Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F032905.423ON40440421720.0
NDAI0B055905.423ON38037316730.0
Smik_8.1905.423ON42040016690.0
Suva_15.3085.423ON37837616510.0
Skud_8.1735.423ON37837616430.0
YHR112C5.423ON37837516420.0
KAFR0E038605.423ON37837415740.0
CAGL0I01276g5.423ON38037515480.0
SAKL0G02222g5.423ON37837515290.0
TBLA0A036805.423ON38437215100.0
Kpol_1031.235.423ON37937514930.0
KNAG0C049905.423ON38037514720.0
ZYRO0F09768g5.423ON37337314400.0
CAGL0K05665gsingletonON37937514250.0
ZYRO0F15664gsingletonON37337314120.0
KLLA0E21319g5.423ON38037614020.0
NDAI0F00140singletonON37837513480.0
KNAG0F01580singletonON37937313410.0
TBLA0B03020singletonON37937113130.0
TDEL0G00140singletonON38137412761e-175
AER250C5.423ON37437312561e-172
TDEL0G04970singletonON38137612521e-172
TPHA0A06070na 1ON37336312431e-170
Ecym_55235.423ON38137312381e-169
NDAI0B00595singletonON37837612251e-168
Kwal_55.222215.423ON38037011601e-158
KLTH0E16566g5.423ON38137411561e-157
Kpol_1044.107.97ON3914103728e-40
CAGL0H06369g7.97ON3914013702e-39
TPHA0L005707.97ON3914093692e-39
KAFR0K007607.97ON3924143658e-39
NCAS0F015207.97ON4294293608e-38
KLLA0F07909g7.97ON3914063526e-37
NDAI0H024007.97ON3934053526e-37
TDEL0H035307.97ON3914083464e-36
SAKL0B09614g7.97ON3924043448e-36
Smik_1.557.97ON3944033361e-34
YAL012W (CYS3)7.97ON3944033351e-34
Skud_1.497.97ON3944033342e-34
TBLA0E022407.97ON3874083323e-34
Suva_1.567.97ON3954043323e-34
Ecym_26297.97ON3923973324e-34
KLTH0D02728g7.97ON3924013299e-34
ZYRO0D05742g7.97ON3914083229e-33
KNAG0D047407.97ON3903973095e-31
AEL341W7.97ON3934143044e-30
CAGL0L06094g8.145ON4503972473e-22
Skud_7.888.145ON4654122465e-22
ZYRO0G19162g8.145ON4553972431e-21
YGL184C (STR3)8.145ON4654122403e-21
Smik_7.898.145ON4654122403e-21
SAKL0H24882g8.145ON4593972378e-21
KLTH0E06644g8.145ON4603912351e-20
Suva_7.798.145ON4654162323e-20
TDEL0B046608.145ON4643882297e-20
ACL059C8.145ON4532522235e-19
Kwal_47.172218.145ON4634132163e-18
Skud_19.6singletonON4013862153e-18
Ecym_84058.145ON4724142156e-18
KLLA0C17028g8.145ON4604102102e-17
NDAI0D028804.53ON4474592032e-16
NCAS0A058104.53ON4474602004e-16
TDEL0D06630singletonON4023531985e-16
Suva_17.6singletonON4014001986e-16
Smik_7.375na 1ON4013431889e-15
TPHA0F004204.53ON4424481881e-14
KAFR0F030704.53ON4454571853e-14
TBLA0C044004.53ON4454531763e-13
Kpol_1041.444.53ON4444511764e-13
Ecym_83654.53ON4444521754e-13
ADL031W4.53ON4674581755e-13
YFR055W (IRC7)na 1ON3402951727e-13
KNAG0I029204.53ON4454561712e-12
SAKL0H23892g4.53ON4424541684e-12
SAKL0G18172g4.354ON6732421669e-12
YJR130C (STR2)4.354ON6392521651e-11
KLTH0G00418gsingletonON5682601641e-11
Ecym_51694.354ON6812591642e-11
Suva_12.2214.354ON6392591623e-11
ZYRO0B08338g4.354ON6402721605e-11
ZYRO0G22198g4.53ON4454591587e-11
CAGL0D06402g4.53ON4424621579e-11
Smik_10.4234.354ON6392561552e-10
TDEL0D006104.354ON6522691552e-10
AER164C4.354ON6453251534e-10
Skud_10.3534.354ON6402561524e-10
Skud_12.3844.53ON4444481515e-10
TDEL0E05710singletonON5562691515e-10
TPHA0L003304.354ON7172841516e-10
TDEL0E056204.53ON4464581506e-10
Smik_12.3834.53ON4444481491e-09
Suva_10.3974.53ON4444531481e-09
KLTH0D03652g4.53ON4444451462e-09
NCAS0A062704.354ON6592711463e-09
KLTH0D17930g4.354ON6522661453e-09
YLR303W (MET17)4.53ON4444531444e-09
Suva_10.8na 2ON5722521401e-08
Skud_12.10na 2ON5712571401e-08
KLLA0D04037g4.53ON4444471391e-08
Kwal_14.791na 2ON5712491382e-08
Kwal_26.74374.53ON4443101373e-08
CAGL0M00550g4.354ON5692571364e-08
Kpol_1028.804.354ON6892891356e-08
Smik_13.554.354ON6992541331e-07
YLL058Wna 2ON5752721312e-07
Kwal_47.166444.354ON6522711302e-07
Suva_13.684.354ON6882541302e-07
Skud_13.594.354ON6492551293e-07
YML082W4.354ON6492541284e-07
KNAG0M003304.354ON6312981268e-07
NDAI0D032604.354ON6962871259e-07
Smik_12.3na 2ON5662621212e-06
KLLA0B04378g4.354ON6882531223e-06
KAFR0B068304.354ON6672931115e-05
Kwal_26.7197singletonOFF8763999e-05
Kwal_26.71947.97ON152135740.63
TBLA0A104905.263ON28345750.71
Kpol_344.68.331ON2007116751.3
SAKL0C09328g3.85ON67192722.4
Suva_11.725.263ON245122703.1
TDEL0C063701.65ON63581678.6
KAFR0E043904.370ON1431113679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F03290
         (404 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   841   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   649   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   647   0.0  
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   640   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   637   0.0  
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   637   0.0  
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   610   0.0  
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   600   0.0  
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   593   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   586   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   579   0.0  
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   571   0.0  
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   559   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   553   0.0  
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   548   0.0  
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   544   0.0  
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                523   0.0  
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   521   0.0  
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   510   0.0  
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      496   e-175
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   488   e-172
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   486   e-172
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   483   e-170
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   481   e-169
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              476   e-168
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   451   e-158
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   449   e-157
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   147   8e-40
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   147   2e-39
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   146   2e-39
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   145   8e-39
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   143   8e-38
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   140   6e-37
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   140   6e-37
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   137   4e-36
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   137   8e-36
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   134   1e-34
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   133   1e-34
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   133   2e-34
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   132   3e-34
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   132   3e-34
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   132   4e-34
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   131   9e-34
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   128   9e-33
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   123   5e-31
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   121   4e-30
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...   100   3e-22
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    99   5e-22
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    98   1e-21
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...    97   3e-21
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    97   3e-21
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    96   8e-21
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    95   1e-20
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    94   3e-20
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    93   7e-20
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    91   5e-19
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    88   3e-18
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    87   3e-18
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    87   6e-18
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    86   2e-17
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      83   2e-16
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    82   4e-16
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    81   5e-16
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    81   6e-16
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    77   9e-15
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    77   1e-14
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    76   3e-14
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    72   3e-13
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    72   4e-13
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    72   4e-13
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    72   5e-13
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    71   7e-13
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    70   2e-12
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    69   4e-12
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    69   9e-12
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    68   1e-11
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    68   1e-11
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    68   2e-11
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    67   3e-11
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    66   5e-11
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    65   7e-11
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    65   9e-11
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    64   2e-10
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    64   2e-10
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    64   4e-10
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    63   4e-10
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    63   5e-10
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    63   5e-10
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    63   6e-10
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    62   6e-10
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    62   1e-09
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    62   1e-09
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    61   2e-09
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    61   3e-09
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    60   3e-09
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    60   4e-09
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    59   1e-08
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    59   1e-08
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    58   1e-08
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    58   2e-08
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    57   3e-08
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    57   4e-08
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    57   6e-08
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    56   1e-07
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    55   2e-07
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    55   2e-07
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    55   2e-07
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    54   3e-07
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    54   4e-07
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    53   8e-07
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    53   9e-07
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     51   2e-06
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    52   3e-06
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    47   5e-05
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    43   9e-05
Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W ...    33   0.63 
TBLA0A10490 Chr1 (2583135..2583986) [852 bp, 283 aa] {ON} Anc_5....    33   0.71 
Kpol_344.6 s344 (13142..19165) [6024 bp, 2007 aa] {ON} (13142..1...    33   1.3  
SAKL0C09328g Chr3 complement(847128..849143) [2016 bp, 671 aa] {...    32   2.4  
Suva_11.72 Chr11 (147555..148292) [738 bp, 245 aa] {ON} YKL154W ...    32   3.1  
TDEL0C06370 Chr3 complement(1165302..1167209) [1908 bp, 635 aa] ...    30   8.6  
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    30   9.7  

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/404 (100%), Positives = 404/404 (100%)

Query: 1   MIRYTLNTRSHLLKVAPRVARQLATRPIHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYD 60
           MIRYTLNTRSHLLKVAPRVARQLATRPIHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYD
Sbjct: 1   MIRYTLNTRSHLLKVAPRVARQLATRPIHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYD 60

Query: 61  PNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMV 120
           PNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMV
Sbjct: 61  PNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMV 120

Query: 121 HYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSL 180
           HYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSL
Sbjct: 121 HYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSL 180

Query: 181 DISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVK 240
           DISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVK
Sbjct: 181 DISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVK 240

Query: 241 DEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFG 300
           DEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFG
Sbjct: 241 DEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFG 300

Query: 301 NVLDKIYHSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIES 360
           NVLDKIYHSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIES
Sbjct: 301 NVLDKIYHSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIES 360

Query: 361 LVEWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKLQDTN 404
           LVEWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKLQDTN
Sbjct: 361 LVEWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKLQDTN 404

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/373 (80%), Positives = 341/373 (91%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88
           HLST LIH DDKDNRVSDVAPPINVTTTFRYD +DL+PW+ERENLDFM+KTPIYSRL HP
Sbjct: 3   HLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHP 62

Query: 89  NSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYN 148
           NSTRLESIFSE+L+GHAVIYSSG++AFFAAM+HYNPKR+F+GQSYHG RAIANILTRN+ 
Sbjct: 63  NSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQ 122

Query: 149 VEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQ 208
            +QH L++IE++AQ GDIVHLETPVNP+GTSLD+ +FA++AH KGALL VDSTFAPPPLQ
Sbjct: 123 TKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQ 182

Query: 209 DVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLL 268
           +VW+F+ DI+MHSATKYFGGHSDLLSGVLVVK+E VARQLRDDRIYLGTNVANLES++LL
Sbjct: 183 NVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLL 242

Query: 269 RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPV 328
           RSLRTF+MR+ +QSENATK+V FL+ N+ K+  VL  I HSSLQ E FVKKQLKGGY PV
Sbjct: 243 RSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPV 302

Query: 329 FSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADD 388
           FSI+L NKEQCKKFP +LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIR+SIGCE+ADD
Sbjct: 303 FSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADD 362

Query: 389 LINDLSAALNKLQ 401
           LI DL+ AL  LQ
Sbjct: 363 LIQDLANALETLQ 375

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/400 (76%), Positives = 354/400 (88%), Gaps = 2/400 (0%)

Query: 3   RYTLNTRSHLLKVAPRVARQLATRPIHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPN 62
           RY LN    +   A  V R   ++ + LST+LIHGDDKDNRV+DVAPPINV+TTFRYD +
Sbjct: 21  RYFLNVMDCIDVKADCVKR--VSKMVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDD 78

Query: 63  DLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHY 122
           DL+PW+ERENLDFM+K PIYSRL HPNSTRLESIFSE+L+G+AVIYSSG++AF+AAMVHY
Sbjct: 79  DLVPWTERENLDFMEKKPIYSRLAHPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHY 138

Query: 123 NPKRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDI 182
           NPKR+F+GQSYHG RAIANIL+RNY+++Q+PLEDIEKYA +GDIVHLETPVNPYGTS DI
Sbjct: 139 NPKRIFIGQSYHGVRAIANILSRNYDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDI 198

Query: 183 SEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDE 242
              A RAHAKGALL VDSTFA PPLQ VW F ADIV++SATKYFGGHSDLLSGVLVVK+E
Sbjct: 199 ESLAHRAHAKGALLIVDSTFASPPLQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEE 258

Query: 243 DVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNV 302
           + +RQL+DDRIYLGTNVANLES++LLRSLRT++MRI +QSENATK+VKFL+D++ +FG V
Sbjct: 259 ETSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKV 318

Query: 303 LDKIYHSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLV 362
           L KIYHSSLQ E FVKKQL GGY PVF+ITL+ KEQCK+ PL LKYFHHATSLGGIESLV
Sbjct: 319 LKKIYHSSLQREEFVKKQLVGGYGPVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLV 378

Query: 363 EWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKLQD 402
           EWRAMTDPYIDQTLIR+S+GCE A+DLI DL++AL +LQD
Sbjct: 379 EWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKELQD 418

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/376 (78%), Positives = 342/376 (90%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + LST LIH DDKDNRV+DVAPPINV+TTFRYD +DLIPW+ERENLDFM+K P+YSRL H
Sbjct: 2   VDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PNSTRLES+FS++L+G+AV+YSSG++AFFAAMVHYNPK++F+GQSYHG RAIANILTRNY
Sbjct: 62  PNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNY 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
           +++QHPLEDIE+YA +GDIVHLE+PVNPYGTS DI  FARRAHAKGALL +DSTFA PPL
Sbjct: 122 DIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q  W F ADIV++SATKYFGGHSDLLSGVLVVKDE V+R+L+DDRIYLGTNVANLES++L
Sbjct: 182 QYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFML 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRT+++RI +QSENATK+VKFL+D++ +F  VL  IYHSSLQTE FVKKQL GGY P
Sbjct: 242 LRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGP 301

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VF+ITL+ KEQCK FPL LKYFHHATSLGGIESLVEWRAMTDPYIDQTLIR+S+GCE AD
Sbjct: 302 VFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAD 361

Query: 388 DLINDLSAALNKLQDT 403
           DLI DL++AL +LQD 
Sbjct: 362 DLIRDLASALKELQDA 377

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/376 (78%), Positives = 339/376 (90%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           ++LST LIHGDDKDNRV+DVAPPINV+TTFRYD +DLIPW+ERENLDFM+K P+YSRL H
Sbjct: 2   VNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PNSTRLES+FSE+L+G+AVIYSSG++AF+AAMVHYNPK++F+GQSYHG RAI NIL RNY
Sbjct: 62  PNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARNY 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
           +V+Q+PLEDIEKYA +GDIVHLE+PVNPYGTS DI   A RAH KGALL VDSTFA PPL
Sbjct: 122 DVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q  W F AD+V++SATKYFGGHSDLLSGVLVVKDE V+RQL+DDRIYLGTNVANLES++L
Sbjct: 182 QYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFML 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRT++MRI +QSENATK+VKFL+D++ +F  VL  IYHSSLQTE FVKKQL GGY P
Sbjct: 242 LRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGP 301

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VF+I L NKEQCK+ PL LKYFHHATSLGGIESLVEWRAMTDPYIDQTLIR+S+GCE A+
Sbjct: 302 VFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAE 361

Query: 388 DLINDLSAALNKLQDT 403
           DLI DLS+AL +LQDT
Sbjct: 362 DLIKDLSSALKELQDT 377

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/375 (78%), Positives = 338/375 (90%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + LST LIHGDDKDNRV+DVAPPINV+TTFRYD +DLIPW+ERENLDFM+K P+YSRL H
Sbjct: 2   VDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PNSTRLESIFSE+L+G+AVIYSSG++AF+AAMVHYNPK++F+GQSYHG RAIANILTRNY
Sbjct: 62  PNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNY 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            +EQHPLEDIEK A +GDIVHLE+PVNPYGTS DI   ARRAHAKGALL VDSTFA PPL
Sbjct: 122 GIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q  W F ADIV++SATKYFGGHSDLLSGVLVVK+E  +RQL+DDRIYLGTNVANLES++L
Sbjct: 182 QYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFML 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRT++MRI +QSENATK+V+FL+D++ +F  VL  IYHSSLQTE FVKKQL GGY P
Sbjct: 242 LRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGP 301

