Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F033105.425ON44242816770.0
Smik_4.6285.425ON4583167084e-88
Skud_4.6315.425ON4583147008e-87
YDR363W (ESC2)5.425ON4563186953e-86
NDAI0B056005.425ON4573036945e-86
Suva_2.5345.425ON4523236902e-85
KAFR0E038705.425ON3962646461e-79
ZYRO0F09812g5.425ON4163136262e-76
TBLA0A037105.425ON4612796181e-74
SAKL0G02266g5.425ON4842724926e-56
TDEL0E020005.425ON4362724897e-56
Kpol_1027.265.425ON4432844547e-51
TPHA0E018105.425ON4532824452e-49
Kwal_55.214685.425ON4652693981e-42
KLTH0F16280g5.425ON4732723823e-40
Ecym_55245.425ON4152693504e-36
AER251W5.425ON4072633362e-34
KLLA0E21275g5.425ON3922642676e-25
KNAG0C049805.425ON3451052523e-23
CAGL0A02706g5.425ON3691272463e-22
TPHA0E036501.51ON10565820.024
Kpol_2002.451.51ON10465820.031
Ecym_10571.51ON9865800.037
ZYRO0F17424g1.51ON9965800.048
KLTH0F01650g1.51ON9465780.072
NDAI0A006501.51ON10665790.074
NCAS0B085901.51ON10265780.089
SAKL0C01694g1.51ON9765780.090
KAFR0D041101.51ON10265780.095
CAGL0K05731g1.51ON10865780.098
Suva_2.6891.51ON10165780.100
YDR510W (SMT3)1.51ON10165780.100
Smik_4.7911.51ON10165770.10
Skud_4.7851.51ON10165770.11
AFR697C1.51ON9265770.11
TBLA0A071401.51ON9665760.15
TDEL0C065001.51ON9765730.41
KLLA0C01628g1.51ON9365720.50
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03310
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   650   0.0  
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   277   4e-88
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   274   8e-87
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   272   3e-86
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   271   5e-86
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   270   2e-85
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   253   1e-79
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   245   2e-76
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   242   1e-74
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   194   6e-56
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   192   7e-56
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   179   7e-51
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   176   2e-49
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   157   1e-42
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   151   3e-40
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   139   4e-36
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   134   2e-34
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   107   6e-25
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   101   3e-23
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...    99   3e-22
TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON...    36   0.024
Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON} (93655.....    36   0.031
Ecym_1057 Chr1 (104604..104900) [297 bp, 98 aa] {ON} similar to ...    35   0.037
ZYRO0F17424g Chr6 complement(1449658..1449957) [300 bp, 99 aa] {...    35   0.048
KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly s...    35   0.072
NDAI0A00650 Chr1 (120882..121202) [321 bp, 106 aa] {ON} Anc_1.51...    35   0.074
NCAS0B08590 Chr2 (1648641..1648949) [309 bp, 102 aa] {ON} Anc_1....    35   0.089
SAKL0C01694g Chr3 (142861..143154) [294 bp, 97 aa] {ON} highly s...    35   0.090
KAFR0D04110 Chr4 complement(813551..813859) [309 bp, 102 aa] {ON...    35   0.095
CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {...    35   0.098
Suva_2.689 Chr2 (1222165..1222470) [306 bp, 101 aa] {ON} YDR510W...    35   0.100
YDR510W Chr4 (1469400..1469705) [306 bp, 101 aa] {ON}  SMT3Ubiqu...    35   0.100
Smik_4.791 Chr4 (1392239..1392544) [306 bp, 101 aa] {ON} YDR510W...    34   0.10 
Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W...    34   0.11 
AFR697C Chr6 complement(1725916..1726194) [279 bp, 92 aa] {ON} S...    34   0.11 
TBLA0A07140 Chr1 (1774301..1774591) [291 bp, 96 aa] {ON} Anc_1.5...    34   0.15 
TDEL0C06500 Chr3 complement(1195140..1195433) [294 bp, 97 aa] {O...    33   0.41 
KLLA0C01628g Chr3 (126942..127223) [282 bp, 93 aa] {ON} highly s...    32   0.50 

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/428 (78%), Positives = 334/428 (78%)

Query: 15  MAHXXXXXXXXXXXQRAKLVLPDSTMKGSQNLDAERRKILELSDDEIEGKMGNVQKELPN 74
           MAH           QRAKLVLPDSTMKGSQNLDAERRKILELSDDEIEGKMGNVQKELPN
Sbjct: 15  MAHDESDEEIEIESQRAKLVLPDSTMKGSQNLDAERRKILELSDDEIEGKMGNVQKELPN 74

Query: 75  VSPTKNTRSQRKNTTATESLDPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKR 134
           VSPTKNTRSQRKNTTATESLDPE                                  AKR
Sbjct: 75  VSPTKNTRSQRKNTTATESLDPESNNNKRSRSLSRRGSSSSSLSSRSRSRSNSPYRSAKR 134

Query: 135 QKSTSTPILSLGPDENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFLSQLDG 194
           QKSTSTPILSLGPDEND            LPSITDRSKEATPDKQPKRVYSIRFLSQLDG
Sbjct: 135 QKSTSTPILSLGPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQLDG 194

Query: 195 TINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMT 254
           TINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMT
Sbjct: 195 TINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMT 254

Query: 255 CNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXAAQMKLDLXXXXXXXXX 314
           CNSLNIPQAFENEVTNVDIVIMS                    AAQMKLDL         
Sbjct: 255 CNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKEGE 314

Query: 315 XXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNIDGSDNEKSSIMKIAL 374
                   NTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNIDGSDNEKSSIMKIAL
Sbjct: 315 KNKPKESKNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNIDGSDNEKSSIMKIAL 374

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE
Sbjct: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434

Query: 435 DMIEVVIK 442
           DMIEVVIK
Sbjct: 435 DMIEVVIK 442

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  277 bits (708), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 197/316 (62%), Gaps = 24/316 (7%)

Query: 133 KRQKSTSTPILSLGPDENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFLSQL 192
           KRQKS+    L    DEND              S+   SKE+TPD Q KRVY+I+FLS+L
Sbjct: 159 KRQKSS----LLYAYDENDDFFKELAKEAKKTTSV---SKESTPD-QRKRVYNIKFLSKL 210

Query: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252
           +GTINK VQVKVLGK++F +ILP  L+GL KSY IP V++  YKV+NVTLYW N KLL+F
Sbjct: 211 EGTINKAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDF 270

Query: 253 MTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXAAQMKLDLXXXXXXX 312
           MTCNSL+IPQ FENEV+++D+ I+S                    A  +K          
Sbjct: 271 MTCNSLHIPQDFENEVSDIDVTIVSKEYEKNFEASLESKLKEEEAALLVK-------EHE 323

Query: 313 XXXXXXXXXXNTEYAKAIAEFEKELKDATELKDS-------QVHGGENDGNMNIDGSDNE 365
                     N +      EFE EL++  E ++         +   + D N+  + SD+E
Sbjct: 324 EIERKLERKRNEQEESEYREFEFELRNVKEKQERTENETVINIKNLQEDDNLLENNSDSE 383

Query: 366 KSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEET 425
           K  +MKIAL G DNKKIYVNVR STPFSK+AEYYR+QKQLPQ A+I+L+FDHD+L++ E 
Sbjct: 384 K--VMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441

Query: 426 VGDQDMEDEDMIEVVI 441
           + DQDMEDEDMI+V+I
Sbjct: 442 IADQDMEDEDMIDVII 457

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  274 bits (700), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 196/314 (62%), Gaps = 20/314 (6%)

Query: 133 KRQKSTSTPILSLGPDENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFLSQL 192
           KRQK +   I     DEND            + +I   SKE TP+ QPKRVY+I+FLS+L
Sbjct: 159 KRQKCSLVDIY----DENDDFFKELAKEAKKITTI---SKEPTPE-QPKRVYNIKFLSKL 210

Query: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252
           +GTINK VQVKVLGK++F +ILP  L+GL+KSY IP V+   YKV NVTLYWNN KLLNF
Sbjct: 211 EGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNF 270

Query: 253 MTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXAAQMKLDLXXXXXXX 312
           MTCNSLNI Q FENE++++D+ I+S                    A  +K          
Sbjct: 271 MTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVK-------QRQ 323

Query: 313 XXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQ-----VHGGENDGNMNIDGSDNEKS 367
                     N +      EFE EL++  E ++ +     ++     GN ++ G++ +  
Sbjct: 324 EIERKLEKKRNEQEESEYREFEFELRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTE 383

Query: 368 SIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVG 427
            ++K+AL+G DNKKI+VNVRNSTP  K+AEYYR+QK+LPQ A+I+L+FDHDELN+ E V 
Sbjct: 384 KVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVA 443

Query: 428 DQDMEDEDMIEVVI 441
           DQDMEDEDMI+V++
Sbjct: 444 DQDMEDEDMIDVIV 457

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  272 bits (695), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 152/318 (47%), Positives = 196/318 (61%), Gaps = 28/318 (8%)

Query: 133 KRQKSTSTPILSLGPDENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFLSQL 192
           KRQKS+    L    DEND              +I   SKE+TPD Q KRVY+I+FLS+L
Sbjct: 157 KRQKSS----LLYTYDENDDFFKELAKEAKKSTTI---SKESTPD-QRKRVYNIKFLSKL 208

Query: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252
           +GTINK VQVKVLGK++F KILP  L+GL+KSY IP V++  YKV+NVTLYWNN KLL F
Sbjct: 209 EGTINKAVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTF 268

