNIP 207

Query: 256 HYYHTIVAYMRLMYQICRLVHADLSEYNILI------HKDKMY-IIDVSQSVEPEHPMSL 308
             Y  ++ +   +     L+H D +E+NI+I       KD  + +ID  Q +  +H  + 
Sbjct: 208 KLYSDLMTFAVKLAN-SGLIHCDFNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDAD 266

Query: 309 DFLRMDIKNINFYFEK 324
            + + DI+ I  +F K
Sbjct: 267 FYFQRDIECIRRFFRK 282

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 67/143 (46%), Gaps = 17/143 (11%)

Query: 189 NPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPY 248
           N  ++  + AE+E+  +  +Y  G   VPKP     + +VME++    G+   RL+ H  
Sbjct: 149 NWMRLSHLSAEREYAYMCLLYSKG-FSVPKPYANSRHAIVMEYI---RGYPMRRLRSH-- 202

Query: 249 KDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKD-------KMYIIDVSQSVE 301
                +   Y  ++A++  +     ++H D +E+NI+I  D          +ID  Q + 
Sbjct: 203 ---SNVPKLYSDLMAFVVKLAN-HGMIHCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCIS 258

Query: 302 PEHPMSLDFLRMDIKNINFYFEK 324
            +H  +  + + D+  I  +F+K
Sbjct: 259 IQHQEAEYYFKRDVDCIRRFFKK 281

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 76/151 (50%), Gaps = 19/151 (12%)

Query: 182 RNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASP 241
           +N ++  N   + ++ A KE++ +  +Y  G   VP+P +   ++++M  +   +G+   
Sbjct: 144 KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIIMGLI---EGYPMR 199

Query: 242 RLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKM--------YI 293
           RL+ H       I   Y+ ++ ++  +     L+H D +E+NI+I KD++         +
Sbjct: 200 RLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCDFNEFNIMI-KDEVEDENDCGFVV 252

Query: 294 IDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
           ID  Q +  +HP +  + + D+  I  +F+K
Sbjct: 253 IDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 67/139 (48%), Gaps = 17/139 (12%)

Query: 193 MIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDRE 252
           + ++ A KE++ +  +Y  G   VPK  +   +++VME +    GF   RL+ H     +
Sbjct: 154 LSRVAANKEYQFMSLLYSKG-FTVPKAFDNSRHIVVMELI---KGFPLRRLRKH-----D 204

Query: 253 EIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDK-------MYIIDVSQSVEPEHP 305
            I   Y  ++ ++  +     L+H D +E+NI+I  +K         +ID  Q +  +H 
Sbjct: 205 NIPKLYSDLMCFIVNLAN-SGLIHCDFNEFNIMIKDEKDDENDCGFIVIDFPQCISIQHK 263

Query: 306 MSLDFLRMDIKNINFYFEK 324
            +  + + D+  I  +F+K
Sbjct: 264 DADFYFKRDVDCIRRFFKK 282

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 72/138 (52%), Gaps = 19/138 (13%)

Query: 195 KIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEI 254
           ++ A KE++ +  +Y  G + VP+P +   ++++M+ +   DG+   R++ H     + +
Sbjct: 155 RLAANKEYQFMSLLYSKGFV-VPEPFDNSRHMILMQLI---DGYPMRRMRSH-----KNL 205

Query: 255 FHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKM--------YIIDVSQSVEPEHPM 306
              Y  +++++  +     L+H D +E+NI+I K+K+         +ID  Q +  +H  
Sbjct: 206 PKLYSDLMSFIVKLAN-HGLIHCDFNEFNIMI-KNKVTDADDCGFIVIDFPQCISIQHQD 263

Query: 307 SLDFLRMDIKNINFYFEK 324
           + ++ + D+  I  +F K
Sbjct: 264 AEEYFKRDVDCIRRFFAK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 72/153 (47%), Gaps = 20/153 (13%)

Query: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240
            ++SR   +   +  + A KE+  L  ++  G   VP+  +   ++++MEF+    GF  
Sbjct: 142 LKHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEAFDNSRHMVLMEFI---KGFPM 197

Query: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDK---------M 291
             L+ H       I   Y  ++ +   + +   L+H D +E+NI+I KD+          
Sbjct: 198 KNLRTH-----SNIPKLYSDLMKFAVDLAK-SGLIHCDYNEFNIMI-KDQDTTDSSDCGF 250