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VF+ITL  KEQCK+ PL LKYFHHATSLGGIESLVEWRAMTDPYIDQTLIR+S+GCE A+
Sbjct: 302 VFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESAN 361

Query: 388 DLINDLSAALNKLQD 402
           DLI DL++AL +LQD
Sbjct: 362 DLIKDLASALKELQD 376

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/374 (74%), Positives = 329/374 (87%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88
           HL T+LIH DDKDNRVSDVAPPINV+TT+RYD  DLIPW ERENLDFM+K P+YSRL HP
Sbjct: 3   HLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHP 62

Query: 89  NSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYN 148
           N+TRLES+FSE+L GHAVIYSSG +AF+AAMVHYNPK++FMGQ YHG RAIANI+TRNY 
Sbjct: 63  NATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYG 122

Query: 149 VEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQ 208
           VEQ+ L+DIEKYAQ+GDIV +E+P+NPYGTS+DI   A +AH+KGA++ VDSTFAPPPLQ
Sbjct: 123 VEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQ 182

Query: 209 DVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLL 268
             W+  AD+V+HSATKYFGGHSDLLSGV+VVKDE+V ++LRDDRIYLGTNV NLESY+LL
Sbjct: 183 YAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLL 242

Query: 269 RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPV 328
           RSLR++++RI +QSENATKVV+FLN NK +F  VL ++YHSSLQ E FVKKQL GGY PV
Sbjct: 243 RSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPV 302

Query: 329 FSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADD 388
           FS++L+  +QCKKFP  LKYFHHATSLGG+ESLVEWRAMTDPYIDQTLIR+SIG E+ADD
Sbjct: 303 FSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENADD 362

Query: 389 LINDLSAALNKLQD 402
           LI DL  AL +L +
Sbjct: 363 LIKDLETALQELHN 376

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/375 (74%), Positives = 326/375 (86%), Gaps = 3/375 (0%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L+TTLIHGDD  NRV DVAPPINV TTFRYD NDL+PW+ERE+L+FMD+TPIYSRLGHPN
Sbjct: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65

Query: 90  STRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNV 149
           +TRLESIFSE+L GHAVIYSSG++AF AAM H+NPK+LF+GQSYHG   IA+IL+RNY +
Sbjct: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125

Query: 150 EQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQD 209
            Q  L+DIE+YAQKGDIVH+ETPVNP+GTS D+  FA +AH++GALL VDSTFAPPPLQ 
Sbjct: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185

Query: 210 VWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLR 269
            W F ADI+MHSATK+FGGHSDLLSGVLV KDE+V+++L+DDRIYLGTNVANLES+LLLR
Sbjct: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245

Query: 270 SLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVF 329
           SLRTF+MRI +QS+N TK+V+ L  N+ K+  VL +++HSSLQ E FVKKQL GGY PVF
Sbjct: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305

Query: 330 SITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDL 389
           SITL NKEQCK+ PL LKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR SIGCE ADDL
Sbjct: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADDL 365

Query: 390 INDLSAA---LNKLQ 401
           I DL AA   L KLQ
Sbjct: 366 IADLDAAFIELEKLQ 380

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/375 (71%), Positives = 327/375 (87%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + L TTLIH DDKDNRV+D+  PINV TTFRYD N+LI W++REN DF++ TP+YSRL H
Sbjct: 2   VSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PN+TRLESIFSE+L GHAVIYSSG++A+FA + HYNPK+LF+GQSYHGC  IA+I TRN 
Sbjct: 62  PNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNN 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            ++Q+PL+ IE+ A +GDIVHLETPVNP+GTS DI +FAR+AHAKGALL +DSTFAPPPL
Sbjct: 122 GMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           QDVW+F AD+V+HS TKYFGGHSDLLSGV+VVK  +VA+++++DRIYLGTN+ANLESYLL
Sbjct: 182 QDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLL 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRTF+MR+ +QSENAT +VK+L+D+K +F  VLDKIYHSSLQTE FVKKQL+GGY P
Sbjct: 242 LRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGP 301

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFSI LK+K QCKK P  L+ F HATSLGG+ESLVEWRA+TDPYI+QTLIR+S+GCE  +
Sbjct: 302 VFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVE 361

Query: 388 DLINDLSAALNKLQD 402
           DLI DL+ AL +LQD
Sbjct: 362 DLIKDLAGALKQLQD 376

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/372 (72%), Positives = 322/372 (86%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L T LIHGDD +NRV+DVAPPIN+ TTFRYD  DLIPW+ER +L FM+  PIYSRL HPN
Sbjct: 9   LETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHPN 68

Query: 90  STRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNV 149
           S+RLE++FS++L+G+AVIY+SGVSAFFAAM ++NPKR+F+GQ+YHGC A  NIL RN  +
Sbjct: 69  SSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGTL 128

Query: 150 EQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQD 209
           ++H  ++IE++AQKGDIVHLE+PVNPYGTS DI EF ++AH+KG L+ +DSTFAPPPLQ 
Sbjct: 129 KKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQY 188

Query: 210 VWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLR 269
           VW+FD DIVMHSATK+FGGHSDLLSGVLVVKDE++A+ LR+DRIYLGTN+ANLESYLLLR
Sbjct: 189 VWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLLR 248

Query: 270 SLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVF 329
           SLRTF+MRI +QS +AT++VKFLNDN+ KF  VL +IYHSSLQ E FVKKQLKGGY PVF
Sbjct: 249 SLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPVF 308

Query: 330 SITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDL 389
           SI L NKEQCK  P LLKYF HATSLGG+ESL+EWRA+TDPYI QTLIR+S+GCE+  DL
Sbjct: 309 SIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQDL 368

Query: 390 INDLSAALNKLQ 401
           INDL  AL  +Q
Sbjct: 369 INDLDQALTVIQ 380

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/375 (71%), Positives = 320/375 (85%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + LST LIH DDK+NRV+DVAPPINVTTTFRY+  DLIP  ERE++ F+D+ P+YSR GH
Sbjct: 2   VELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREGH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PN TRLE++FSE L GHAVIYSSG+SA+FAA++ +NPKR+FM Q+YHGC AIA +  RN 
Sbjct: 62  PNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRNG 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            V+++ L++IE+YA+KGDIVHLE+PVNP+GTS DI  FA+RAHAKGALL VD TFAPPPL
Sbjct: 122 MVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q+VW+F ADIVMHSATKYFGGHSDLL GVLVVKD+     L++DRI LGTN+ANLESYLL
Sbjct: 182 QNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYLL 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRTF+MRI +QSEN TK+VK+L++NKGK+G VL  I HSSLQ E FVKKQLKGGY+P
Sbjct: 242 LRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYNP 301

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFSITL   EQCK F   LKYF HATSLGG+ESLVEWRA++DP+IDQTL+R+S+GCE AD
Sbjct: 302 VFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESAD 361

Query: 388 DLINDLSAALNKLQD 402
           DLI DL++AL  LQD
Sbjct: 362 DLIKDLASALQNLQD 376

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/375 (70%), Positives = 324/375 (86%), Gaps = 2/375 (0%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88
           HL+TTLIH DD+DNRV DVAPPINV+TT+RYD +DL+PW +RE+L+FMDK PIYSRL HP
Sbjct: 3   HLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLAHP 62

Query: 89  NSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYN 148
           NSTRLES+FS++L GHAV+Y+SG++AFFAA++HYNPKRLF+ QSYHGCRAIA+ILTR   
Sbjct: 63  NSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRTTG 122

Query: 149 VEQHPLEDIEKYAQKGDIVHLETPVNPYGT-SLDISEFARRAHAKGALLCVDSTFAPPPL 207
           ++Q  L+D+ + AQ GD+VHLE+PVNP GT   D+S  A +AH +GA+L VDSTFAPPPL
Sbjct: 123 MQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPPPL 182

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           QD W F  D+VMHSATKYFGGHSDLLSGVLV +D+  A  LRDDRIYLGTNVANLE+YLL
Sbjct: 183 QDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAYLL 242

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQT-EPFVKKQLKGGYD 326
           LRSLRTF++RI+RQS N T VV +LND++G +  VLDK+YHSSLQT EP+V +QL+GG+ 
Sbjct: 243 LRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGGHP 302

Query: 327 PVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDA 386
           PVF++TL++ +QCK+FP LL YF HATSLGG+ESLVEWRAMTDP+IDQTL+R+S+GCE+A
Sbjct: 303 PVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCENA 362

Query: 387 DDLINDLSAALNKLQ 401
           +DLI DL+ ALN LQ
Sbjct: 363 EDLIADLTTALNALQ 377

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/373 (69%), Positives = 311/373 (83%), Gaps = 1/373 (0%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + L T L+HGDD+ NRV+DVAPPINV +TFRYD ++LIPW ++ NLDF+D+ P+YSR GH
Sbjct: 2   VDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PN  RLE++FS  L GHA+ YS G+  F   MVH+NPKR+FM Q YHG + I  IL RNY
Sbjct: 62  PNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNY 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            VE++ L DIEK+AQKGDIVH+ETP+NP+GTSLDISE ARRAH+KGALL VDSTFAPPPL
Sbjct: 122 GVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q+ W+F AD++MHSATKYF GHSDLLSGVLVVKD++VA +L++DRIYLG+N+ANLESYLL
Sbjct: 182 QNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLL 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRT+ +RI RQ+ENATKVVK+LND+K K+   L ++YHSSLQTE FVKKQL GGY P
Sbjct: 242 LRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYTP 300

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFS+T K +EQCKKF   LK F HATSLGG+ESLVEWRAM D  IDQ L+R+SIGCE AD
Sbjct: 301 VFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360

Query: 388 DLINDLSAALNKL 400
           DLINDLS  L++L
Sbjct: 361 DLINDLSTVLSQL 373

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/375 (65%), Positives = 317/375 (84%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + L+T LIH DDK NRVSDVAPPINV+TT+RY   DLIPW++REN DFMD+ P+YSR GH
Sbjct: 2   VELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREGH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PN TRLE+IFS++L GHAV+Y+SG++AFFAAM+HYNPK++F+GQ YHG   I+++ TRN+
Sbjct: 62  PNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRNF 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
           NV+Q  LEDI ++A+KGD+VHLE+PVNP+GT +D+ + A  AH+KGA++ +DSTFAPPPL
Sbjct: 122 NVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q  W+  AD++MHSATKYFGGHSDLL G+LV KD++++R L++DRI LG+ + NLESYLL
Sbjct: 182 QYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYLL 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           +RSLRT++MRI +QSEN  K+VK+LNDNK K+ NVL  IYHSS+Q++ FVK QL GGY+ 
Sbjct: 242 MRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYNS 301

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFS  LK++EQCKKFP  LKYFHHATSLGGIESL+EWRA++D  IDQ L+R+S+GCE A 
Sbjct: 302 VFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESAK 361

Query: 388 DLINDLSAALNKLQD 402
           DLI+DLS AL +L++
Sbjct: 362 DLIDDLSQALQELEN 376

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/373 (67%), Positives = 312/373 (83%), Gaps = 1/373 (0%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + L+T L+HGDD+ NRV+DVAPPINV +TFRYD ++L+PW +  NLD +D+ P+YSR GH
Sbjct: 2   VDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREGH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PN  RLE++FS  L GHAV YS G+  F +AMVH+NPKR+FM Q YHG + I  I+ RNY
Sbjct: 62  PNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRNY 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            VE++ L DIEK+AQKGDIVH+ETP+NP+GTSLDISE ARRAHAKGALL VDSTFAPPPL
Sbjct: 122 GVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q+ W+F AD++MHSATKYFGGHSDLLSGVLVVKD++ A +L++DRI LG+N++NL+SYLL
Sbjct: 182 QNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYLL 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRT+ +RI+RQSE+ATK+V++LND+K  F   LDK+YHSSLQ++ FVKKQL GGY P
Sbjct: 242 LRSLRTYDLRIKRQSESATKIVQYLNDHKNDF-PALDKLYHSSLQSDDFVKKQLSGGYGP 300

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFS+TLK +EQCKKF   LK F HATSLGG+ESLVEWRAM D  IDQ L+R+SIGCE A+
Sbjct: 301 VFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAE 360

Query: 388 DLINDLSAALNKL 400
           DL NDL+  L++L
Sbjct: 361 DLTNDLTTVLSQL 373

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/376 (65%), Positives = 313/376 (83%), Gaps = 2/376 (0%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + LST L+H DDK NRV+D+  PINV TTFRY+  DLIPW+ERE+   ++K PIYSRL H
Sbjct: 1   MSLSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAH 60

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PNS R+ES+ S+VL G AV+Y++G++A+FA + +YNPKRLF+G+ YHGCR+IA+I TRN+
Sbjct: 61  PNSLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNW 120

Query: 148 NVEQHPLE--DIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPP 205
           N+EQH LE  +I ++A KGD+VH+ETPVNPYGTS DI  FA   H+KGA+L +DSTFAPP
Sbjct: 121 NLEQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPP 180

Query: 206 PLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESY 265
           PLQ+ W+F  D+++HSATKYFGGHSDLL+GVL VKD++VA +LR DRIYLGTN+ANLE++
Sbjct: 181 PLQNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAF 240

Query: 266 LLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGY 325
           LLLRSLRTF+MRI+ QSENATK+V +L ++K  F  VL+ ++HSSLQTEPFVK+QLKGGY
Sbjct: 241 LLLRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGY 300

Query: 326 DPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCED 385
            PVF++TL +KEQC+KFP LL  F HATSLGG+ESLVEWRA+TDPYI  TLIR+S+G E+
Sbjct: 301 GPVFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVEN 360

Query: 386 ADDLINDLSAALNKLQ 401
            DDLI D + AL  LQ
Sbjct: 361 VDDLIKDFANALKTLQ 376

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/375 (65%), Positives = 306/375 (81%), Gaps = 1/375 (0%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSE-RENLDFMDKTPIYSRLGH 87
           HLST LIHGDDK NRV+DVAPPINV+TTFR+D N+LIP +E ++ L  +D+ P+Y+R  H
Sbjct: 3   HLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARESH 62

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PNS+R++++ S++L GHAVIY+SG SAF A M HYNPKR FM   Y G  AIA+++TRNY
Sbjct: 63  PNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITRNY 122

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            +EQH L++IE++AQ GDIVHLETP+NP+GTS DI   A+R H KGA+L +D+T APPPL
Sbjct: 123 GLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPPPL 182

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           QD W+F ADI++HSATKYFGGHSDLL+GVLVVK ++ A +L +DRI+LGTN+ NLESYLL
Sbjct: 183 QDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESYLL 242

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRT++MRI +Q  N  KV+ +LN+NK KF  VL+KIYHSSLQ + FV+KQL G Y P
Sbjct: 243 LRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLYCP 302

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VF+ITL + +QCK+ PL LKYF HATSLGG+ESL+EWRAM+D  IDQ LIR+SIGCE+AD
Sbjct: 303 VFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCENAD 362

Query: 388 DLINDLSAALNKLQD 402
           DLI DL  AL  LQ+
Sbjct: 363 DLIKDLENALQILQN 377

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/373 (64%), Positives = 297/373 (79%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88
           H +T+ IH DD++NRV DVAPPINV+ T+RYD ++L    E+E L+ MD  P+YSR  HP
Sbjct: 3   HFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTAHP 62

Query: 89  NSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYN 148
           N TRLES+ S +LNGHAV+Y+SG SAF+AA+VHYNPKRLF+ +SY G  AIA+I+TRNY 
Sbjct: 63  NCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRNYG 122

Query: 149 VEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQ 208
           ++QH  ++IEKYAQ GDIVHLE+P+NPYG S DI   A RAHAKGALL VDST APPPLQ
Sbjct: 123 MQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPPLQ 182

Query: 209 DVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLL 268
           + W+F  DI+MHSATKYFGGHSDLL+G+LV KD+DV+ QL+ DRIYLGT   NLES+LLL
Sbjct: 183 NTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFLLL 242

Query: 269 RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPV 328
           RSLRT +MR+ +QSENATK+V++L DNK  F  VL +IYHSSLQ EPFV  Q+ GGY P+
Sbjct: 243 RSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYTPL 302

Query: 329 FSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADD 388
           FS  L+  +Q K FP  LK F HATSLGGIESL+EWR +++P +DQTL+RIS+GCE+ DD
Sbjct: 303 FSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENVDD 362

Query: 389 LINDLSAALNKLQ 401
           LI DL  AL + Q
Sbjct: 363 LIADLQNALQQAQ 375

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/371 (63%), Positives = 302/371 (81%), Gaps = 1/371 (0%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSEREN-LDFMDKTPIYSRLG 86
           +HL+TTLIH DDK+NRV+DVAPPINV++TFRYD N+LIP +E ++ L  ++++P+YSR  
Sbjct: 2   VHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRES 61