Query: 253 MTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXAAQMKLDLXXXXXXX 312
           MTCNSL+IPQ FENEV+++D+ I+S                    A  +K          
Sbjct: 269 MTCNSLHIPQDFENEVSDIDVTIVSKEYEKNFEATLESKLKEEEAALLIK-------ERQ 321

Query: 313 XXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNI---------DGSD 363
                     N +      EFE ELK+  E ++ +    END  MN           G+ 
Sbjct: 322 EMERKLEKKRNEQEESEYREFESELKNVEETQEIK----ENDTVMNTKLLQEGGSLSGNS 377

Query: 364 NEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLE 423
           +    +M+IAL+G DNKKIYV+VR STPFSK+AEYYR+QKQLPQ  +++L+FDHDEL++ 
Sbjct: 378 SSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMN 437

Query: 424 ETVGDQDMEDEDMIEVVI 441
           E + DQDMEDEDM++V+I
Sbjct: 438 ECIADQDMEDEDMVDVII 455

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  271 bits (694), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 202/303 (66%), Gaps = 10/303 (3%)

Query: 143 LSLGPDENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFLSQLDGTINKTVQV 202
           L + PDEND            +PS+T   KE+TPDK PKR+Y+IRF+S+LDGT+NK VQV
Sbjct: 160 LQMEPDENDEFFKEIAKEAKKIPSLT---KESTPDKLPKRIYNIRFISKLDGTMNKCVQV 216

Query: 203 KVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQ 262
           KVLGKFQF KILP  L GLIK+YSIP+VLQK+Y VDNV+LYWN+ KLL+FMTCNSLNIPQ
Sbjct: 217 KVLGKFQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQ 276

Query: 263 AFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXAAQMKLDLXXXXXXXXXXXXXXXXX 322
           AFENEVTNVDI ++S                       +KL+                  
Sbjct: 277 AFENEVTNVDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQEKLAKELAK 336

Query: 323 NTEYAKAIAEFEKELKDATELKDSQVHGGENDGN----MNIDGSDNEKSSIMKIALVGHD 378
             +  +   EFE EL++ +ELK    +G + D +     N    +   + +MKIALVG D
Sbjct: 337 EEKENEVFEEFEHELENVSELK---TNGYDADASTVNEANELALEEGNADVMKIALVGQD 393

Query: 379 NKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDEDMIE 438
           NKKI+VNVR +TPFSK+AEYYR+QKQLPQ AKI+L+FDH+EL+L ET+ DQDMED+DMIE
Sbjct: 394 NKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSLYETIEDQDMEDDDMIE 453

Query: 439 VVI 441
           VVI
Sbjct: 454 VVI 456

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 157/323 (48%), Positives = 196/323 (60%), Gaps = 38/323 (11%)

Query: 133 KRQKSTSTPILSLGPDENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFLSQL 192
           KRQK++    L    DEND              SI   SKE+TPD QPKRVY+I+F S+L
Sbjct: 153 KRQKNS----LLNTYDENDDFFKELAKEAKKTTSI---SKESTPD-QPKRVYNIKFFSKL 204

Query: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252
           +GTINK VQVKVLGK++F +ILP  L+GL+KSY IP V++  YK +NVTLYWNN KLL F
Sbjct: 205 EGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKF 264

Query: 253 MTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXA--------AQMKLD 304
           MTCNSL+IPQ FENE++++DI I+S                    A         +MKL+
Sbjct: 265 MTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQEMEMKLE 324

Query: 305 ----LXXXXXXXXXXXXXXXXXNTEYAKAIAEF--EKELKDATELKDSQVHGGENDGNMN 358
                                  TE  KA   F  E  L++   +K       EN+G   
Sbjct: 325 KKRNEREESEFREFEFELRNVEETEELKANETFMNEHSLREGNSVK-------ENNGG-- 375

Query: 359 IDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHD 418
                NEK  +MKIAL+G DNKKIYVNVRNSTPF K+AEYYR+QKQLPQ A+I+L+FDHD
Sbjct: 376 -----NEK--VMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHD 428

Query: 419 ELNLEETVGDQDMEDEDMIEVVI 441
           ELNL E + DQDMEDEDM++V++
Sbjct: 429 ELNLNECIADQDMEDEDMVDVIV 451

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  253 bits (646), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 173/264 (65%), Gaps = 24/264 (9%)

Query: 178 KQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKV 237
           K+PKR+Y+IRF+S+LDG+INK+V+VKVLGKF F KILP  L+GLI +Y IP+++ + Y V
Sbjct: 156 KRPKRIYNIRFISKLDGSINKSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDV 215

Query: 238 DNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXX 297
           +NV LYWNN KLLNFMTC+SL+IP AFENE++NVDI+I+S                    
Sbjct: 216 ENVGLYWNNAKLLNFMTCDSLSIPLAFENEISNVDILIVSKEFGEKLEKLD--------- 266