Query: 292 YIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
            +ID  Q +  +HP +  F R DI+ I  +F+K
Sbjct: 251 VVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 82/174 (47%), Gaps = 26/174 (14%)

Query: 159 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPK 218
           ++ +TS    K+   Y+ G       R   +   + ++ A KE++ +  +Y  G   VP+
Sbjct: 126 RLGRTSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPE 177

Query: 219 PIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHAD 278
           P +   ++++ME +    G+   RL+ H      ++   Y  ++ ++  +     L+H D
Sbjct: 178 PFDNSRHIILMELI---KGYPMRRLRKH-----HDLPKLYSDLMCFIVNLAN-HGLIHCD 228

Query: 279 LSEYNILIHKDKM--------YIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
            +E+NI+I KD++         +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 229 FNEFNIMI-KDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44
           YNL207W
          Length = 444

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 95/214 (44%), Gaps = 44/214 (20%)

Query: 159 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPK 218
           ++ +TS    K+   Y+      +NS+   N   +  + A KE++ +  +Y S    VPK
Sbjct: 126 RLGRTSFQTVKNNRDYLK-----KNSKIGTNWMVLSGLAALKEYQFMSILY-SNDFKVPK 179

Query: 219 PIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHAD 278
           P +   ++++ME +   +G+   RL+    K++ ++   Y+ ++ ++  +     L+H D
Sbjct: 180 PFDNSRHIIIMELI---EGYPMRRLRS---KNQLKLAKLYNELMCFIVKLAD-HGLIHCD 232

Query: 279 LSEYNILIHKDK-----------------------MYIIDVSQSVEPEHPMSLDFLRMDI 315
            +E+NI+I +                           +ID  Q +   H  +  + + D+
Sbjct: 233 FNEFNIMIKEINNSNTDNNTTYTNKNKNSDDFDLDFTVIDFPQCISINHAYAEYYFKRDV 292

Query: 316 KNINFYFEKMGIDIFPERVIFQFIISDTLENFNG 349
             I  +F+K        ++ F+ II D++ + +G
Sbjct: 293 DCIRRFFKK--------KLKFEPIIDDSMVDVSG 318

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 67/142 (47%), Gaps = 27/142 (19%)

Query: 195 KIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEI 254
           ++ A KE++ +  ++  G   VP+P +   ++++ME +   DG+    ++ H  K+  ++
Sbjct: 155 RLAANKEYQFMSLLHSKG-FTVPEPFDNSRHMILMELI---DGYPMRNMRLH--KNLPKL 208

Query: 255 FHYYHTIVAYMRLMYQICRL-----VHADLSEYNILIHK-------DKMYIIDVSQSVEP 302
                    Y  LM  I +L     +H D +E+NI+I         +   +ID  Q +  
Sbjct: 209 ---------YSDLMLFIVKLANHGLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISI 259

Query: 303 EHPMSLDFLRMDIKNINFYFEK 324
           +H  +  F + D+  I  +F+K
Sbjct: 260 QHQDAEFFFKRDVDCIRRFFKK 281

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 79/173 (45%), Gaps = 24/173 (13%)

Query: 159 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPK 218
           ++ +TS    K+   Y+      RN +S  +   + K+ A KE++ +  +Y      VP+
Sbjct: 126 RLGRTSFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQ 177

Query: 219 PIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHAD 278
           P +   + ++ME +    G+   RL  H     + +   Y  ++ ++  +     L+H D
Sbjct: 178 PFDNSRHCVLMEHI---RGYPMRRLGKH-----KNLPKLYSDLMCFIVKLANHG-LIHCD 228

Query: 279 LSEYNILI------HKDKMY-IIDVSQSVEPEHPMSLDFLRMDIKNINFYFEK 324
            +E+NI+I        D  Y +ID  Q +  +H  +  + + D+  I  +F+K
Sbjct: 229 FNEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa]
           {ON} Anc_1.180 YKL168C
          Length = 981

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 11/70 (15%)

Query: 228 VMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQI------CRLVHADLSE 281
           VMEF   GD F    L ++  K+ + +FH       + +++Y I      C + H D+  
Sbjct: 761 VMEFCAAGDLFT---LMNNKLKNNK-VFHPLEADCIFKQILYAIKYMHDHC-VAHCDIKP 815