Query: 87  HPNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRN 146
           HPNS+R++SI S++L GHAVIY+SG SAF A M HYNPKR FM   Y G  AIA+++TRN
Sbjct: 62  HPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITRN 121

Query: 147 YNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPP 206
           Y +EQH L++IE++AQ GD+VHLE+P+NP+GT+ DI   A R H+KGA+L +DST APPP
Sbjct: 122 YGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPPP 181

Query: 207 LQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYL 266
           LQ+VW F ADIV+HSATKYFGGHSDLL+GVL VK ++ A +L +DRI+LGTN+ NLESYL
Sbjct: 182 LQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESYL 241

Query: 267 LLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYD 326
           LLRSLRT++MRI +QS+NATK+VK+L+++K      L +I+H+SLQ E F+ KQL GG+ 
Sbjct: 242 LLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGHG 301

Query: 327 PVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDA 386
            VFSI L +  QCKK PL LKYF HATSLGGIESL+EWRAM+D  IDQ LIR+S+GCE+ 
Sbjct: 302 AVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCENV 361

Query: 387 DDLINDLSAAL 397
           +DLI DL  AL
Sbjct: 362 EDLIKDLENAL 372

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  496 bits (1276), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 227/374 (60%), Positives = 291/374 (77%), Gaps = 1/374 (0%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSEREN-LDFMDKTPIYSRLGH 87
           HLST  IH DD  NRV+DVAPPINV+TTFRYD  +L+P  E EN ++ +++TP+YSR  H
Sbjct: 3   HLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRESH 62

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PNS RL+++ S++L GHA +Y+SGVSAF A + HYNPKR FM   Y G R IA +    +
Sbjct: 63  PNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQEKH 122

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            +E + L  IE++A+KGD++HLE P+NPYGT  DI+  A+R H KGA+L +DST APPPL
Sbjct: 123 GLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPPPL 182

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           QD W+F AD+VMHSATKY GGHSDLL+GV+VVK  +  R+L  +RI+LGTNV NLES+LL
Sbjct: 183 QDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESFLL 242

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRTF+MR+ +QSENA K+V FL++NK K+  VL+++YHSSLQ E FV++QL GG+  
Sbjct: 243 LRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGHGA 302

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFS+TL++ EQCKK P  L YF HATSLGG+ESL+EWRA++D  ID  L+R+SIGCE+AD
Sbjct: 303 VFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCENAD 362

Query: 388 DLINDLSAALNKLQ 401
           DLI DL  AL  LQ
Sbjct: 363 DLIQDLDNALQVLQ 376

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  488 bits (1256), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 219/373 (58%), Positives = 286/373 (76%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87
           + L T+LIH DD  NRV+DVAPPINVTTTFRY  +DLIP  ER           YSR+ H
Sbjct: 2   VELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSH 61

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PN  R E + +E L G AV+YSSG++AF AA+ H+NPKRLF+G+ YHGC  +A+I  RN+
Sbjct: 62  PNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNH 121

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            +++  LE++ + ++ GD+VH+E+P+NPYGT +D++  A  AH KGA + +D+TFAPPPL
Sbjct: 122 GLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPPL 181

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           QD WE  AD+V+HS TKYFGGHSDLL GV  V+D  VARQLR DR+YLGTN+ANLE+YLL
Sbjct: 182 QDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLL 241

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           +RS+RT +MR+ RQS +ATKVV +L  +K +FG VL K++HSSLQTEP+V++ L+GG  P
Sbjct: 242 IRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAP 301

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFSI L+  EQCK+ P LLK FHHATSLGG+ESL+EWRAM+D  ++Q L+RIS+GCE  +
Sbjct: 302 VFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPE 361

Query: 388 DLINDLSAALNKL 400
           DLI DL+ A  +L
Sbjct: 362 DLIADLAGAFRQL 374

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  486 bits (1252), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/376 (60%), Positives = 287/376 (76%), Gaps = 1/376 (0%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSEREN-LDFMDKTPIYSRLGH 87
           HLSTT IH DD  NRVSDVAPPINVTTTFR+D ++LIP +E EN ++ ++++P+Y+R  H
Sbjct: 3   HLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARETH 62

Query: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147
           PNS R++SI S +L GHA +Y+SG SAF A M   NPKR+FM  +Y G   IA+++   Y
Sbjct: 63  PNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKEKY 122

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
            ++   L+ IE++A+KGD+VHLETP+NP+G   +I   A R H KGALL VDST APPPL
Sbjct: 123 GLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPPPL 182

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
           Q+ W+F ADIVMHSATKY GGHSDLL+GVLVVKD +  R L  +RIYLGTN+ NLES+LL
Sbjct: 183 QNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESFLL 242

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327
           LRSLRTF+MR+ +QSENA KVV FL++N  K+  VLD++YHSSLQ E FV+KQL GG+  
Sbjct: 243 LRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGHGA 302

Query: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           VFS+ LK+ EQ KK P  L YF HATSLGG+ESL+EWRAM+D  ID  L+R+S+GCE+ D
Sbjct: 303 VFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCENVD 362

Query: 388 DLINDLSAALNKLQDT 403
           DLI DL   L  LQ+ 
Sbjct: 363 DLIQDLDQGLQALQNA 378

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  483 bits (1243), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 221/363 (60%), Positives = 292/363 (80%), Gaps = 1/363 (0%)

Query: 43  RVSDVAPPINVTTTFRYDPNDLIPWSE-RENLDFMDKTPIYSRLGHPNSTRLESIFSEVL 101
           ++SD+APPINV+TT+RYD ++LIP +E ++ L  +++ P+YSR  H NS+R++ + S+VL
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 102 NGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEKYA 161
           NGHAVIY+SG SAF A M HYNPKR+F  +SY G +AIAN++TRNY ++Q+ L+DI+K+A
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 162 QKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHS 221
           Q+GDI+H+ETP+NP+GT+++I E A +AHAK ALL VDST APPPLQ+ ++F ADIV+HS
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 222 ATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQ 281
           ATKY GGHSDLL+GVLVVK E  AR L +DRI+LGTN+ NLES+LLLRSLRT++MR+  Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 282 SENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKK 341
           S+N  K+V FL  N+ ++ NV+  IYHSSLQ E FV +QL  G+  VF++  K++EQCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 342 FPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKLQ 401
           F   LKYF HATSLGG+ESLVEWRAM+DP ID  LIR SIGCE+A+DLI DL +AL +L+
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRLE 367

Query: 402 DTN 404
             N
Sbjct: 368 KEN 370

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  481 bits (1238), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/373 (60%), Positives = 291/373 (78%), Gaps = 1/373 (0%)

Query: 30  LSTTLIHGDDK-DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88
           LST LIH DD   + V+DVAPPINV+TTFRYD ++L+      +    +  P+YSR GHP
Sbjct: 4   LSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSREGHP 63

Query: 89  NSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYN 148
           NS R  SI S  LNG+AV Y+SG+SAF AA+ HYNPKRLF+GQSYHGC  +A+I  RNY 
Sbjct: 64  NSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVRNYG 123

Query: 149 VEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQ 208
           + +  L++IE+ AQ GD+VH+E+P+NPYGT++DI E+  + H KGA++ +DSTFAPPPLQ
Sbjct: 124 LLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPPPLQ 183

Query: 209 DVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLL 268
           + WEF  DI+MHS TKY GGHSDLL GVLVVKD+ V RQL  DRIYLGTN+ANL+SYLL+
Sbjct: 184 NAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSYLLI 243

Query: 269 RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPV 328
           RSLRT ++R+ +QS+ ATK+V +L  +  +F +VL +I H+SLQ E FVKKQL GG+ PV
Sbjct: 244 RSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGHTPV 303

Query: 329 FSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADD 388
           FSI LK  +QC++ P  LK+FHHATS GG+ESL+EWRA++DP I++TL+R+S+GCED +D
Sbjct: 304 FSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCEDHND 363

Query: 389 LINDLSAALNKLQ 401
           LINDL+ AL  LQ
Sbjct: 364 LINDLANALRYLQ 376

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  476 bits (1225), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/376 (60%), Positives = 296/376 (78%), Gaps = 1/376 (0%)

Query: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSE-RENLDFMDKTPIYSRLG 86
           +HLSTTLIHGDDK NRV+ VAPPINV+TTFR+D N+LIP +E ++ L  +D+ P+Y++  
Sbjct: 2   VHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKES 61

Query: 87  HPNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRN 146
           +PNS+R++++ S++L GHAVIY+SG S F A M HYNPKR FM   Y G  AIA++LTRN
Sbjct: 62  YPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTRN 121

Query: 147 YNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPP 206
           Y +EQ  L++IE++AQ GDIVHLETP+NP+GTS D+     R H KGA+L +D+T A PP
Sbjct: 122 YGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASPP 181

Query: 207 LQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYL 266
           LQD W+F ADI++HSATKY GGHSDLL+GVLVVK ++ A +L +DRI+LGTN+ NLESYL
Sbjct: 182 LQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESYL 241

Query: 267 LLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYD 326
           LLR L T++MRI +Q +N  KV+ +LN+NK KF  V++KIYHSS Q + F++KQL G Y 
Sbjct: 242 LLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLYC 301

Query: 327 PVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDA 386
           PVF+ITL + +QCK+ PL LKYF HATSLG  ESL+EWRA++D  IDQ LI +SIGCE+A
Sbjct: 302 PVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCENA 361

Query: 387 DDLINDLSAALNKLQD 402
           DDLI DL  AL  LQ+
Sbjct: 362 DDLIKDLENALQILQN 377

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  451 bits (1160), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 283/370 (76%)

Query: 31  STTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNS 90
           +T  IH DD  NRVSDVAPPINV+TTFRYD   L+P +    +   D   IYSRLGHPN+
Sbjct: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64

Query: 91  TRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNVE 150
            RLE++ S++L+ HAV+Y+SG++A+ A +VH+ PKRLF+   YHGC+ +A I++R   +E
Sbjct: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124

Query: 151 QHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDV 210
              LEDIE   Q+GD+VH+E P+NP+G ++D++++A R H+ G L+ +DST  PPPL++ 
Sbjct: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184

Query: 211 WEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRS 270
           W++ ADI+MHS TKYFGGHSDLLSG++ V DE +A QL++DR YLGT  A+LES+LLLRS
Sbjct: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRS 244

Query: 271 LRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVFS 330
           LRT  +R+ RQS+N T++V +L +N  KF +V+ +I H+SLQTE FVK+Q+ GG+ PVF+
Sbjct: 245 LRTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304

Query: 331 ITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDLI 390
           + LK+++QC+K    + +F HATSLGG+ESL+EWRAM+DP   +TLIR+S+G E+ +DLI
Sbjct: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364

Query: 391 NDLSAALNKL 400
            DL+ +L K+
Sbjct: 365 ADLAGSLEKI 374

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  449 bits (1156), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/374 (57%), Positives = 280/374 (74%), Gaps = 6/374 (1%)

Query: 31  STTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNS 90
           ST  IHGDD+ NRVSDVAPPINV+TTFRYD   L P +        D   IYSRLGHPN+
Sbjct: 5   STATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNA 64

Query: 91  TRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNVE 150
            RLE + +E+L+G  V+Y+SG++A+ A ++H NPKRLF    YHGC A+A I++R   +E
Sbjct: 65  DRLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGME 124

Query: 151 QHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDV 210
             PLE++E   Q GD+VHLE P NPYG  +++ EFA + H  GAL+ VDST APPPL++ 
Sbjct: 125 ILPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPPLRNT 184

Query: 211 WEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRS 270
           WEF ADIVMHS TKYFGGHSDLLSG++ V+DE VA+QLR+DR YLGT  A+LESYLLLRS
Sbjct: 185 WEFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRS 244

Query: 271 LRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVFS 330
           LRT ++R+ +QS N T++V++L  +K ++ +V+  I H+SLQ E FVKKQL GGY PVFS
Sbjct: 245 LRTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYGPVFS 304

Query: 331 ITLKNKEQCKKFPLLLK---YFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           + L ++EQCK   LL+K    F HATSLGG ESL+EWRAM+DP+ ++ LIR+S+G E+A+
Sbjct: 305 LLLFSQEQCK---LLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAE 361

Query: 388 DLINDLSAALNKLQ 401
           DLI DL+  L K++
Sbjct: 362 DLIEDLAGTLEKIE 375

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  147 bits (372), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 131/410 (31%), Positives = 206/410 (50%), Gaps = 57/410 (13%)

Query: 18  RVARQLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFM 76
           +   + AT+ IH  + + +HG         V  PI+++TTF+       P  E E     
Sbjct: 4   KATDKFATKAIHAGSHVDVHGS--------VIEPISLSTTFKQSA-PAQPIGEYE----- 49

Query: 77  DKTPIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQS 132
                YSR  +PN   LE   + + NG + + +SSG SA  + ++   P+    + +G  
Sbjct: 50  -----YSRSQNPNRKNLEDAIAALENGKYGLAFSSG-SATTSVILQSLPQGSHAVSIGDV 103

Query: 133 YHGCRAIANILTRNYNVE----QHPLEDIEKYAQKGD-IVHLETPVNPYGTSLDISEFAR 187
           Y G       +   + VE     + +E++ +  ++   +V +E+P NP     DI   ++
Sbjct: 104 YGGTHRYFTKVANTHGVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQ 163

Query: 188 --RAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVA 245
             ++  K  +L VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL   D+D+ 
Sbjct: 164 TIKSLKKDIILVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIY 223

Query: 246 RQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDK 305
            +L+  +  +G   +  +S+L+ R L+T  +R+ + + NATK+ +FL  N+    NV+  
Sbjct: 224 ERLQFLQNAIGAIPSPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASNE----NVIAV 279

Query: 306 IYHSSLQTEPF--VKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGI 358
            Y     +E F  VKKQ    L GG   + S  +K   E   KF    + F  A SLGGI
Sbjct: 280 NYPGLPSSENFEVVKKQHRDALGGG---MISFRIKGGAEAASKFSSSTRLFTLAESLGGI 336

Query: 359 ESLVEWRA-MTDPYIDQT----------LIRISIGCEDADDLINDLSAAL 397
           ESL+E  A MT   I +           LIR+S+G ED+DDL++D+  AL
Sbjct: 337 ESLLEVPAVMTHGGIPKEQREASGVFDDLIRLSVGIEDSDDLLDDIKQAL 386

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  147 bits (370), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 130/401 (32%), Positives = 197/401 (49%), Gaps = 52/401 (12%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRY-DPNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +T  IH    ++    V  PI+++TTF+  +P   I   E            YSR  +P
Sbjct: 9   FATKAIHAGAHEDIHGSVIEPISLSTTFKQSEPAKPIGTYE------------YSRSQNP 56

Query: 89  NSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCR----AIA 140
           N   LE+  + +  G + + +SSG SA  A ++   P+    + +G  Y G       +A
Sbjct: 57  NRENLEAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVA 115

Query: 141 NILTRNYNVEQHPLEDIEKYAQKG-DIVHLETPVNPYGTSLDISEFARRAHA--KGALLC 197
           N    + +   + +ED+ K  +    +V +E+P NP     DI   A       K  LL 
Sbjct: 116 NAHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDILLV 175

Query: 198 VDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGT 257
           VD+TF  P L +  +F ADIV+HSATKY  GHSD++ GVL    +D+  +L+  +  +G 
Sbjct: 176 VDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGC 235

Query: 258 NVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP-- 315
             +  +++L  R L+T  +R+ + S NATK+  FL  N+    NV+  + +  LQ+ P  
Sbjct: 236 IPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNE----NVV-AVNYPGLQSHPNY 290

Query: 316 -FVKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLVEWRA-MT 368
             VKKQ    L GG   + S  +K   E   KF    + F  A SLGGIESL+E  A MT
Sbjct: 291 DVVKKQHREALGGG---MISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMT 347

Query: 369 DPYIDQT----------LIRISIGCEDADDLINDLSAALNK 399
              I +           L+R+S+G ED +DL+ D+  AL K
Sbjct: 348 HGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  146 bits (369), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 132/409 (32%), Positives = 200/409 (48%), Gaps = 59/409 (14%)

Query: 22  QLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKT 79
           + AT+ IH  + + +HG         V  PI+++TTF+   P +  P  E E        
Sbjct: 8   KFATKAIHAGSHVDVHGS--------VIEPISLSTTFKQSAPAE--PIGEYE-------- 49

Query: 80  PIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSG--VSAFFAAMVHYNPKRLFMGQSYHGC 136
             YSR  +PN   LE   + + NG + + +SSG   +A     +  N   + +G  Y G 
Sbjct: 50  --YSRSQNPNRKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGT 107