Query: 298 AAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNM 357
             QMK  L                   ++   + EFE EL+D             ++ N+
Sbjct: 267 --QMKT-LQEEAKLERQEEIKDVDEGDDF--VLKEFEAELRDV----------APSNANL 311

Query: 358 NIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDH 417
           ++D    +   +MK+AL+G DNKKIYVNVR+ST  SKL EYY+ QK L +  K++L+FDH
Sbjct: 312 SLDTDGEDSEPLMKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDH 371

Query: 418 DELNLEETVGDQDMEDEDMIEVVI 441
           DEL+L ETVGDQDMEDEDMI+VV+
Sbjct: 372 DELDLNETVGDQDMEDEDMIDVVV 395

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  245 bits (626), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 184/313 (58%), Gaps = 31/313 (9%)

Query: 133 KRQKSTSTPILS---LGPDENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFL 189
           + ++S +TP ++   L PDEND             P  T   +E TP+ QP+R+Y++RFL
Sbjct: 132 RTKRSRTTPNIANNFLEPDENDEFFKQIAKDFNHTPLGT---RETTPE-QPRRIYNVRFL 187

Query: 190 SQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKL 249
           S+LDG+I+K VQ+KVLGK+ F  +LP  L G I+ Y IP V++K Y  +NVTLYW   KL
Sbjct: 188 SKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKL 247

Query: 250 LNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXAAQMKLDLXXXX 309
           LNFMTCNSL IPQAFENE++++DI ++                            +    
Sbjct: 248 LNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQ------------------MINSR 289

Query: 310 XXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNIDGSDNEKSSI 369
                               + EFEKELK+     D+     E      ID  D   + +
Sbjct: 290 LLEDEQNPPDTAETGNLDARVEEFEKELKNV----DNSTTNHET--TELIDLEDEGDTDL 343

Query: 370 MKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQ 429
           MKIALVG DNKKI+VNVRN+T  +K+AEYYR++K+LP+   I+L+FDH+ELNL E++GDQ
Sbjct: 344 MKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQ 403

Query: 430 DMEDEDMIEVVIK 442
           DMEDEDMIEV+ K
Sbjct: 404 DMEDEDMIEVLTK 416

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  242 bits (618), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 130/279 (46%), Positives = 181/279 (64%), Gaps = 17/279 (6%)

Query: 165 PSITDRSKEATPDKQ--PKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLI 222
           PS T +S   T   Q  PKR+Y++RF+S+++GT++K VQVKVLGKF F KILPP L+   
Sbjct: 197 PSSTMKSDIKTTKDQGNPKRIYNVRFISKIEGTLDKKVQVKVLGKFPFSKILPPALKAFS 256

Query: 223 KSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXX 282
           + Y IP VL+++Y+V+NVTLYWN++KLLNFMTCNSLNIPQ +ENE+++V+I++++     
Sbjct: 257 EEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYENEISDVEIIVIT----- 311

Query: 283 XXXXXXXXXXXXXXXAAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATE 342
                          + +  ++                   +    +I EFEKELK+ ++
Sbjct: 312 --KTNEKSYEDKINMSLKQNIEQNLAQKSNEIKELRKLKVESFEHNSIQEFEKELKELSQ 369

Query: 343 LKDSQVHGGENDGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQ 402
                  G +     NID   NE  S +KIAL+  DNKK+YV VRNSTPFS+L  Y+R Q
Sbjct: 370 ------DGVDTKQTANIDDIPNE--SHIKIALLTQDNKKLYVKVRNSTPFSELVNYFREQ 421

Query: 403 KQLPQAAKIQLMFDHDELNLEETVGDQDMEDEDMIEVVI 441
           KQL +  +I+L+FD++EL+L ETVGDQDMEDEDMIEVV+
Sbjct: 422 KQLGETQQIKLIFDNEELDLNETVGDQDMEDEDMIEVVL 460

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  194 bits (492), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 153/272 (56%), Gaps = 32/272 (11%)

Query: 172 KEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVL 231
           +E++P+   KR Y I F+S+L G+I+K ++VK  GK  F KILP TL+ ++K+Y IP  +
Sbjct: 242 RESSPELD-KRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAI 300

Query: 232 QKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXX 291
           Q  YK+DNVTLYWN  K+LNFMTCNSL IPQ + +E+T+VDI ++S              
Sbjct: 301 QNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKEM 360

Query: 292 XXXXXXAAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGG 351
                  + + +                         A  E+E +L+ +   + S +   
Sbjct: 361 VENELSGSSVDVKNVKKDDF-----------------ATNEYELQLEKSESAEPSLLKSS 403

Query: 352 EN--DGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAA 409
           EN  DG            S +K+ALVG DNKK++V  R+ST F K+A+YY+  K LP   
Sbjct: 404 ENIRDG------------SFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFT 451

Query: 410 KIQLMFDHDELNLEETVGDQDMEDEDMIEVVI 441
           K++L FDH  L+LE+ V D +MEDEDMIEV I
Sbjct: 452 KLKLTFDHVNLSLEDRVEDHEMEDEDMIEVAI 483