Query: 282 YNILIHKDKM 291
            NIL+HKD +
Sbjct: 816 ENILLHKDGL 825

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 165 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVI 214
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ S VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 160 IFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRI 208
           +F+T  + F+D++R+ +G    R   +QH+P +++K+    E+ +++R+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>NDAI0C03340 Chr3 complement(762096..769340) [7245 bp, 2414 aa] {ON}
            Anc_5.73 YHR165C
          Length = 2414

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 212  GVIPV--PKPIEVKNNVLVMEFLGRGDGF---ASPRLKDHPYKDREEIFHYYHTIVAYMR 266
            G  PV  P   EVK  VL+ + LG   G    A+P  + HPY +  E+  + HT    ++
Sbjct: 2210 GASPVDHPNIKEVKTIVLIPQ-LGSSRGVNMSAAPNSQSHPYLENLELLGWIHTQTNEIK 2268

Query: 267  LMYQICRLVHADLSEYN 283
             M     + H  L E N
Sbjct: 2269 FMSANEVMTHTQLFEEN 2285

>Kpol_2002.98 s2002 (234791..236497) [1707 bp, 568 aa] {ON}
           (234791..236497) [1707 nt, 569 aa]
          Length = 568

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 164 SILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIP-VPKPIE 221
           +IL+F  R+ R VDGE R  N    H P    KIW   E+ ++  ++ + +I  + KPI 
Sbjct: 501 NILMFVPRQDRLVDGE-RLINHFINHEPHSTYKIWYIDEYSHMDVLWANDMIERIGKPI- 558

Query: 222 VKN 224
           VKN
Sbjct: 559 VKN 561

>NCAS0C01180 Chr3 (219229..221568) [2340 bp, 779 aa] {ON} Anc_8.702
          Length = 779

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 15/83 (18%)

Query: 305 PMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTL--------------ENFNGD 350
           PM+  FL M  + +NFY  K+G  +   R  + F++S                     G 
Sbjct: 86  PMA-QFLSMLSEKLNFYLNKIGNPLILRRFFYIFLMSGITWFVMSSGLFPNERASGSRGT 144

Query: 351 YRDYNDLRDYVAQNLPIKKSEQD 373
           + D+N L +Y  Q++ + K E+D
Sbjct: 145 FSDHNLLMEYARQSMDLSKMERD 167

>KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {ON}
           similar to uniprot|Q07950 Saccharomyces cerevisiae
           YLR020C YEH2 Steryl ester hydrolase catalyzes steryl
           ester hydrolysis at the plasma membrane involved in
           sterol metabolism
          Length = 509

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 165 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIP-VPKPI 220
           IL+F  ++ R VDGE R  N  +   P+ + KIW   E+ +L  ++   VI  V KPI
Sbjct: 443 ILMFIPKQDRLVDGE-RLINHFTNCEPQSLYKIWYIDEYSHLDVLWSHDVIERVGKPI 499

>Kwal_33.13665 s33 complement(339375..345734) [6360 bp, 2119 aa]
           {ON} YCR032W (BPH1) - (putative) acetic acid export pump
           [contig 114] FULL
          Length = 2119

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 332 ERVIFQFIISDTLENF--NGDYRDYNDLRDYVAQNLPIKKSEQDEAED 377
           E +    ++ D L ++  +GD+ + N + +YV   LPIK ++  EAED
Sbjct: 29  EEIPLNELLLDILSSYHPDGDFLETNSISEYVYDQLPIKFADVGEAED 76

>KAFR0D03640 Chr4 (710080..712830) [2751 bp, 916 aa] {ON} Anc_1.509
           YJR061W
          Length = 916

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 384 YLVRNLEGLEERDFDRYTDGKFDLLKSLIA--HDNEKNFSAAEQF 426
           YL+ N E  EE  F  Y    FD+   L++  H NE NF+    F
Sbjct: 139 YLINNEENFEEMPFSWYDWMDFDMYNKLLSVRHSNENNFTCEFAF 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,970,525
Number of extensions: 2190311
Number of successful extensions: 7796
Number of sequences better than 10.0: 65
Number of HSP's gapped: 7996
Number of HSP's successfully gapped: 82
Length of query: 509
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 395
Effective length of database: 40,409,475
Effective search space: 15961742625
Effective search space used: 15961742625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)