Query: 137 R----AIANILTRNYNVEQHPLEDIEKYAQKGD-IVHLETPVNPYGTSLDISEFAR--RA 189
                 +AN    + +     + D+ K  ++   +V +E+P NP     DI   A+  ++
Sbjct: 108 HRYFSKVANTHGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKS 167

Query: 190 HAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLR 249
             K  LL VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL     D+  +L+
Sbjct: 168 LNKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQ 227

Query: 250 DDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHS 309
             +  +G   +  +++L  R L+T  +R+ + + NATK+ +FL  +     NV+  + + 
Sbjct: 228 FLQNAVGAIPSPFDAWLTHRGLKTLHLRVRQAALNATKIAEFLAQSD----NVV-AVNYP 282

Query: 310 SLQTEP---FVKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESL 361
            L T P    VKKQ    L GG   + S  +K   E   KF    + F  A SLGGIESL
Sbjct: 283 GLPTNPDYAIVKKQHRDALGGG---MISFRVKGGAEAASKFASSTRLFTLAESLGGIESL 339

Query: 362 VEWRA-MTDPYIDQT----------LIRISIGCEDADDLINDLSAALNK 399
           +E  A MT   I +           L+R+S+G ED DDL+ D+ AAL K
Sbjct: 340 LEVPAVMTHGGIPKEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQK 388

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  145 bits (365), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 201/414 (48%), Gaps = 61/414 (14%)

Query: 18  RVARQLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDF 75
           R + + AT+ IH    + +HG         V  PI+++TTFR   P   I   E      
Sbjct: 4   RESDKFATKAIHAGAHVDVHGS--------VIEPISLSTTFRQSAPAQPIGTYE------ 49

Query: 76  MDKTPIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQ 131
                 YSR  +PN   LE   + + NG + + +SSG SA  A ++   P+    + +G 
Sbjct: 50  ------YSRSQNPNRENLEVAIASLENGKYGLAFSSG-SATTAVILQSLPQGSHAISIGD 102

Query: 132 SYHGCRAIANILTRNYNVEQH----PLEDIEKYAQKG-DIVHLETPVNPYGTSLDISEFA 186
            Y G       +   + VE       L D+ K  ++   +V +E+P NP     DI   +
Sbjct: 103 VYGGTHRYFTKVANAHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVS 162

Query: 187 RRAHA--KGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDV 244
           ++  +  K  LL VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL   ++D+
Sbjct: 163 QKVKSLNKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDI 222

Query: 245 ARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLD 304
             +L+  +  +G   +  +++L  R LRT  +R+ + S +A K+ +FL +N+      ++
Sbjct: 223 YERLQFLQNAIGAIPSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNEN-----VE 277

Query: 305 KIYHSSLQTEP---FVKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLG 356
            + +  L T      VKKQ    L GG   + S  +K   E   KF    + F  A SLG
Sbjct: 278 AVNYPGLPTHKDYDVVKKQHREALGGG---MISFRIKGGAEAAAKFSSSTRLFALAESLG 334

Query: 357 GIESLVEWRA-MTDPYIDQ----------TLIRISIGCEDADDLINDLSAALNK 399
           G+ESL+E  A MT   I +           L+R+S+G ED DDL+ D+  AL K
Sbjct: 335 GVESLLEVPAVMTHGGIPKEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALEK 388

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  143 bits (360), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 134/429 (31%), Positives = 207/429 (48%), Gaps = 60/429 (13%)

Query: 1   MIRYTLNT--RSHLLKVAPRVARQLATRPIHLST-TLIHGDDKDNRVSDVAPPINVTTTF 57
           ++RY  NT  + H  K+  +   + AT+ IH  T T +HG         V  PI+++TTF
Sbjct: 23  ILRYN-NTFKKFHHTKMVLKATDKFATKAIHAGTHTDVHGS--------VIEPISLSTTF 73

Query: 58  RYD-PNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAF 115
           +   P + +   E            YSR  +PN   LE+  + + NG + + +SSG SA 
Sbjct: 74  KQSSPANPVGIYE------------YSRSQNPNRENLENAIAALENGKYGLAFSSG-SAT 120

Query: 116 FAAMVHYNPK---RLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEK-----YAQKGDIV 167
            A ++   P+    + +G  Y G       +   + VE     D+ K       +   +V
Sbjct: 121 TATVLQSLPQGSHAISIGDVYGGTHRYFTKVANAHGVETTFTNDLLKELPNLVKENTKLV 180

Query: 168 HLETPVNPYGTSLDISEFAR--RAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKY 225
            +E+P NP     DI   A   ++  K  +L VD+TF  P L +  +F ADIV+HSATKY
Sbjct: 181 WIESPTNPTLKVTDIQAVADAIKSLNKDIILVVDNTFLSPYLSNPLDFGADIVVHSATKY 240

Query: 226 FGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENA 285
             GHSD++ GVL   D+ +  +L+  +  +G   +  +S+L  R L+T  +R+ + S NA
Sbjct: 241 INGHSDVVLGVLATNDKALYEKLQFLQNAIGAIPSPFDSWLAHRGLKTLHLRVRQASLNA 300

Query: 286 TKVVKFLNDNKGKFGNVLDKIYHSSLQTE---PFVKKQLK---GGYDPVFSITLKNKEQC 339
           TK+ +FL  +      ++  + +  L T      V+KQ +   GG    F I     E  
Sbjct: 301 TKIAQFLQSSP-----LVKAVNYPGLPTHENYAVVQKQHREALGGGMISFRIQ-GGSEAA 354

Query: 340 KKFPLLLKYFHHATSLGGIESLVEWRA-MTDPYIDQT----------LIRISIGCEDADD 388
            KF    + F  A SLGGIESL+E  A MT   I +           L+R+S+G ED DD
Sbjct: 355 SKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASGVYDDLVRLSVGIEDGDD 414

Query: 389 LINDLSAAL 397
           L++D+  AL
Sbjct: 415 LLDDIKQAL 423

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  140 bits (352), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 131/406 (32%), Positives = 195/406 (48%), Gaps = 57/406 (14%)

Query: 22  QLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP 80
           + AT+ IH  T + +HG         V  PI+++TTF+       P  E E         
Sbjct: 8   KFATKAIHAGTHVDVHGS--------VIEPISLSTTFKQSA-PAQPIGEYE--------- 49

Query: 81  IYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGC 136
            YSR  +PN   LE   + + NG + + +SSG SA  A ++   P+    + +G  Y G 
Sbjct: 50  -YSRSQNPNRKNLEDAIAALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGT 107

Query: 137 RAIANILTRNYNVEQHPLEDI-----EKYAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
                 +   + VE     ++         +   +V +ETP NP     DI   A+ A +
Sbjct: 108 HRYFTKVANAHGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKS 167

Query: 192 --KGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLR 249
             K  LL VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL   D+ +  +L+
Sbjct: 168 INKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQ 227

Query: 250 DDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHS 309
             +  +G   +  +S+L+ R ++T  +R+ + S +A K+ +FL+ N+    NV+   Y  
Sbjct: 228 FLQNAIGAIPSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNE----NVIAVNYPG 283

Query: 310 SLQTEPF--VKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLV 362
               E +  VKKQ    L GG   + S  +K   E    F    + F  A SLGGIESL+
Sbjct: 284 LPTHESYAVVKKQHRDALGGG---MISFRIKGGAEAASTFSSSTRLFTLAESLGGIESLL 340

Query: 363 EWRA-MTDPYIDQT----------LIRISIGCEDADDLINDLSAAL 397
           E  A MT   I +           L+R+SIG ED DDL+ D+  AL
Sbjct: 341 EVPAVMTHGGIPKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQAL 386

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  140 bits (352), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 192/405 (47%), Gaps = 55/405 (13%)

Query: 22  QLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKT 79
           + AT+ IH  + + +HG         V  PI+++TTF+   P   I   E          
Sbjct: 8   KFATKAIHAGSHVDVHGS--------VIEPISLSTTFKQSAPAQPIGTYE---------- 49

Query: 80  PIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSG--VSAFFAAMVHYNPKRLFMGQSYHGC 136
             YSR  +PN   LE+  + + NG + + +SSG   +A     +  N   + +G  Y G 
Sbjct: 50  --YSRSQNPNRENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGT 107

Query: 137 RAIANILTRNYNVEQHPLEDIEK-----YAQKGDIVHLETPVNPYGTSLDISEFAR--RA 189
                 +   + VE     D+ K       +   +V +E+P NP     DI   ++  ++
Sbjct: 108 HRYFTKVANAHGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKS 167

Query: 190 HAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLR 249
             K  LL VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL   ++++  +L+
Sbjct: 168 LNKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQ 227

Query: 250 DDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHS 309
             +  +G   +  +S+L  R L+T  +R+ + S  ATK+ +FL+ N       +  + + 
Sbjct: 228 FLQNAVGAIPSPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPN-----VKAVNYP 282

Query: 310 SLQTEP---FVKKQLK---GGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVE 363
            L T      VKKQ +   GG    F I     E   KF    + F  A SLGGIESL+E
Sbjct: 283 GLPTHENYDIVKKQHREALGGGMISFRIN-GGSEAAAKFSSSTRLFTLAESLGGIESLLE 341

Query: 364 WRA-MTDPYIDQT----------LIRISIGCEDADDLINDLSAAL 397
             A MT   I +           LIR+S+G EDA DL++D+  AL
Sbjct: 342 VPAVMTHGGIPKESREASGVYDDLIRLSVGIEDAGDLLDDIKQAL 386

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  137 bits (346), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 126/408 (30%), Positives = 195/408 (47%), Gaps = 53/408 (12%)

Query: 18  RVARQLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFM 76
           R + + AT+ IH    + IHG         V  PI+++TTF+   +   P  E E     
Sbjct: 4   RESDKFATKAIHAGAHVDIHGS--------VIEPISLSTTFK-QSSPAAPLGEYE----- 49

Query: 77  DKTPIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQS 132
                YSR  +PN   LE   + + N  + + +SSG SA  A ++   P+    + +G  
Sbjct: 50  -----YSRSQNPNRKNLEEALAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDV 103

Query: 133 YHGCRAIANILTRNYNVEQHPLEDIEK-----YAQKGDIVHLETPVNPYGTSLDISEFAR 187
           Y G       +   + V+     D+ K       +   +V +E+P NP     DI+   +
Sbjct: 104 YGGTHRYFTKVANAHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVK 163

Query: 188 RAHA--KGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVA 245
            A    K  L+ VD+TF  P L +   F  DIV+HSATKY  GHSD++ GVL   D+ + 
Sbjct: 164 TAKQINKEILVVVDNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIY 223

Query: 246 RQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDK 305
            +L+  +  +G   +  +S+L  R L+T  +R+ + +  ATK+ +FL  +     NVL  
Sbjct: 224 EKLQFLQNAIGAIPSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFLEQDS----NVL-A 278

Query: 306 IYHSSLQTEP---FVKKQLKGGY-DPVFSITLKNKEQ-CKKFPLLLKYFHHATSLGGIES 360
           + +  L + P    V++Q + G    + S  +K   Q   KF    + F  A SLGGIES
Sbjct: 279 VNYPGLASNPDREIVQRQHRDGLGGGMISFRIKGGAQAAAKFSSSTRLFTLAESLGGIES 338

Query: 361 LVEWRA-MTDPYIDQT----------LIRISIGCEDADDLINDLSAAL 397
           L+E  A MT   I +           LIR+S+G ED+DDL+ D+  AL
Sbjct: 339 LLEVPAVMTHGGIPKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEAL 386

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  137 bits (344), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 128/404 (31%), Positives = 198/404 (49%), Gaps = 53/404 (13%)

Query: 22  QLATRPIHLST-TLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP 80
           + AT+ IH    T +HG         V  PI+++TTF+       P  E E         
Sbjct: 8   KFATKAIHAGAHTDVHGS--------VIEPISLSTTFKQTA-PAQPVGEYE--------- 49

Query: 81  IYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGC 136
            YSR  +PN   LE   + + N  + + +SSG SA  A ++   P+    + +G  Y G 
Sbjct: 50  -YSRSQNPNRKNLEDAVAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGT 107

Query: 137 RAIANILTRNYNVE----QHPLEDIEKYAQKGD-IVHLETPVNPYGTSLDISEFAR--RA 189
                 +   + VE     + +ED+ +  ++   +V +E+P NP     DI   ++  ++
Sbjct: 108 HRYFTKVANAHGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKS 167

Query: 190 HAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLR 249
             K  LL VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL   D+++  +L+
Sbjct: 168 INKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQ 227

Query: 250 DDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHS 309
             +  +G   +  +++L  R L+T  +R+ + +  ATK+ +FL+ ++         + + 
Sbjct: 228 FLQNAIGAIPSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLSQSEDVVA-----VNYP 282

Query: 310 SLQTEP---FVKKQLKGGY-DPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLVEW 364
            L T P    V KQ + G    + S  +K   E   KF    + F  A SLGGIESL+E 
Sbjct: 283 GLPTHPNHNVVLKQHRDGLGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEV 342

Query: 365 RA-MTDPYI--DQ--------TLIRISIGCEDADDLINDLSAAL 397
            A MT   I  DQ         LIR+SIG ED DDL++D+  AL
Sbjct: 343 PAVMTHGGIPKDQREASGVFDDLIRLSIGIEDTDDLLDDIKQAL 386

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  134 bits (336), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 193/403 (47%), Gaps = 53/403 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +T  IH  +  +    V  PI+++TTF+   P + I   E            YSR  +P
Sbjct: 9   FATKAIHAGEHIDVHGSVIEPISLSTTFKQSSPANPIGTYE------------YSRSQNP 56

Query: 89  NSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCRAIANILT 144
           N   LE   + + N  + + +SSG SA  A ++   P+    + +G  Y G       + 
Sbjct: 57  NRENLEKAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVA 115

Query: 145 RNYNVEQHPLEDI-----EKYAQKGDIVHLETPVNPYGTSLDISEFAR--RAHAKG--AL 195
             + VE     D+     +       +V +ETP NP     DI + A   + HA G   +
Sbjct: 116 NAHGVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVI 175

Query: 196 LCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYL 255
           L VD+TF  P + +   F ADIV+HSATKY  GHSD++ GVL   ++ +  +L+  +  +
Sbjct: 176 LVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAI 235

Query: 256 GTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP 315
           G   +  +++L  R L+T  +R+ + + +A K+ +FL  +K    NV+  + +  L+T P
Sbjct: 236 GAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDK---ENVV-AVNYPGLKTHP 291

Query: 316 ---FVKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLVEWRA- 366
               V KQ    L GG   + S  +K   E   KF    + F  A SLGGIESL+E  A 
Sbjct: 292 NYDVVLKQHRDALGGG---MISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAV 348

Query: 367 MTDPYIDQT----------LIRISIGCEDADDLINDLSAALNK 399
           MT   I +           L+RIS+G ED DDL+ D+  AL +
Sbjct: 349 MTHGGIPKEAREASGVYDDLVRISVGIEDTDDLLEDVKQALKQ 391

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  133 bits (335), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 194/403 (48%), Gaps = 53/403 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +T  IH  +  +    V  PI+++TTF+   P + I   E            YSR  +P
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYE------------YSRSQNP 56

Query: 89  NSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCRAIANILT 144
           N   LE   + + N  + + +SSG SA  A ++   P+    + +G  Y G       + 
Sbjct: 57  NRENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVA 115

Query: 145 RNYNVEQHPLEDI-----EKYAQKGDIVHLETPVNPYGTSLDISEFAR--RAHAKG--AL 195
             + VE     D+     +   +   +V +ETP NP     DI + A   + HA G   +
Sbjct: 116 NAHGVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVI 175

Query: 196 LCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYL 255
           L VD+TF  P + +   F ADIV+HSATKY  GHSD++ GVL   ++ +  +L+  +  +
Sbjct: 176 LVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAI 235

Query: 256 GTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP 315
           G   +  +++L  R L+T  +R+ + + +A K+ +FL  +K    NV+  + +  L+T P
Sbjct: 236 GAIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADK---ENVV-AVNYPGLKTHP 291

Query: 316 ---FVKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLVEWRA- 366
               V KQ    L GG   + S  +K   E   KF    + F  A SLGGIESL+E  A 
Sbjct: 292 NYDVVLKQHRDALGGG---MISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAV 348

Query: 367 MTDPYIDQT----------LIRISIGCEDADDLINDLSAALNK 399
           MT   I +           L+RIS+G ED DDL+ D+  AL +
Sbjct: 349 MTHGGIPKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQ 391

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  133 bits (334), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 193/403 (47%), Gaps = 53/403 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +T  IH  +  +    V  PI+++TTF+   P + I   E            YSR  +P
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYE------------YSRSQNP 56