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  192 bits (489), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 105/272 (38%), Positives = 154/272 (56%), Gaps = 14/272 (5%)

Query: 171 SKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTV 230
           S  A   K  ++++++ FLS+L+GT+++ +Q+KVLGK+ F  IL   LE +++ + IP  
Sbjct: 178 SSPAKGTKARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYP 237

Query: 231 LQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXX 290
           +   Y VDNVTLYWN  KLL FMTC+SL I     NEVT +++ ++S             
Sbjct: 238 VMHQYTVDNVTLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSKSDEERFEEEERA 297

Query: 291 XXXXXXXAAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAI-AEFEKELKDATELKDSQVH 349
                   A  K  L                 + E  +   +  E E+K+ ++L      
Sbjct: 298 RLLRVEKEAMSKAKLPTTFEADPSDDNGEADCSIEIIEMDDSSRESEMKEGSKLAP---- 353

Query: 350 GGENDGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAA 409
                    +D  D ++  ++K+ALVG DN ++YVNVR STPFSK+AEYY+L K LP   
Sbjct: 354 ---------VDLEDEDELEVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEV 404

Query: 410 KIQLMFDHDELNLEETVGDQDMEDEDMIEVVI 441
           K+ L FDH++L+L ETVGDQ++EDEDM+EVVI
Sbjct: 405 KLNLYFDHEKLDLNETVGDQELEDEDMLEVVI 436

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  179 bits (454), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 159/284 (55%), Gaps = 30/284 (10%)

Query: 175 TPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKF 234
           T D  P R+Y+I F S+LDG+++K +Q +VLGK QF +I+ P L+   K Y +  V ++ 
Sbjct: 171 TSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRN 230

Query: 235 YKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXX 294
           YK D VT+YW+  KLL FMTCNSL IP  F++E++++++ I+S                 
Sbjct: 231 YKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIIS-------------KENE 277

Query: 295 XXXAAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQV-----H 349
               A +K  L                 N      I E +K+ ++     +  +      
Sbjct: 278 QQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQIDENKKKYEEYENELNESIPISVPS 337

Query: 350 GGENDGNMNIDGSDNE------------KSSIMKIALVGHDNKKIYVNVRNSTPFSKLAE 397
            G  +  M+IDG +              + +I+K+ALVG+DNKKI+VN R +T F KLAE
Sbjct: 338 QGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAE 397

Query: 398 YYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDEDMIEVVI 441
           YY L ++LP++ K++L+FD ++++L+  V DQD+ED+DMIEVVI
Sbjct: 398 YYILHRKLPKSTKVKLIFDDEQIDLDSMVKDQDVEDDDMIEVVI 441

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  176 bits (445), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 159/282 (56%), Gaps = 31/282 (10%)

Query: 182 RVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVT 241
           R Y+I ++S+L+G+  + +Q KVLG   F K+LPP L  L+K   IP+ L+  YK +NVT
Sbjct: 182 RKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVT 241

Query: 242 LYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXXAAQM 301
           LYWN +KLLNFM C+SL IPQ ++NE++ ++I+++S                     +Q 
Sbjct: 242 LYWNKSKLLNFMNCDSLKIPQTYQNEISELEIILISKEEEQKFEEQFKMQLLEDEQLSQK 301

Query: 302 KLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKEL-----KDATELKDS-QVHGGENDG 355
            ++                  NT Y     E+EKEL     KD     D   V   EN  
Sbjct: 302 NIE------NFNDSNKPFDILNTSY----NEYEKELENWNSKDFNVTNDVLDVSNDENSS 351

Query: 356 N-------MN-IDGSDNEK-------SSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYR 400
           N       MN I+ SDNE        S+++KI+L+ +DNKKI+VNVR+ST   KL +Y++
Sbjct: 352 NNVKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFK 411

Query: 401 LQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDEDMIEVVIK 442
             K L    +I+++FDHD L+L+  +GD D+EDED++E++I+
Sbjct: 412 KCKNLTSNQRIKVIFDHDVLSLDSMIGDNDIEDEDIVEMIIE 453

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  157 bits (398), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 139/269 (51%), Gaps = 27/269 (10%)

Query: 172 KEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVL 231
           KE +P    KRVY+I+FLS L+G++N  + VKV GK  F +ILP  L+ LIK Y +   L
Sbjct: 222 KEGSP-ATAKRVYNIKFLSNLEGSLNDKINVKVKGKHAFSEILPIALKTLIKEYKVSKDL 280

Query: 232 QKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXX 291
           + FY+ +NV+LY N  K+LNFM CNSL+IP  +E EV++V + ++S              
Sbjct: 281 KPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYEGEVSDVSMTLVS-------RDREQEY 333