Query: 89  NSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCRAIANILT 144
           N   LE   + + N  + + +SSG SA  A ++   P+    + +G  Y G       + 
Sbjct: 57  NRENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGAHAVSIGDVYGGTHRYFTKVA 115

Query: 145 RNYNVEQHPLEDI-----EKYAQKGDIVHLETPVNPYGTSLDISEFAR--RAHAKG--AL 195
             + VE     D+     +       +V +ETP NP     DI + A   + HA G   +
Sbjct: 116 NAHGVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVI 175

Query: 196 LCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYL 255
           L VD+TF  P + +  +F ADIV+HSATKY  GHSD++ GVL    + +  +L+  +  +
Sbjct: 176 LVVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAI 235

Query: 256 GTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP 315
           G   +  +++L  R L+T  +R+ + + +A K+ +FL  +K    N++  + +  L+T P
Sbjct: 236 GAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDK---ENIV-AVNYPGLKTHP 291

Query: 316 ---FVKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLVEWRA- 366
               V KQ    L GG   + S  +K   E   KF    + F  A SLGGIESL+E  A 
Sbjct: 292 NYDVVLKQHRDALGGG---MISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAV 348

Query: 367 MTDPYIDQT----------LIRISIGCEDADDLINDLSAALNK 399
           MT   I +           LIRIS+G ED DDL+ D+  AL +
Sbjct: 349 MTHGGIPKEAREASGVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  132 bits (332), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 194/408 (47%), Gaps = 59/408 (14%)

Query: 22  QLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKT 79
           + AT+ IH    + +HG         V  PI+++TTF+   P+  I   E          
Sbjct: 8   KFATKAIHAGAHIDVHGS--------VIEPISLSTTFKQSAPSQPIGIYE---------- 49

Query: 80  PIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHG 135
             YSR  +PN   LE   + + NG + + +SSG SA  A ++   P+    + +G  Y G
Sbjct: 50  --YSRSQNPNRKNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVYGG 106

Query: 136 CRAIANILTRNYNVEQ----HPLEDIEKYAQKGD-IVHLETPVNPYGTSLDISEFARRAH 190
                  +   + VE     + +E++    +    +V +E+P NP     DI        
Sbjct: 107 THRYFTKVANAHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVK 166

Query: 191 A--KGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQL 248
              K  L+ VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL    +++  +L
Sbjct: 167 KLNKDILVVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERL 226

Query: 249 RDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYH 308
           +  +  +G   +  +++L  R L+T  +R+ + S +A K+ +FL  +     NV+  + +
Sbjct: 227 QFLQNAIGAIPSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQDP----NVI-AVNY 281

Query: 309 SSLQTEP---FVKKQLKGGY-DPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLV- 362
             L++ P    VKKQ + G    + S  +K   E   KF    + F  A SLGGIESL+ 
Sbjct: 282 PGLESHPNRDIVKKQHRDGLGGGMISFRIKGGAEGASKFTQKTRLFTLAESLGGIESLLE 341

Query: 363 ------------EWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALN 398
                       E R  T  Y D  L+R+S+G ED DDL+ D+  ALN
Sbjct: 342 VPAVMTHGGIPKEAREATGVYDD--LVRLSVGIEDVDDLLADVKQALN 387

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  132 bits (332), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/404 (30%), Positives = 193/404 (47%), Gaps = 54/404 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +T  IH  +  +    V  PI+++TTF+   P + I   E            YSR  +P
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYE------------YSRSQNP 56

Query: 89  NSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCRAIANILT 144
           N   LE   + + N  + + +SSG SA  A ++   P+    + +G  Y G       + 
Sbjct: 57  NRENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVA 115

Query: 145 RNYNVEQHPLEDIEK-----YAQKGDIVHLETPVNPYGTSLDISEFA-----RRAHAKGA 194
             + VE     D+ K           +V +ETP NP     DI + A       A ++  
Sbjct: 116 NAHGVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDV 175

Query: 195 LLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIY 254
           +L VD+TF  P + +   F ADIV+HSATKY  GHSD++ GVL    + +  +L+  +  
Sbjct: 176 ILVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNA 235

Query: 255 LGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTE 314
           +G   +  +++L  R L+T  +R+ + + +A K+ +FL  +K    N++  + +  L+T 
Sbjct: 236 IGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADK---ENIV-AVNYPGLKTH 291

Query: 315 P---FVKKQ----LKGGYDPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLVEWRA 366
           P    V KQ    L GG   + S  +K   E   KF    + F  A SLGGIESL+E  A
Sbjct: 292 PNYDVVVKQHRDALGGG---MISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPA 348

Query: 367 -MTDPYIDQT----------LIRISIGCEDADDLINDLSAALNK 399
            MT   I +           L+RIS+G EDADDL++D+  AL +
Sbjct: 349 VMTHGGIPKEAREASGVFDDLVRISVGIEDADDLLDDIKQALKQ 392

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  132 bits (332), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 194/397 (48%), Gaps = 44/397 (11%)

Query: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +ST ++H  +  +    V  PI+++TTF+   +  +P    E          YSR  +P
Sbjct: 8   QISTKVVHAGEHVDIHGSVIEPISLSTTFK-QASPAVPVGAYE----------YSRSQNP 56

Query: 89  NSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCRAIANILT 144
           N   LE   + + N  H + +SSG SA  A ++   P+    + +G  Y G     N + 
Sbjct: 57  NRKNLEDAIAVLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFNNVA 115

Query: 145 RNYNVE----QHPLEDIEKYAQKG-DIVHLETPVNPYGTSLDISEFAR--RAHAKGALLC 197
             + VE     + +ED+    ++   +V +E+P NP     DI   ++  ++  K  +L 
Sbjct: 116 NAHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIILV 175

Query: 198 VDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGT 257
           VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL    + +  +L+  +  +G 
Sbjct: 176 VDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIGA 235

Query: 258 NVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP-- 315
             +  +++L  R L+T  +R+   S +A ++ +FL  +     + +  + +  L + P  
Sbjct: 236 VPSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFLVKS-----DKVISVNYPGLSSHPNN 290

Query: 316 -FVKKQLKGGY-DPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIESLVEWRA-MTDPY 371
             VKKQ + G    + S  +K   +   KF    + F  A SLGGIESL+E  A MT   
Sbjct: 291 DIVKKQHRDGLGGGMISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 372 I--DQ--------TLIRISIGCEDADDLINDLSAALN 398
           I  DQ         LIR+S+G ED  DL+ D+  ALN
Sbjct: 351 IPKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQALN 387

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  131 bits (329), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 185/401 (46%), Gaps = 52/401 (12%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +T  IH     +    V  PI+++TTF+   P   I   E            YSR  +P
Sbjct: 9   FATLAIHAGAHTDVHGSVIEPISLSTTFKQSAPAQPIGAYE------------YSRSQNP 56

Query: 89  NSTRLESIFSEVLNGH-AVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCRAIANILT 144
           N   LE+  + +      + +SSG SA  A ++   P     + +G  Y G       + 
Sbjct: 57  NRANLEAAVAALERAQFGLAFSSG-SATTAVVLQSLPTDSHAISIGDVYGGTHRYFTQVA 115

Query: 145 RNYNVEQHPLEDIEK-----YAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGA--LLC 197
             + V+     D+E+           +V LE+P NP     DI   A  AHA     L+ 
Sbjct: 116 HAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDILVV 175

Query: 198 VDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGT 257
           VD+TF  P + +     ADIV+HSATKY  GHSD++ GVL   +E +  +LR  +  +G 
Sbjct: 176 VDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNAIGA 235

Query: 258 NVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP-- 315
             +  +S+L  R L+T  +R+   +++A ++ KFL  +     + ++ + +  L + P  
Sbjct: 236 VPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLEAS-----DRVEHVNYPGLSSHPAY 290

Query: 316 -FVKKQ----LKGGYDPVFSITLKNKE-QCKKFPLLLKYFHHATSLGGIESLVEWRA-MT 368
             V+KQ    L GG   + S  +K       +F    + F  A SLGGIESLVE  A MT
Sbjct: 291 AVVQKQHRDALGGG---MISFRIKGGAGAAARFTSTTRLFTLAESLGGIESLVEVPAVMT 347

Query: 369 DPYIDQ----------TLIRISIGCEDADDLINDLSAALNK 399
              I +           LIR+S+G ED DDL+ D+  AL K
Sbjct: 348 HGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  128 bits (322), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 194/408 (47%), Gaps = 53/408 (12%)

Query: 18  RVARQLATRPIHLSTTL-IHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFM 76
           +   + AT+ IH    + +HG         V  PI+++TTF+       P  E E     
Sbjct: 4   KATDKFATKAIHAGAHVDVHGS--------VIEPISLSTTFKQSA-PAQPLGEYE----- 49

Query: 77  DKTPIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQS 132
                YSR  +PN   LE   + + NG H + +SSG SA  A ++   P+    + +G  
Sbjct: 50  -----YSRSQNPNRKNLEDAIASLENGKHGLAFSSG-SATTAVILQSLPQGSHAISIGDV 103

Query: 133 YHGCR----AIANILTRNYNVEQHPLEDIEKYAQKG-DIVHLETPVNPYGTSLDISEFAR 187
           Y G       +AN    + +     ++D+    +    ++ +E+P NP     DI+   +
Sbjct: 104 YGGTHRYFTKVANAHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNK 163

Query: 188 RAHA--KGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVA 245
                 K  L+ VD+TF  P L +  +F  D+V+HSATKY  GHSD++ GVL     ++ 
Sbjct: 164 TVKELNKDILVVVDNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELY 223

Query: 246 RQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDK 305
            +L+  +  +G   +  +++L  R L+T  +R+ + +  ATK+ +FL  N     + +  
Sbjct: 224 ERLQFLQNAIGAIPSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSN-----DRVIA 278

Query: 306 IYHSSLQTEP---FVKKQLKGGY-DPVFSITLK-NKEQCKKFPLLLKYFHHATSLGGIES 360
           + +  L + P    V++Q + G    + S  +K   E   KF    + F  A SLGGIES
Sbjct: 279 VNYPGLASHPSHDVVQRQHRDGLGGGMISFRIKGGAEGAAKFSSNTRLFTLAESLGGIES 338

Query: 361 LVEWRA-MTDPYI--DQT--------LIRISIGCEDADDLINDLSAAL 397
           L+E  A MT   I  DQ         LIR+S+G ED +DL+ D+  AL
Sbjct: 339 LLEVPAVMTHGGIPEDQREASGVYDDLIRLSVGIEDTEDLLEDIKQAL 386

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  123 bits (309), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 117/397 (29%), Positives = 190/397 (47%), Gaps = 48/397 (12%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKTPIYSRLGHP 88
            +T  +H  +  +    V  PI+++TTF+   P + I   E            YSR  +P
Sbjct: 7   FATLAVHAGEHTDVHGSVIEPISLSTTFKQSSPANPIGVYE------------YSRSQNP 54

Query: 89  NSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHGCRAIANILT 144
           N   LE+  + +    + + +SSG SA  + ++   P+    + +G  Y G       + 
Sbjct: 55  NRDNLENAIAALEKAQYGLAFSSG-SAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTKVA 113

Query: 145 RNYNVE----QHPLEDIEKYAQKGD-IVHLETPVNPYGTSLDISEF--ARRAHAKGALLC 197
             + VE     + LE++    +    +V +E+P NP     DI     A +   K  LL 
Sbjct: 114 NTHGVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDILLV 173

Query: 198 VDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGT 257
           VD+TF  P L +   F ADIV+HSATKY  GHSD++ GVL    +D+  +L+  +  +G 
Sbjct: 174 VDNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGA 233

Query: 258 NVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP-- 315
             +  +++L  R L+T  +R+++ S  A K+ +FL+ +K      ++ + +  L+T P  
Sbjct: 234 IPSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSASKH-----VEAVNYPGLKTHPNH 288

Query: 316 -FVKKQLK---GGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRA-MTDP 370
             V++Q +   GG    F +         KF    + F  A SLGGIESL+E  A MT  
Sbjct: 289 AVVQRQHRDALGGGMISFRVK-GGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMTHG 347

Query: 371 YIDQ----------TLIRISIGCEDADDLINDLSAAL 397
            I +           LIR+S+G ED +DL+ D+  AL
Sbjct: 348 GIPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQAL 384

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  121 bits (304), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 120/414 (28%), Positives = 194/414 (46%), Gaps = 61/414 (14%)

Query: 22  QLATRPIHLST-TLIHGDDKDNRVSDVAPPINVTTTFRYD-PNDLIPWSERENLDFMDKT 79
           + AT+ IH    T +HG         V  PI+++TTF+   P + +   E          
Sbjct: 8   KFATKAIHAGAHTDLHGS--------VIEPISLSTTFKQSSPGNPVGAYE---------- 49

Query: 80  PIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHG 135
             YSR  +PN   LE   + + +  + + +SSG SA  A +V   P+    + +G  Y G
Sbjct: 50  --YSRGQNPNRQNLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGG 106

Query: 136 CRAIANILTRNYNVE----QHPLEDIEKYAQKGD-IVHLETPVNPYGTSLDISEFARRAH 190
                  +   + VE       LED+ K  +    +V +E+P NP     DI + A    
Sbjct: 107 THRYFTKVANAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVK 166

Query: 191 A--KGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQL 248
           A  +  +L VD+TF  P L +   F ADIV+HSATKY  GHSD++ G L      +  +L
Sbjct: 167 ALNEDIILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERL 226

Query: 249 RDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIY- 307
              +  +G   +  +++L  R L+T  +R+ + +++A K+ ++L  ++    +V+   Y 
Sbjct: 227 AFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLEQSE----HVVSVNYP 282

Query: 308 ----HSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLL---LKYFHHATSLGGIES 360
               H   Q     +KQ + G      I+ + K   +   LL    + F  A SLGGIES
Sbjct: 283 GLPSHRGYQ---IAQKQHRDGLGGGM-ISFRVKGGAQGAALLSQSTRLFTLAESLGGIES 338

Query: 361 LVEWRA-MTDPYIDQT----------LIRISIGCEDADDLINDLSAALNKLQDT 403
           L+E  A MT   I +           L+R+S+G ED DDL+ D+  AL+ + ++
Sbjct: 339 LLEVPAVMTHAGIPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQALSVVAES 392

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/397 (25%), Positives = 168/397 (42%), Gaps = 69/397 (17%)

Query: 50  PINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLES----IFSEVLNGHA 105
           P+ ++TTF+ D        E EN  +      YSR G+P  T L+     ++ ++     
Sbjct: 11  PLYLSTTFKVD-------LENENNQYD-----YSRSGNPTRTLLQQQVAKLYDDIDPNFV 58

Query: 106 VIYSSGVSAFFAAMVHYNPKR-----LFMGQS-YHGCRAIANILTRNYNVEQHPLEDIEK 159
              SSG++A    +  + P       +  G   Y G + + N+L  + +     L   E 
Sbjct: 59  FAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHTEN 118

Query: 160 YAQKG-----------DIVHLETPVNPYGTSLDISEFAR--RAHAKGALLCVDSTFAPPP 206
           +  K            DI+ LE+P NP    +DI    +  R ++   L+ +D+T     
Sbjct: 119 FKAKFYDLVTIKKTIVDIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMSGL 178

Query: 207 LQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYL 266
             +  +F AD+V  SATKY  GH D+++GV++ K++ +A ++       G+ +  ++S+L
Sbjct: 179 NCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLNPMDSWL 238

Query: 267 LLRSLRTFKMRIERQSENATKVVKFLNDNKG----KFGNVLDKIY-----------HSSL 311
           L+R L+T  +R+ +Q  NA  +  +L +  G       N L   Y           H S 
Sbjct: 239 LIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKTRYIGLKSHPDYELHRSF 298

Query: 312 QTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEW-----RA 366
              P     L+ G  P+    + +K        LLK ++   S G + SL+        A
Sbjct: 299 NKGPGAVISLQTGSIPISKKIVASK--------LLKLWNVTVSFGCVNSLISMPCLMSHA 350

Query: 367 MTDPYID------QTLIRISIGCEDADDLINDLSAAL 397
             DP +       + LIR+  G ED   L  DL  A 
Sbjct: 351 SIDPELRKERQFPEDLIRLCCGIEDVKALQEDLLGAF 387

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 99.4 bits (246), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 108/412 (26%), Positives = 180/412 (43%), Gaps = 57/412 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L T +++   ++++ S   PP+ ++TTF+ D N+       +N D       YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQNFD-------YSRSGNPT 54

Query: 90  STRLESIFSE---VLNGHAVIYSSGVSAF---FAAMVHYN------PKRLFMGQSYHGCR 137
            + L++   +   V   + +  SSG++A       +V  N      P  +     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 138 AIANILT-RNYNVEQH-PLEDIEKY------AQKGDIVHLETPVNPYGTSLDISEFAR-- 187
            + N    + + V  H    D EK+        K D V LE+P NP    +DI +  R  
Sbjct: 115 RLLNFFKHQTHAVTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFV 174

Query: 188 RAHAKGALLCVDSTFAPP----PLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDED 243
           +  +   ++ VD+T        PLQ       D+V  SATKY  GH DL+ GV++ K  +
Sbjct: 175 KRISPETIVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 244 VARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKG---KFG 300
           +A +L       G  ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L ++ G      
Sbjct: 233 IASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCGFKPTET 292

Query: 301 NVLDKIYHSSLQTEPFVK--KQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLG 356
           N   K     L++ P  K  +    G   V S    + E  K+      L  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSFG 352

Query: 357 GIESLVEW-----RAMTDPYI------DQTLIRISIGCEDADDLINDLSAAL 397
            + SL+        A  DP +       + L+R+  G E+  DL  DL AA+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 106/397 (26%), Positives = 172/397 (43%), Gaps = 72/397 (18%)

Query: 50  PINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNG-----H 104
           P+ ++TTF+ D       S+ +  D       YSR G+P  + L     ++ N      H
Sbjct: 23  PVYMSTTFKVDLR-----SDGQAYD-------YSRSGNPTRSLLHRQLGQLYNVPESQVH 70

Query: 105 AVIYSSGVSAFFAAM-------VHYNPKRLFMGQSYHG-----------CRA-IANILTR 145
           AV  SSG++A  A M         + P  L     Y G           C A   N+ T 
Sbjct: 71  AV--SSGMTALDAIMRGLILSNTSHVPTILAGDDLYGGSDRLLTFLKTRCHARTINVDTS 128

Query: 146 NYNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFAR--RAHAKGALLCVDSTFA 203
           N++  Q     ++K     D VH+E+P NP    +D+       ++ +    + VD+T  
Sbjct: 129 NFDKFQEAFLSVDKV----DCVHIESPTNPMCKVVDVPRIISFVKSVSPQTYVIVDNTMM 184

Query: 204 PPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYL-----GTN 258
              L +     AD V  SATK+  GH D+++GV+V +++ +A     D IY      G  
Sbjct: 185 SGLLCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVVNATGCG 239

Query: 259 VANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKG---KFGNVLDKIYHSSLQTEP 315
           +A ++S+LL+R L+T  +R+ +Q  NA  + ++L  + G      N L +  +  LQ+ P
Sbjct: 240 LAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYVGLQSHP 299

Query: 316 --FVKKQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLGGIESLVEW-----RA 366
              + +    G   V S    +    ++      LK +    S G + SL+        A
Sbjct: 300 QFSLHRSFNDGPGAVLSFETGSTPLSRRIVSSKALKIWSVTVSFGCVNSLISLPCSMSHA 359

Query: 367 MTDPYID------QTLIRISIGCEDADDLINDLSAAL 397
             DP +       + LIR+ +G ED  DL  DL AA+
Sbjct: 360 SIDPNVRKEREFPEDLIRLCVGIEDIVDLQKDLLAAM 396

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 179/412 (43%), Gaps = 57/412 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L T +++   ++++ S   PP+ ++TTF+ D N+     + +N D       YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EDAQNYD-------YSRSGNPT 54

Query: 90  STRLESIFSE---VLNGHAVIYSSGVSAF---FAAMVHYN------PKRLFMGQSYHGCR 137
            + L+    +   V   + +  SSG++A       +V  N      P  +     Y G +
Sbjct: 55  RSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 138 AIANIL-TRNYNVEQH-PLEDIEKYA------QKGDIVHLETPVNPYGTSLDISEFAR-- 187
            + N    +++ V  H    D EK+        K D V LE+P NP    +DI    R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 188 RAHAKGALLCVDSTFAPP----PLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDED 243
           +  +    + VD+T        PLQ       D+V  SATKY  GH DL+ GV++ K  +
Sbjct: 175 KCISPDTTVVVDNTMMSGLNCNPLQ--LNPGCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 244 VARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKG---KFG 300
           +A +L       G  ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L ++ G      
Sbjct: 233 IASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRT 292

Query: 301 NVLDKIYHSSLQTEPFVK--KQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLG 356
           N   K     L++ P  K  K    G   V S    + E  K+      L  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 357 GIESLVEW-----RAMTDPYI------DQTLIRISIGCEDADDLINDLSAAL 397
            + SL+        A  DP +       + L+R+  G E+  DL  DL AA+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 107/412 (25%), Positives = 180/412 (43%), Gaps = 57/412 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L T +++   ++++ S   PP+ ++TTF+ D ++       ++ D       YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLSN----ETAQDYD-------YSRSGNPT 54

Query: 90  STRLESIFSE---VLNGHAVIYSSGVSAF---------FAAMVHYNPKRLFMGQSYHGCR 137
            + L++   +   V   + +  SSG++A          F    ++ P  +     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQ 114

Query: 138 AIANIL-TRNYNVEQH-PLEDIEKYA------QKGDIVHLETPVNPYGTSLDISEFAR-- 187
            + N    +++ V  H    D EK+        K D V LE+P NP    +DI    R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 188 RAHAKGALLCVDSTFAPP----PLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDED 243
           +  +    + VD+T        PLQ   +   D+V  SATKY  GH DL+ GV++ K  +
Sbjct: 175 KCISPETTVVVDNTMMSGLNCNPLQ--LDPGCDVVYESATKYLNGHHDLMGGVIISKTAE 232

Query: 244 VARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKG---KFG 300
           +A +L       G  ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L D+ G      
Sbjct: 233 IAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTET 292

Query: 301 NVLDKIYHSSLQTEPFVK--KQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLG 356
           N   K     L++ P  K  +    G   V S    + E  K+      L  +    S G
Sbjct: 293 NKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 357 GIESLVEW-----RAMTDPYI------DQTLIRISIGCEDADDLINDLSAAL 397
            + SL+        A  DP +       + LIR+  G E+  DL  DL AA+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDLLAAM 404

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 95.9 bits (237), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 104/397 (26%), Positives = 181/397 (45%), Gaps = 51/397 (12%)

Query: 40  KDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSE 99
           KD   S V PP+  +TTF+    +          D  D+   Y+R G+P  + L+   ++
Sbjct: 17  KDQHGSSV-PPLYQSTTFKQSSLE----------DDADQEYDYTRSGNPTRSVLQEQIAK 65

Query: 100 VLN--GHAVI-YSSGVSAF---FAAMV----HYNPKRLFMGQSYHGCRAIANILTR--NY 147
           + N  G  V   SSG++       A+V    ++ P  +     Y G + +   L R  + 
Sbjct: 66  LYNVPGFQVFAVSSGMTCLDVILRALVLGNSNHTPTIIAGDDLYGGTQRLLTFLERKNHA 125

Query: 148 NVEQHPLEDIEKY--AQKG----DIVHLETPVNPYGTSLDI---SEFARRAHAKGALLCV 198
            V      D +K+  A  G    D V LE+P NP     D+   ++F ++A+ K  ++ V
Sbjct: 126 RVIHVDTTDFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIKQANPKCHVV-V 184

Query: 199 DSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTN 258
           D+T       +  EF  D+V  S TKY  GH D+++GV++ + +++A++L       G  
Sbjct: 185 DNTMVSGLNCNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQELYFVINSTGCG 244

Query: 259 VANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHS---SLQTEP 315
           ++ ++ +LL+R L+T  +R+ +Q  NA  + ++L  + G   N  +K+  +    L++ P
Sbjct: 245 LSPMDCWLLIRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSENKLLRTRYVGLKSHP 304

Query: 316 FVK--KQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLGGIESLVEW-----RA 366
             +  +    G   V S    + E  K+      LK +    S G + SL+        A
Sbjct: 305 QFELHRSFNKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNSLISMPCKMSHA 364

Query: 367 MTDPYI------DQTLIRISIGCEDADDLINDLSAAL 397
             DP +       + L+R+  G ED  DL  DL AA+
Sbjct: 365 SIDPELRKERDFPEDLVRLCCGIEDVKDLQKDLLAAM 401

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 96/391 (24%), Positives = 171/391 (43%), Gaps = 55/391 (14%)

Query: 49  PPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESIFSEVLN---GHA 105
           PPI  +TTF+    +          D   +   Y+R G+P  T ++    ++ +      
Sbjct: 25  PPIYQSTTFKIGSLE----------DDASQPYDYTRSGNPTRTVVQHQIGKLYDVDAAQV 74

Query: 106 VIYSSGVSAF---FAAMVHYNPKR---LFMGQSYHGC--RAIANILTRNYNVEQH----- 152
           +  SSG++A      A+V  N  R   +  G   +G   R + ++ +RN+    H     
Sbjct: 75  LAVSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGTQRLLTHLESRNHARVLHVDTAN 134

Query: 153 --PLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAH-----AKGALLCVDSTFAPP 205
                ++ K  +  D V LE+P NP    L +++  R  H      +  L+ +D+T    
Sbjct: 135 YETFVEVFKQQEHVDCVLLESPTNPL---LKVADLPRLTHFIKSANEACLVAIDNTMMSG 191

Query: 206 PLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESY 265
            L +  +F  D+V  SATKY  GH D+++G++V +   +A+++       G+ ++  +S+
Sbjct: 192 MLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQEIYFVINSTGSGLSPFDSW 251

Query: 266 LLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDK----IYHSSLQTEPFVK--K 319
           LL+R L+T  +R+ +Q  NA  +  +L ++ G  G    K         L++ P  +  K
Sbjct: 252 LLVRGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGKKGVKGSPRTRFVGLKSHPQFELHK 311

Query: 320 QLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLGGIESLVEW-----RAMTDPYI 372
               G   V S    + E  ++      +K +    S G + SL+        A  DP +
Sbjct: 312 SFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGCVNSLISMPCKMSHAAIDPAL 371

Query: 373 DQT------LIRISIGCEDADDLINDLSAAL 397
            Q       L+R+  G E+  DL NDL  A+
Sbjct: 372 RQERDFPEDLVRLCCGIENISDLQNDLLEAM 402

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 105/416 (25%), Positives = 179/416 (43%), Gaps = 65/416 (15%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L T +++   ++++ S   PP+ ++TTF+ D N+       ++ D       YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQDYD-------YSRSGNPT 54

Query: 90  STRLESIFSE---VLNGHAVIYSSGVSAF---FAAMVHYN------PKRLFMGQSYHGCR 137
            + L++   +   V   + +  SSG++A       +V  N      P  +     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGTQ 114

Query: 138 AIANIL------------TRNYNVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEF 185
            + N              T N++  +   + ++K     D V LE+P NP    +DI + 
Sbjct: 115 RLLNFFKHQTHAVTVHVDTSNFDRFKTVFQSLDKV----DCVLLESPTNPLCKVVDIPKI 170

Query: 186 AR--RAHAKGALLCVDSTFAPP----PLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVV 239
            R  +  +    + VD+T        PLQ       D+V  SATKY  GH DL+ GV++ 
Sbjct: 171 LRYVKCVSPDTKVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIIS 228

Query: 240 KDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKG-- 297
           K  ++A +L       G  ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L D+ G  
Sbjct: 229 KTAEIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSCGFK 288

Query: 298 -KFGNVLDKIYHSSLQTEPFVK--KQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHA 352
               N   K     L++ P  K  +    G   V S    + E  K+      L  +   
Sbjct: 289 PTATNKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVT 348

Query: 353 TSLGGIESLVEW-----RAMTDPYI------DQTLIRISIGCEDADDLINDLSAAL 397
            S G + SL+        A  DP +       + L+R+  G E+  DL  DL AA+
Sbjct: 349 VSFGCVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 92.8 bits (229), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 97/388 (25%), Positives = 175/388 (45%), Gaps = 53/388 (13%)

Query: 50  PINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLE---SIFSEVLNGHAV 106
           P+ ++TTF+ D ++     E +  D       YSR G+P  + L+       EV   H +
Sbjct: 29  PLYLSTTFKVDLDN----PESQVFD-------YSRSGNPTRSLLQYQIGKLYEVPVEHVL 77

Query: 107 IYSSGVSAF--------FAAMVHYNPKRLFMGQSYHGC-RAIANILTRNYNVEQH-PLED 156
             +SG++A          ++  H  P  +     Y G  R +A + ++++    H    D
Sbjct: 78  AVASGMTALDVILRGLVISSATHV-PTIIAGDDLYGGSNRLLAYLESKSHARAVHVDTTD 136

Query: 157 IEKYAQ------KGDIVHLETPVNPYGTSLDISE---FARRAHAKGALLCVDSTFAPPPL 207
           +EK+        K D V LE+P NP    +D+ +   + +R  +   ++ VD+T      
Sbjct: 137 MEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRI-SPSTVVIVDNTMMSGLQ 195

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267
            +  E+  D+V  SATKY  GH D++ G++V K  ++A+++       G+ ++ ++S+LL
Sbjct: 196 CNPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMDSWLL 255

Query: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKG---KFGNVLDKIYHSSLQTEPFVK--KQLK 322
            R L+T  +R+ +Q  N+  + ++L ++ G      N   K  +  L+T P  +  +   
Sbjct: 256 NRGLKTLGVRMYQQQYNSMVIAQWLEESCGFKPTEKNSALKTRYVGLKTNPGFELHRSFN 315

Query: 323 GGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLGGIESLVEW-----RAMTDPYIDQT 375
            G   V S    + E  ++       + F    S G + SL+        A  DP + + 
Sbjct: 316 KGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASIDPEVRKQ 375

Query: 376 ------LIRISIGCEDADDLINDLSAAL 397
                 LIR+ +G ED  DL  DL  A+
Sbjct: 376 REFPEDLIRLCVGIEDVGDLQKDLLYAM 403

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 115/252 (45%), Gaps = 26/252 (10%)

Query: 169 LETPVNPYGTSLDISEFAR--RAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           LE+P NP     D+       +AHA G  + VD+T       +     AD V  SATKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENAT 286
            GH D+++GV+V     +A +       +G  +A ++++LL+R L+T  +R+ +Q  NA 
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 287 KVVKFLNDNKG---KFGNVLDKIYHSSLQTEPFVK--KQLKGGYDPVFSI-----TLKNK 336
            +  +L +  G     GN   +     L++ P  K  +    G   V SI      L  +
Sbjct: 268 VLAHWLREVCGFRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDTALSER 327

Query: 337 EQCKKFPLLLKYFHHATSLGGIESLVEW-----RAMTDPYIDQT------LIRISIGCED 385
             C K    L+++    S G + SL+        A  DP + +       LIR+S G ED
Sbjct: 328 IVCSKK---LQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGVED 384

Query: 386 ADDLINDLSAAL 397
            +DL  DL AAL
Sbjct: 385 VEDLQQDLLAAL 396

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 176/413 (42%), Gaps = 64/413 (15%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L + + H D   + V    PPI  +TTF+    +          D   +   Y+R G+P 
Sbjct: 12  LVSVVQHSDQHGSSV----PPIYQSTTFKIGSLE----------DDASQPYDYTRSGNPT 57

Query: 90  STRLESIFSEVLN---GHAVIYSSGVSAF---FAAMV----HYNPKRLFMGQSYHGCRAI 139
            T ++    ++        +  SSG++A      A+V     Y P  +     Y G + +
Sbjct: 58  RTVVQHQIGKLYGVDASQVLAVSSGMTALDVILRALVLTNNSYVPTIIAGDDLYGGTQRL 117

Query: 140 ANIL-TRNYNVEQHPLEDIEKY--------AQ-KGDIVHLETPVNPYGTSLD---ISEFA 186
              L +RN+    H   D   Y        AQ + D V LE+P NP     D   I+ F 
Sbjct: 118 LTYLESRNHARVLHV--DTTNYDAFTALFNAQPRVDCVLLESPTNPLLKVADLPRITRFV 175

Query: 187 RRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVAR 246
           ++++ K  ++ +D+T     L +   F  D+V  SATKY  GH D+++G++V +   +A 
Sbjct: 176 KQSNEK-CVVAIDNTMMSGMLCNPLHFHCDVVYESATKYLNGHHDIMAGIVVARSAQLAG 234

Query: 247 QLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKI 306
           ++       G  ++  +S+LL+R L+T  +RI +Q  NA  +  +L ++ G   +   K 
Sbjct: 235 EIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQHNAMVLAHWLENSCGFVSH--GKK 292

Query: 307 YHSSLQT---------EPFVKKQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSL 355
              SLQT         E  + K    G   V S    + E  ++      +K +    S 
Sbjct: 293 GKGSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFETGSFEHSRRLVSSKKIKLWAVTVSF 352