Query: 292 XXXXXXAAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGG 351
                 +     DL                       +I EFEK+L+            G
Sbjct: 334 VKTLEQSRHATPDLSREETSPKIP-----------GFSIEEFEKDLEG--------FESG 374

Query: 352 ENDGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKI 411
           E++  +            +KIAL+  DNKKIYVNVR +T  + L E+YR  K L    + 
Sbjct: 375 ESNNLLEDTPQTENNHGTIKIALMAQDNKKIYVNVRQTTTIAMLGEHYRTTKNLSSIERF 434

Query: 412 QLMFDHDELNLEETVGDQDMEDEDMIEVV 440
           + +FD+++L L   + D DMED D+IEVV
Sbjct: 435 KFVFDNEDLQLSTKIDDLDMEDGDIIEVV 463

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  151 bits (382), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 144/272 (52%), Gaps = 28/272 (10%)

Query: 172 KEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVL 231
           KE++P    +R+Y+I+F+S L+G+  + + VKV GK  F +ILP  L+ +IK Y IP  L
Sbjct: 227 KESSP-AVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDAL 285

Query: 232 QKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXX 291
              Y+ D VTLY +  K+LNFM CNSL IP  F+ EV++V + I+S              
Sbjct: 286 HPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQS 345

Query: 292 XXXXXXAAQMKLDLXXXXXXXXXXXXXXXXXNTEYAK-AIAEFEKELKDATELKDSQVHG 350
                      ++                   TE     + E+EKEL++    K++ V  
Sbjct: 346 KHSNHELVPAFIE-----------------PGTETPDFTVEEYEKELRNVDFNKNTSVQN 388

Query: 351 GENDGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAK 410
                +++    DN     ++IAL+  DNKKI V  R  T F+ LAE+Y+    LP   +
Sbjct: 389 QPPPQSVD----DN-----IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQ 439

Query: 411 IQLMFDHDELNLEETVGDQDMEDEDMIEVVIK 442
           + L FD++EL+L+  V D D+ED+D++EVVIK
Sbjct: 440 VLLFFDNEELHLDSKVSDADVEDDDIVEVVIK 471

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  139 bits (350), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 139/269 (51%), Gaps = 34/269 (12%)

Query: 183 VYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTL 242
           +Y++ F+S+L+G+ NK + V++ GK +F   LP  L+  +K Y I   L   Y++DNV +
Sbjct: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229

Query: 243 YWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIM-----SXXXXXXXXXXXXXXXXXXXX 297
           Y    ++  FMTC+S NI +A+ +   ++++ I+     S                    
Sbjct: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289

Query: 298 AAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGGE----- 352
           A+ + LD                  N ++   + E+EK+L +A  L ++++         
Sbjct: 290 ASPVDLD-----------SDGIEFGNDDFR--VNEYEKDLANARSLDETEIQYSNQISKP 336

Query: 353 NDGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQ 412
           +DGN            ++K+ L+G DNKK+YVNV+ +T F KLAE+YR  K+LP   K+ 
Sbjct: 337 DDGN-----------ELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLI 385

Query: 413 LMFDHDELNLEETVGDQDMEDEDMIEVVI 441
           L FDHD+++   T+    +ED+D++EV +
Sbjct: 386 LSFDHDDIDPSNTIFSAAIEDDDIVEVSV 414

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  134 bits (336), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 137/263 (52%), Gaps = 21/263 (7%)

Query: 182 RVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVT 241
           RVY++ F+S+++G+ N+ V VKV G+ QF   L   L    K ++I   L+  Y+ D V 
Sbjct: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVK 223

Query: 242 LYWNNTKLLNFMTCNSLNIPQAFENEVTNVD--IVIMSXXXXXXXXXXXXXXXXXXXXAA 299
           +Y    ++  FMTC+S NI + +    T+++  IV +                     + 
Sbjct: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSN 283

Query: 300 QMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNI 359
              L++                        + E+EK L +A  L ++++   E       
Sbjct: 284 SSFLEVMDDIEDDNDDFL------------VNEYEKALVNARSLNETELAVREGT----- 326

Query: 360 DGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDE 419
               +E S ++KI L+G DNKK++++VR +T   K+AE+YR+ K+LP   ++ LMFDH+E
Sbjct: 327 --PADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEE 384

Query: 420 LNLEETVGDQDMEDEDMIEVVIK 442
           ++L++T+ + D+ED D+IEVV+K
Sbjct: 385 IDLDDTICNIDIEDGDIIEVVVK 407

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  107 bits (267), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 127/264 (48%), Gaps = 16/264 (6%)

Query: 178 KQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKV 237
           K  KR+Y+I F+S L+G+ +K V VKV G   F  ILP T+   I+SY IP  L+ FY  
Sbjct: 144 KVTKRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTP 203

Query: 238 DNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSXXXXXXXXXXXXXXXXXXXX 297
             + L+    ++L F  C+SL IP+      T VD+VI+                     
Sbjct: 204 AELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIR----- 258

Query: 298 AAQMKLDLXXXXXXXXXXXXXXXXXNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNM 357
             + +L                     E  K    FEKEL+ A +L          D  +
Sbjct: 259 --ESRLQSFLDESNIEEQDPLEQPARDEKFKL---FEKELESAPKL------AERTDDVI 307

Query: 358 NIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDH 417
           ++  SD E S+ +++ L+   NK+  ++V  +T F+++A  Y+    L + A + L+FD+
Sbjct: 308 DLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDN 367

Query: 418 DELNLEETVGDQDMEDEDMIEVVI 441
           +ELN   TV  + +E++D++E+ I
Sbjct: 368 EELNPAATVLSEGLEEDDILEIKI 391

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  101 bits (252), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 64/105 (60%)

Query: 171 SKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTV 230
           ++ AT    P  VY +RF SQL+GT+ K+VQVKV+G      +LP  L  L+++  +P V
Sbjct: 119 AETATTSTVPSPVYRVRFQSQLEGTLGKSVQVKVIGTRPLGTVLPSVLSALVRACRVPQV 178

Query: 231 LQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVI 275
           LQ  Y    V +Y    ++L FM CNSL + Q FENEV  VD+V+
Sbjct: 179 LQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFENEVLEVDVVL 223

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 52/77 (67%)

Query: 364 NEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLE 423
           N   ++MKIAL+  DN+++YV V   TP S+L EYYR+++ LP  A +QL  D ++++ E
Sbjct: 268 NPAPALMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQVSPE 327

Query: 424 ETVGDQDMEDEDMIEVV 440
             + + D+ED D++E+ 
Sbjct: 328 THISELDLEDGDVLEIA 344

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 5/127 (3%)

Query: 148 DENDXXXXXXXXXXXXLPSITDRSKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGK 207
           DEND            LP + D S     DK    VY ++F+S +DGT  K+VQVK LG 
Sbjct: 122 DENDLFFQSIAKRSQSLP-VQDGSGAVRQDK----VYYVQFISHVDGTKGKSVQVKALGS 176

Query: 208 FQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENE 267
             F K++   L GL++++ +P+V++  Y+ ++V  YWN  K+L FMTC++L +PQ + ++
Sbjct: 177 HPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSD 236

Query: 268 VTNVDIV 274
              + +V
Sbjct: 237 YLEIQLV 243

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 56/77 (72%)

Query: 363 DNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNL 422
           D E   ++++AL G DNKK+YVNV+ +T F+++ EYYR QKQLP++ +I L  D + L+ 
Sbjct: 290 DLESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDP 349

Query: 423 EETVGDQDMEDEDMIEV 439
             TV  QD+EDEDM+EV
Sbjct: 350 HATVKSQDIEDEDMLEV 366

>TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON}
           Anc_1.51 YDR510W
          Length = 105

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   L  ++T  D DMED 
Sbjct: 33  VSDGSSEIFFKIKRTTPLKRLMEAF-AKRQGKEMDSLRFLYDGIRLQADQTPEDLDMEDN 91

Query: 435 DMIEV 439
           D+IE 
Sbjct: 92  DIIEA 96

>Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON}
           (93655..93969) [315 nt, 105 aa]
          Length = 104

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q      ++ ++D   L  ++T  D DMED 
Sbjct: 30  VSDGSSEIFFKIKRTTPLKRLMEAF-AKRQGKDVDSLRFLYDGVRLQSDQTPDDLDMEDN 88

Query: 435 DMIEV 439
           D+IE 
Sbjct: 89  DIIEA 93

>Ecym_1057 Chr1 (104604..104900) [297 bp, 98 aa] {ON} similar to
           Ashbya gossypii AFR697C
          Length = 98

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +IY  +R +TP  +L E +  ++Q  +   ++ ++D   +  +++  D DMED 
Sbjct: 21  VSDGSSEIYFKIRRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGVRIQPDQSPDDLDMEDN 79

Query: 435 DMIEV 439
           D+IE 
Sbjct: 80  DIIEA 84

>ZYRO0F17424g Chr6 complement(1449658..1449957) [300 bp, 99 aa] {ON}
           highly similar to uniprot|Q12306 Saccharomyces
           cerevisiae YDR510W
          Length = 99

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 26  VSDGSSEIFFKIKRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPDDLDMEDN 84

Query: 435 DMIEV 439
           D+IE 
Sbjct: 85  DIIEA 89

>KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly
           similar to uniprot|Q12306 Saccharomyces cerevisiae
           YDR510W
          Length = 94

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 22  VSDGSSEIFFKIKRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGVRIQADQTPEDLDMEDN 80

Query: 435 DMIEV 439
           D+IE 
Sbjct: 81  DIIEA 85

>NDAI0A00650 Chr1 (120882..121202) [321 bp, 106 aa] {ON} Anc_1.51
           YDR510W
          Length = 106