Query: 356 GGIESLVEW-----RAMTDPYIDQT------LIRISIGCEDADDLINDLSAAL 397
           G + SL+        A  DP + Q       L+R+  G E+  DL NDL  A+
Sbjct: 353 GCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENIVDLQNDLLEAM 405

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 95/386 (24%), Positives = 157/386 (40%), Gaps = 37/386 (9%)

Query: 37  GDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPNSTRLESI 96
           G + D +   V PP+   +T  +   D        +++ M     Y   G P    LE  
Sbjct: 20  GRNPDEQNGFVNPPLYKGSTIIHKKLD--------DVEHMKGRFFYGTAGSPTIANLEDA 71

Query: 97  FSEVLNGHAVIYS-SGVSAFFAAMVHYNPKR---LFMGQSYHGCRAIANILTRNYNVEQH 152
           ++ +  G   + S SG+ +   A++         L     Y   R + + L   + +E  
Sbjct: 72  WTHLTGGAGTVLSPSGLGSISLALLTLAKAGDHILITDSVYVPTRMLCDGLLAKFGIETE 131

Query: 153 PL-----EDIEKYAQKGD-IVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPP 206
                  EDI+K  +    ++ LE+P +      DI      A   G    +D+T+A P 
Sbjct: 132 YYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQDIPALVSVAKKHGIKTILDNTWATPL 191

Query: 207 LQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYL 266
             D      DI + + TKY GGHSDLL G L   +E+    LR     +       +  L
Sbjct: 192 FFDAHGHGIDISLEAGTKYLGGHSDLLIG-LTSANEECWPLLRSTYDAMAMLPGADDCLL 250

Query: 267 LLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLK--GG 324
            LR +RT  +R++     A  +  +L D      + ++K+ H + +  P  +  ++   G
Sbjct: 251 ALRGMRTLHLRLKEAERKALDLAAWLEDR-----DEVEKVLHPAFKDCPGHEYWVRDYKG 305

Query: 325 YDPVFSITLKN---KEQCKKFPLLLKYFHHATSLGGIESLV-------EWRAMTDPYIDQ 374
              +FSI LK+   +   +     +K FH   S GG ESL+       + +A   P+   
Sbjct: 306 SSGLFSIVLKDGYTRTGLENMVEKMKVFHLGFSWGGYESLITPVNPARQRKAANWPHRGF 365

Query: 375 TLIRISIGCEDADDLINDLSAALNKL 400
            L RI +G E+  DL  DL     +L
Sbjct: 366 AL-RIQVGLEELTDLKRDLELGFERL 390

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 104/414 (25%), Positives = 174/414 (42%), Gaps = 62/414 (14%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L T L++   + +      PP+  +TTF+ +  +  P  +  +         Y+R G+P 
Sbjct: 16  LHTRLVNVTQQKDPYGASVPPLYQSTTFKQESFE--PGCQEYD---------YTRSGNPT 64

Query: 90  STRLESIFSE---VLNGHAVIYSSGVSAFFAAM--------VHYNPKRLFMGQSYHGCRA 138
            + +E    +   V     +  SSG+SA    +            P  +     Y G + 
Sbjct: 65  RSVVERQVGKLYGVCGEQVLAVSSGMSALDVILRSILGSYQAGKTPVVIAGDDLYGGTQR 124

Query: 139 IANILTRNYNVEQHPLE--------DIEKYAQKGDIVHLETPVNPYGTSLDISEFAR--R 188
           +  IL    +V+   ++        D+    +    V LE+P NP     D+ +     +
Sbjct: 125 LLGILGIQGHVKVLHVDTSDAARFVDVFLSQRNVACVLLESPTNPLMKVADLPKLISFVK 184

Query: 189 AH--AKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVAR 246
           +H    G  + VD+T       +  E  AD+V  SATK+  GH D+++GV+V    ++A+
Sbjct: 185 SHRGGSGCKIVVDNTMVSGINCNPLELGADLVYESATKFLNGHHDIMAGVIVAASVELAQ 244

Query: 247 QLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFG----NV 302
            +      +G  +A ++S+LL+R L+T  +R+ +Q  NA  +  +L D+ G F     N 
Sbjct: 245 DMYFIVNSMGAGLAPMDSWLLIRGLKTLGVRMYQQQHNAMVLAHWLQDSCG-FAPTEQNS 303

Query: 303 LDKIYHSSLQTEP--FVKKQLKGGYDPVFS-----ITLKNKEQC-KKFPLLLKYFHHATS 354
             +     L++ P   + +    G   V S     I L  K  C KKF    KY++   S
Sbjct: 304 QLRTRFVGLKSHPQFHLHRSFNSGPGAVLSIETGDIELSEKIVCSKKF----KYWNVTVS 359

Query: 355 LGGIESLVEW-----RAMTDPYI------DQTLIRISIGCEDADDLINDLSAAL 397
            G + SL+        A  DP +       + LIRI  G ED  DL  DL  A 
Sbjct: 360 FGCVNSLISMPCKMSHASIDPELRKDRKFPEDLIRICCGIEDVSDLQWDLLGAF 413

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 108/410 (26%), Positives = 171/410 (41%), Gaps = 54/410 (13%)

Query: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89
           L+T+L+     D   S V PP+  +TTF+    D     + +  D       Y+R G+P 
Sbjct: 6   LNTSLVSVSHNDKYGSSV-PPLYQSTTFKASSFD-----QLQEYD-------YTRSGNPT 52

Query: 90  STRLESIFS---EVLNGHAVIYSSGVSAFFAAM------VHYNPKRLFMGQSYHGCRAIA 140
            T L+   +   +V        SSG++A    +        + P  +     Y G + + 
Sbjct: 53  RTVLQQQIANLYDVAPEQVFAVSSGMTALDIILRTLIDNSDHIPTIIAGDDLYGGTQRLL 112

Query: 141 NIL-TRNYNVEQHP-LEDIEKYAQ------KGDIVHLETPVNPYGTSLDISEFARRAHAK 192
             L TRN+    H    D E + +      + DIV LE+P NP     D+    +    K
Sbjct: 113 TFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPRLCQFVKQK 172

Query: 193 GAL-----LCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQ 247
           G       + VD+T       +  +F AD+V  S TKY  GH D+++GV++ K +DVA  
Sbjct: 173 GGSSSNCKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHHDIMAGVIIAK-KDVAPS 231

Query: 248 LRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKG---KFGNVLD 304
           +       G  ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L D  G      N   
Sbjct: 232 VYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQDICGFKPTDNNQQL 291

Query: 305 KIYHSSLQTEPFVK--KQLKGGYDPVFSITLKNKEQCKKF--PLLLKYFHHATSLGGIES 360
           K     L++ P  +  K    G   V SI   +    +       L  +    S G + S
Sbjct: 292 KTRFVGLESHPQFELHKSFNNGPGAVLSIETGDLALSEAIVTSKRLNIWAVTVSFGCVNS 351

Query: 361 LVEW-----RAMTDPYI------DQTLIRISIGCEDADDLINDLSAALNK 399
           L+        A  DP +       + LIR+  G ED  DL  DL AA  +
Sbjct: 352 LISMPCKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYDLLAAFEE 401

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 111/459 (24%), Positives = 180/459 (39%), Gaps = 104/459 (22%)

Query: 27  PIHLSTTLIHG-----DDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP- 80
           P H  T  +H      DD  NR   V  PI  TT++ +  ND    SE  +  F  K P 
Sbjct: 2   PSHFDTIQLHAGQENPDDNANRPRAV--PIYATTSYVF--ND----SEHGSNLFGLKVPG 53

Query: 81  -IYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHG 135
            +YSR  +P    LE   + +  G  AV  +SG +A       + H     +     Y G
Sbjct: 54  YVYSRFQNPTQNVLEERMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGG 113

Query: 136 CRAIANILTRNYNVEQHPL-----EDIEKYAQ-KGDIVHLETPVNPYGTSLDISEFARRA 189
                 +  +   +E   +     +D EK    K   V+LE+  NP     D  +    A
Sbjct: 114 TYNQFKVAFKRLGIEARFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIA 173

Query: 190 HAKGALLCVDSTFAPPPL--QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDE----- 242
           H  G  + VD+TF       Q + ++ ADIV HSATK+ GGH   ++G++V   +     
Sbjct: 174 HKHGVPVVVDNTFGAGGFFCQPI-KYGADIVTHSATKWIGGHGTTIAGMIVDSGKFPWAD 232

Query: 243 -----------------DVARQLRDDRIY-----------LGTNVANLESYLLLRSLRTF 274
                             +  +   +  Y           LG  ++   ++LL++ + T 
Sbjct: 233 YPEKFPQFSKPAEGYHGTIFNEAYGNLAYIVHVRVELLRDLGPAISPFAAFLLIQGIETL 292

Query: 275 KMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSI 331
            +R ER  +NA K+ ++L  +       +  + +  L + P+    KK L  G+  V S 
Sbjct: 293 SLRGERHGQNALKLAQWLEQSP-----YVSWVSYPGLPSHPYHENAKKYLSNGFGGVLSF 347

Query: 332 TLKN-----KEQCKKFPL---------LLKYFHHATSLGGIESLVEWRAMTDPY------ 371
            +K+     KE+    P           LK   +  ++G  ++LV       PY      
Sbjct: 348 GVKDIPGQTKEELAAKPFSASGAQVVDSLKLASNLANVGDSKTLV-----IAPYFTTHEQ 402

Query: 372 ----------IDQTLIRISIGCEDADDLINDLSAALNKL 400
                     + + LIR+S+G E  DD+I D   +  K+
Sbjct: 403 LDDDEKLLSGVTKDLIRVSVGTEFIDDIIADFQQSFEKV 441

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 115/460 (25%), Positives = 184/460 (40%), Gaps = 106/460 (23%)

Query: 27  PIHLSTTLIHGDDK---DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +   DN+    A PI  TT++ +  ND    S+     F  + P  +
Sbjct: 2   PSHFDTVQLHAGQENPDDNKNRPRAVPIYATTSYVF--ND----SKHGAQLFGLEVPGYV 55

Query: 82  YSRLGHPNSTRLESIFSEVLNGHA-VIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR  +P +   E   + +  G A V  SSG +A     + + H     +     Y G  
Sbjct: 56  YSRFQNPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTY 115

Query: 138 AIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               +  +   VE   ++     D EK + ++   V+LE+  NP     D       AH 
Sbjct: 116 NQFKVAFKRLGVEARFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHK 175

Query: 192 KGALLCVDSTFAP-----PPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLV------VK 240
            G  + VD+TF        PL+    F ADIV HSATK+ GGH   ++GV+V       K
Sbjct: 176 HGIPVVVDNTFGAGGFFCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPWK 231

Query: 241 D--EDVARQLRDDRIYLGT-------NVANL------------------ESYLLLRSLRT 273
           D  E   +  +    Y GT       N+A +                   ++LLL+ + T
Sbjct: 232 DYPEKFPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVET 291

Query: 274 FKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFS 330
             +R ER + NA  + K+L  +       +  + +  L++       KK L  G+  V S
Sbjct: 292 LSLRCERHASNALALAKWLEKSP-----YVSWVSYPGLESHSHHENAKKYLSNGFGGVLS 346

Query: 331 ITLKN-----KEQCKKFPLL---------LKYFHHATSLGGIESLVEWRAMTDPY----- 371
             +K+     +E+ KK P           L+   +  ++G  ++LV       PY     
Sbjct: 347 FGVKDLPNQSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLV-----IAPYFTTHQ 401

Query: 372 -----------IDQTLIRISIGCEDADDLINDLSAALNKL 400
                      + + LIR+S+G E  DD+I D   +  K+
Sbjct: 402 QLDDDEKLLSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKV 441

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 144/353 (40%), Gaps = 29/353 (8%)

Query: 71  ENLDFMDKTPIYSRLGHPNSTRLESIFSEVLNGHAVIYS----SGVSAFFAAMVHYNPKR 126
           E+L+ +     Y   G P    LE  ++E+      + S      +S    ++V +    
Sbjct: 46  ESLESLGGRFWYGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHI 105

Query: 127 LFMGQSYHGCRAIANILTRNYNVEQH---PL--EDIEKYAQKG-DIVHLETPVNPYGTSL 180
           L     Y       N + R + V      PL  +DIE+  +    ++ LE+P +      
Sbjct: 106 LLPISVYGPTANFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQ 165

Query: 181 DISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVK 240
           D+    + A        +D+T+A P      ++  DI + + TKY GGHSDLL G L   
Sbjct: 166 DVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLG-LTSA 224

Query: 241 DEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFG 300
           +      LR     +G      + +L LR LRT ++R++     A  + ++L        
Sbjct: 225 NSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWLEAR----- 279

Query: 301 NVLDKIYHSSLQTEPFVKKQLK--GGYDPVFSITLKN---KEQCKKFPLLLKYFHHATSL 355
           N +++I H + +  P     ++   G   VF+  LK+   +   K     ++ F    S 
Sbjct: 280 NEVERILHPAFEDCPGHSLWVRDYSGSTGVFTFILKDQFSRAGLKDMLEKMQIFKLGYSW 339

Query: 356 GGIESLV-------EWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKLQ 401
           GG ESL+         R  T  +    L RI +G ED DD + DL     +L+
Sbjct: 340 GGYESLLIPVNSTSRDRIRTWSHFGYAL-RIQVGLEDIDDQLRDLEMGFERLK 391

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 96/400 (24%), Positives = 159/400 (39%), Gaps = 36/400 (9%)

Query: 22  QLATRPIHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPI 81
           +L+T  I    T+I G + D +   V PP+   +T  +         +  +++ M     
Sbjct: 6   ELSTFDITTQLTVI-GRNPDEQNGFVNPPLYKGSTIIH--------KKLSDVESMKGRFF 56

Query: 82  YSRLGHPNSTRLESIFSEVLNGHAVIYS-SGVSAFFAAMVHYNPKR---LFMGQSYHGCR 137
           Y   G P    LE  ++ +      + S SG+ +   A++         L     Y   R
Sbjct: 57  YGTAGSPTIANLEDAWTHLTGAAGTVLSPSGLGSITLALMTLAKAGDHILITDSVYVPTR 116

Query: 138 AIANILTRNYNVEQH---PL--EDIEKYAQKG-DIVHLETPVNPYGTSLDISEFARRAHA 191
            + + L   + ++     P   EDIEK  +    ++ LE+P +      DI      A  
Sbjct: 117 VLCDGLLAKFGIQTEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKK 176

Query: 192 KGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDD 251
            G    +D+T+A P   D      DI + + TKY GGHSD L G L   +++    LR  
Sbjct: 177 HGIRTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDFLLG-LTSANQECWPLLRST 235

Query: 252 RIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSL 311
              +       +  L LR +RT  +R++     A  +  +L        + ++ + H + 
Sbjct: 236 YDAMAMLPGADDCQLALRGMRTLHLRLKEAERKALDLAAWLGKR-----DEVETVLHPAF 290

Query: 312 QTEPFVKKQLK--GGYDPVFSITLK---NKEQCKKFPLLLKYFHHATSLGGIESLV---- 362
           +  P  K  L+   G   +FSI LK    +   +     +K FH   S GG ESL+    
Sbjct: 291 EDCPGHKYWLRDYKGSSGLFSIVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPVK 350

Query: 363 --EWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKL 400
             E R   +       +RI +G E+  DL  DL     +L
Sbjct: 351 PAEQRKPHNWPHRGFALRIQVGLEELSDLKRDLELGFERL 390

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 139/343 (40%), Gaps = 27/343 (7%)

Query: 81  IYSRLGHPNSTRLESIFSEVLNGHAVIYS-SGVSAFFAAMVHYNPKR---LFMGQSYHGC 136
            Y   G P    LE  ++ +      + S SG+ +   A++  +      L     Y   
Sbjct: 56  FYGTAGSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHILITDSVYFPT 115

Query: 137 RAIANILTRNYNVEQHPL-----EDIEKYAQKGD-IVHLETPVNPYGTSLDISEFARRAH 190
           R + + L   + +E         EDIEK  +    ++ LE+P +      +I      A 
Sbjct: 116 RMLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQNIPALVSVAK 175

Query: 191 AKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRD 250
             G    +D+T+A P   D      DI + + TKY GGHSDLL G LV  +E+    LR 
Sbjct: 176 KHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLG-LVSANEECWPLLRS 234

Query: 251 DRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSS 310
               +       +  L LR +RT  +R++     A  +  +         + ++K+ H +
Sbjct: 235 TYDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWFKKR-----DEVEKVLHPA 289

Query: 311 LQTEPFVKKQLK--GGYDPVFSITLKN---KEQCKKFPLLLKYFHHATSLGGIESLVE-- 363
            +  P  +  ++   G   +FSI LK+   +   +     +K F    S GG +SL+   
Sbjct: 290 FEDCPGHEYWVRDYKGSSGLFSIVLKDGFTRSGLENMVDNMKVFELGYSWGGYDSLITPV 349