 Score = 35.0 bits (79), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 32  VSDGSSEIFFKIKRTTPLKRLMEAF-AKRQGKEMNSLRFLYDGIRVQADQTPEDLDMEDN 90

Query: 435 DMIEV 439
           D+IE 
Sbjct: 91  DIIEA 95

>NCAS0B08590 Chr2 (1648641..1648949) [309 bp, 102 aa] {ON} Anc_1.51
           YDR510W
          Length = 102

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 29  VSDGSSEIFFKIKRTTPLKRLMEAF-AKRQGKEMDSLRFLYDGIRVGADQTPEDLDMEDN 87

Query: 435 DMIEV 439
           D+IE 
Sbjct: 88  DIIEA 92

>SAKL0C01694g Chr3 (142861..143154) [294 bp, 97 aa] {ON} highly
           similar to uniprot|Q12306 Saccharomyces cerevisiae
           YDR510W
          Length = 97

 Score = 34.7 bits (78), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 24  VSDGSSEIFFKIKRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGVRIQPDQTPDDLDMEDN 82

Query: 435 DMIEV 439
           D+IE 
Sbjct: 83  DIIEA 87

>KAFR0D04110 Chr4 complement(813551..813859) [309 bp, 102 aa] {ON}
           Anc_1.51 YDR510W
          Length = 102

 Score = 34.7 bits (78), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 30  VSDGSSEIFFKIKRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQPDQTPDDLDMEDN 88

Query: 435 DMIEV 439
           D+IE 
Sbjct: 89  DIIEA 93

>CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {ON}
           highly similar to uniprot|Q12306 Saccharomyces
           cerevisiae YDR510w SMT3 ubiquitin-like protein
          Length = 108

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 36  VSDGSSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGLRIQADQTPEDLDMEDN 94

Query: 435 DMIEV 439
           D+IE 
Sbjct: 95  DLIEA 99

>Suva_2.689 Chr2 (1222165..1222470) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 34.7 bits (78), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 435 DMIEV 439
           D+IE 
Sbjct: 87  DIIEA 91

>YDR510W Chr4 (1469400..1469705) [306 bp, 101 aa] {ON}
           SMT3Ubiquitin-like protein of the SUMO family,
           conjugated to lysine residues of target proteins;
           regulates chromatid cohesion, chromosome segregation,
           APC-mediated proteolysis, DNA replication and septin
           ring dynamics; phosphorylated at Ser2
          Length = 101

 Score = 34.7 bits (78), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 435 DMIEV 439
           D+IE 
Sbjct: 87  DIIEA 91

>Smik_4.791 Chr4 (1392239..1392544) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 435 DMIEV 439
           D+IE 
Sbjct: 87  DIIEA 91

>Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 435 DMIEV 439
           D+IE 
Sbjct: 87  DIIEA 91

>AFR697C Chr6 complement(1725916..1726194) [279 bp, 92 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR510W
           (SMT3)
          Length = 92

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 21  VSDGSSEIFFKIKRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGVRIQPDQTPDDLDMEDN 79

Query: 435 DMIEV 439
           D+IE 
Sbjct: 80  DIIEA 84

>TBLA0A07140 Chr1 (1774301..1774591) [291 bp, 96 aa] {ON} Anc_1.51
           YDR510W
          Length = 96

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q      ++ ++D   +  ++T  D DMED 
Sbjct: 23  VSDGSSEIFFKIKRTTPLRRLMEAF-AKRQGKDVDSLRFLYDGVRIQPDQTPEDLDMEDN 81

Query: 435 DMIEV 439
           D+IE 
Sbjct: 82  DIIEA 86

>TDEL0C06500 Chr3 complement(1195140..1195433) [294 bp, 97 aa] {ON}
           Anc_1.51 YDR510W
          Length = 97

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L + +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 26  VSDGSSEIFFKIKRTTPLRRLMDAF-AKRQGREMDSLRFLYDGLRIQPDQTPDDLDMEDN 84

Query: 435 DMIEV 439
           D+IE 
Sbjct: 85  DIIEA 89

>KLLA0C01628g Chr3 (126942..127223) [282 bp, 93 aa] {ON} highly
           similar to uniprot|Q12306 Saccharomyces cerevisiae
           YDR510W
          Length = 93

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 375 VGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDE 434
           V   + +I+  ++ +TP  +L E +  ++Q  +   ++ ++D   +  ++T  D DMED 
Sbjct: 21  VSDGSSEIFFKIKKTTPLKRLMEAF-AKRQGKEIESLRFLYDGVRVLPDQTPEDLDMEDN 79

Query: 435 DMIEV 439
           D+IE 
Sbjct: 80  DIIEA 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,739,284
Number of extensions: 1516347
Number of successful extensions: 5206
Number of sequences better than 10.0: 66
Number of HSP's gapped: 5348
Number of HSP's successfully gapped: 84
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)