Query: 364 ---WRAMTDPYIDQTL-IRISIGCEDADDLINDLSAALNKLQD 402
               +    P+      +RI +G E+ +DL  DL     +L +
Sbjct: 350 NPPTQRKAAPWSHNGFALRIQVGLEELEDLKRDLELGFERLTE 392

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 112/448 (25%), Positives = 182/448 (40%), Gaps = 86/448 (19%)

Query: 27  PIHLSTTLIHG---DDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H    D  DN     A PI  TT+F ++       S      F  + P  +
Sbjct: 2   PSHFDTVQLHAGQEDPGDNAHRPAAVPIYQTTSFVFED------SHHGAQLFGLEKPGYM 55

Query: 82  YSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR+G+P    LE  + +      AV  SSG +A       + H     +     Y G  
Sbjct: 56  YSRVGNPTVDVLEKRLAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTY 115

Query: 138 AIANILTRNYNVEQHPL-----EDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               +  +   ++   +     ED EK + +K   V++E+  NP     D  +    AH 
Sbjct: 116 NQFKVAFKRLGIDVRFVLGDNPEDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHK 175

Query: 192 KGALLCVDSTFAPPPL--QDVWEFDADIVMHSATKYFGGHSDLLSGVLV------VKD-- 241
            G  + VD+TF       Q + +   DIV HSATK+ GGH   ++GV+V       KD  
Sbjct: 176 HGIPVVVDNTFGAGGFFCQPI-KHGVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDYP 234

Query: 242 ----------EDVARQLRDDRIY---------------LGTNVANLESYLLLRSLRTFKM 276
                     E     + +D +                LG  +  + ++LLL+ + T  +
Sbjct: 235 EKFPQFSKPSEGYHGMIFNDAMGPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVETLSL 294

Query: 277 RIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITL 333
           R ERQ +NA K+ ++L  +       ++ + +  L + P+    KK L  G+  V SI +
Sbjct: 295 RAERQGQNALKLAQWLEKSPH-----VNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIGV 349

Query: 334 KN----------KEQCKKFPLLLKYFHHATSLGGIESLV------EWRAMTD-----PYI 372
           K           K+   +    LK   +  ++G  ++LV        + ++D       +
Sbjct: 350 KPLKDVSDSDPFKKSGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSGV 409

Query: 373 DQTLIRISIGCEDADDLINDLSAALNKL 400
            + LIRISIG E  DD+I D   +  K+
Sbjct: 410 TEDLIRISIGTEFIDDIIADFEQSFEKV 437

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 110/457 (24%), Positives = 178/457 (38%), Gaps = 105/457 (22%)

Query: 27  PIHLSTTLIHG---DDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H    D  DN     A PI  TT++ +D       S+  +  F  + P  +
Sbjct: 2   PSHFDTIQLHAGQEDAGDNAHRPRAVPIYATTSYVFDD------SKHGSQLFGLEVPGYV 55

Query: 82  YSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR  +P S  LE  I +      A+  +SG +A       + H     +     Y G  
Sbjct: 56  YSRFQNPTSNVLEERIAALEGGAAALAVASGQAAQTLAIQGLAHNGDNIVATSYLYGGTY 115

Query: 138 AIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               +  + + +E   +E     D EK + ++   V+LE+  NP     D  +    AH 
Sbjct: 116 NQFKVAFKRFGIEARFVEGDNQDDFEKQFDERTKCVYLESIGNPKYNVPDFEKIVAVAHK 175

Query: 192 KGALLCVDSTFAPPPL--QDVWEFDADIVMHSATKYFGGHSDLLSGVLV----------- 238
            G  + VD+TF       Q + ++  DIV HSATK+ GGH   L GV++           
Sbjct: 176 HGIPVMVDNTFGAGGFFCQPI-KYGVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKDYP 234

Query: 239 ----------------VKDEDVA----------RQLRDDRIYLGTNVANLESYLLLRSLR 272
                           + +E               LRD    LG+ ++   ++LLL+ + 
Sbjct: 235 EKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGSLMSPFAAFLLLQGVE 290

Query: 273 TFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVF 329
           T  +R ER  ENA K+ K+L  +       +  + +  L +       KK L  G+  + 
Sbjct: 291 TLSLRGERHGENALKLAKWLEQSP-----YVSWVSYPGLPSHSHHENAKKYLSNGFGGML 345

Query: 330 SITLKN----KEQCKKFPLL-------LKYFHHATSLGGIESLVEWRAMTDPY------- 371
           S  +K+      +   F L        LK   +  ++G  ++LV       PY       
Sbjct: 346 SFGVKDLPNADTETDPFKLSGAQVVDNLKIASNLANVGDSKTLV-----IAPYFTTHQQL 400

Query: 372 ---------IDQTLIRISIGCEDADDLINDLSAALNK 399
                    + + LIR+S+G E  DD+IND   +  +
Sbjct: 401 NDEEKLASGVTKDLIRVSVGTEFIDDIINDFQQSFER 437

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 105/453 (23%), Positives = 177/453 (39%), Gaps = 95/453 (20%)

Query: 27  PIHLSTTLIHGDDKDNRVSDVAP---PINVTTTFRYDPNDLIPWSERENLDFMDKTPIYS 83
           P H  T  +H   ++       P   PI  TT++ +D +        E         IYS
Sbjct: 2   PSHFDTIQLHAGQENAFEHASGPRAVPIYATTSYVFDDSKY----GAEIFGLEKPGFIYS 57

Query: 84  RLGHPNSTRLE---------SIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYH 134
           R+ +P +  LE         +    V +G A   +  ++    +  +        G +Y+
Sbjct: 58  RIMNPTNDVLERRLAALEGGAAALAVASGQAA-QTLAITGLAHSGDNIVSTSFLYGGTYN 116

Query: 135 GCR-AIANILTRNYNVEQHPLEDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHAK 192
             + A   +      VE    ED EK + +K   V+LET  NP     D  +    AH  
Sbjct: 117 QFKVAFKRLGIEARFVEGDAPEDFEKLFDEKTKAVYLETIGNPKYNVPDFDKIVAVAHKH 176

Query: 193 GALLCVDSTFAPPPL--QDVWEFDADIVMHSATKYFGGHSDLLSGVLV------------ 238
           G  + VD+TF       Q + ++ ADIV HSATK+ GGH   ++G ++            
Sbjct: 177 GIPVVVDNTFGAGGFFCQPI-KYGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKEYPE 235

Query: 239 ---------------VKDEDVA----------RQLRDDRIYLGTNVANLESYLLLRSLRT 273
                          + +E +             LRD    LG  ++   S+LLL+ + T
Sbjct: 236 KFPQFSKPSEGYHGMIFNEAMGNLAFIGHVRTELLRD----LGPCMSPFASFLLLQGVET 291

Query: 274 FKMRIERQSENATKVVKFLNDNK----GKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVF 329
             +R ERQ EN   + K+L  +       +  ++   +H +       KK L+ G+  V 
Sbjct: 292 LSLRAERQGENTLALAKWLEKSAYVSWVSYPGLVSHSHHEN------AKKYLRNGFGGVL 345

Query: 330 SITLKN----KEQCKKFPLL-------LKYFHHATSLGGIESLV------EWRAMTD--- 369
           S  +K+     E+   F          LK   +  ++G  ++LV        + ++D   
Sbjct: 346 SFGVKDLPGAAEEKDPFKAAGAQAVDNLKLASNLANVGDSKTLVIAPYFTTHQQLSDEEK 405

Query: 370 --PYIDQTLIRISIGCEDADDLINDLSAALNKL 400
               + + LIR+S+G E  DD+I D   +  K+
Sbjct: 406 LASGVTKDLIRVSVGTEFIDDIIADFQQSFEKI 438

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 112/451 (24%), Positives = 174/451 (38%), Gaps = 91/451 (20%)

Query: 27  PIHLSTTLIHGDDKDNRVSDVAP---PINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +D   +   P   PI  TT++ +  ND    S+     F  +TP  I
Sbjct: 2   PSHFDTIQLHAGQEDASTNANNPNAVPIYATTSYVF--ND----SKHGAQLFGLETPGYI 55

Query: 82  YSRLGHPNSTRLESIFSEVLNGHAVI-YSSGVSA---FFAAMVHYN----PKRLFMGQSY 133
           YSR+ +P     E   + +  G A +  SSG +A       + H            G +Y
Sbjct: 56  YSRIMNPTVDVFEKRIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGTY 115

Query: 134 HGCRAIANILTRNYN-VEQHPLEDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
           +  +     L  N   VE    +D EK + +K   V+LET  NP     D  +    AH 
Sbjct: 116 NQFKVAFKRLGINVKFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHK 175

Query: 192 KGALLCVDSTF-APPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLV------VKD--E 242
            G  + VD+TF A        ++  DIV HSATK+ GGH   ++G ++       KD  E
Sbjct: 176 HGIPVVVDNTFGAGGYFCQPIKYGCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYPE 235

Query: 243 DVARQLRDDRIY-------------------------LGTNVANLESYLLLRSLRTFKMR 277
              +  +    Y                         LG  +    ++LLL+ + T  +R
Sbjct: 236 RFPQFSKPSEGYHGLVFNDAFGPAAFIGHVRTELLRDLGPCLDAFSAFLLLQGVETLSLR 295

Query: 278 IERQSENATKVVKFL-------------------NDNKGK-----FGNVLD----KIYHS 309
            ER  EN  K+ K+L                   ++N  K     FG VL      + ++
Sbjct: 296 GERHGENTLKLAKWLEKSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNA 355

Query: 310 SLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTD 369
           S + +PF     +   +   ++ L N    K   ++  YF     L   E L        
Sbjct: 356 SDEKDPFKASGAQVVDNLKLALNLANVGDSKTL-VIAPYFTTHQQLNEEEKLASG----- 409

Query: 370 PYIDQTLIRISIGCEDADDLINDLSAALNKL 400
             + + LIR+S+G E  DD+I D   +  K+
Sbjct: 410 --VTKDLIRVSVGTEYIDDIIADFQQSFEKV 438

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 108/452 (23%), Positives = 173/452 (38%), Gaps = 90/452 (19%)

Query: 27  PIHLSTTLIHG--DDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLD-FMDKTP--I 81
           P H  T  +H   D   N  +  A PI  T+++ +        + +   D F   TP  +
Sbjct: 2   PSHYDTLQLHAGQDASANSGNPRAVPIYATSSYVFK-------NSQHGADLFGLNTPGYL 54

Query: 82  YSRLGHPNSTRLESIFSEVLNGHA-VIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR+G+P    LE   + +  G   V  +SG +A      A+       +     Y G  
Sbjct: 55  YSRMGNPTVDVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGTY 114

Query: 138 AIANILTRNYNVEQHPLE--DIEKYAQ----KGDIVHLETPVNPYGTSLDISEFARRAHA 191
               +  +   VE    E  + E Y Q    K   +++E+  NP  T  D  +    AH 
Sbjct: 115 NQLKVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAHK 174

Query: 192 KGALLCVDSTF-APPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRD 250
            G  + VD+TF A        EF ADI+ HSATK+  GH   ++G +V        Q  D
Sbjct: 175 HGIPVVVDNTFGAAGFFCKPIEFGADIITHSATKWINGHGTAIAGAIVDSGNFPWTQYPD 234

Query: 251 -------------DRIY--------------------LGTNVANLESYLLLRSLRTFKMR 277
                          +Y                    LG+ ++   ++L L+ L T  +R
Sbjct: 235 KFPQFSQPAESYHGMVYNDNFGPLAFIAYVRLELLRDLGSTMSPFTAFLSLQGLETLSLR 294

Query: 278 IERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITLK 334
            ER + N+  + + L D+       +  + +  L + P     KK L  G   + S  +K
Sbjct: 295 CERHARNSIDLARHLEDSP-----YVAWVSYPGLDSHPSRNNAKKYLTNGAGGMLSFGIK 349

Query: 335 -----NKEQ----------CKKFPLLLKYFHHATSLGGIESLV------EWRAMTD---- 369
                N E+            KF   LK   +  ++G  ++LV        + +TD    
Sbjct: 350 PFDKTNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKL 409

Query: 370 -PYIDQTLIRISIGCEDADDLINDLSAALNKL 400
               D+ +IR+S+G E  DD+I D   A   +
Sbjct: 410 KAGADKDVIRVSVGTEYIDDIIADFEQAFKTV 441

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 114/458 (24%), Positives = 178/458 (38%), Gaps = 103/458 (22%)

Query: 29  HLSTTLIHGDDKD---NRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--IYS 83
           H  T  +H   +D   N  S  A PI  TT++ +  ND    S+     F  + P  IYS
Sbjct: 4   HFDTLQLHAGQEDAAENANSPRAVPIYATTSYVF--ND----SKHGAQLFGLEAPGFIYS 57

Query: 84  RLGHPNSTRLES-IFSEVLNGHAVIYSSGVSAFFAA---MVHYN----PKRLFMGQSYHG 135
           R+ +P +  LE  I +      A+  +SG +A   A   + H            G SY+ 
Sbjct: 58  RIMNPTNDVLEKRIAALEGGAAALAVASGQAAQLVAIGGLAHAGDNIVSTSYLYGGSYNQ 117

Query: 136 CR-AIANILTRNYNVEQHPLEDIE-KYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKG 193
            + A   +      VE    ED E ++  K   V LE+  NP     D       AH  G
Sbjct: 118 FKVAFKRLGIECRFVEGDNAEDFEARFDSKTKAVFLESIGNPKYNVPDFERIVAVAHRHG 177

Query: 194 ALLCVDSTF-APPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLV-------------- 238
             + VD+TF A        +F ADIV HSATK+ GGH   + G++V              
Sbjct: 178 IPVVVDNTFGAGGYFCQPIKFGADIVTHSATKWIGGHGTAIGGLVVDSGKFPWKDYPAKF 237

Query: 239 -------------VKDEDVA----------RQLRDDRIYLGTNVANLESYLLLRSLRTFK 275
                        V +E +             LRD    LG  ++   ++L L+ L T  
Sbjct: 238 PQFSEPSEGYHGLVLNEALGPLAFVGHARIELLRD----LGPALSPFAAFLFLQGLETLS 293

Query: 276 MRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVK---KQLKGGYDPVFSIT 332
           +R ER  +NA  + K+L  +       +  + +  L++  ++    + L+ GY  V S  
Sbjct: 294 LRAERHGQNALALAKYLETSA-----YVSWVSYPGLESHDYLSNATRYLQNGYGGVLSFG 348

Query: 333 LKN-----------KEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPY---------- 371
           +K            K    +F   LK+  +  ++G  ++LV       PY          
Sbjct: 349 VKPLPDTDEEADPFKAAGAQFVDNLKFASNLANVGDSKTLV-----IAPYFTTHQQLSES 403

Query: 372 ------IDQTLIRISIGCEDADDLINDLSAALNKLQDT 403
                 + + LIR+S+G E   D+I D   A + +  T
Sbjct: 404 EKLASGVTRDLIRVSVGTEYLQDIIADFEQAFSTVYGT 441

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 121/295 (41%), Gaps = 21/295 (7%)

Query: 78  KTPIYSRLGHPNSTRLESIFSEVLNGHAVIYS-SGVSAFFAAMVHYNPKR---LFMGQSY 133
           K   Y   G P    LE+ ++ +  G   + S SG+ +   A++  +      L     Y
Sbjct: 52  KGRFYGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVY 111

Query: 134 HGCRAIANILTRNYNVEQHPLE-----DIEKYAQKGD-IVHLETPVNPYGTSLDISEFAR 187
              R + + L   + VE    +     DIEK  +    ++ LE+P +      DI     
Sbjct: 112 VPTRMLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVS 171

Query: 188 RAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQ 247
            A   G    +D+T+A P   D      DI + + TKY GGHSDLL G L   +E+    
Sbjct: 172 VAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIG-LASANEECWPL 230

Query: 248 LRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIY 307
           LR     +       +  L LR +RT  +R++     A  +  +L +      + ++K+ 
Sbjct: 231 LRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNR-----DEVEKVL 285

Query: 308 HSSLQTEPFVKKQLK--GGYDPVFSITLKN---KEQCKKFPLLLKYFHHATSLGG 357
           H + +  P  +  ++   G   +FSI LKN   +   +K    +K      S GG
Sbjct: 286 HPAFEDCPGHEYWVRDYKGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 107/456 (23%), Positives = 174/456 (38%), Gaps = 103/456 (22%)

Query: 27  PIHLSTTLIHG---DDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLD-FMDKTP-- 80
           P H  T  +H    D  DN     A PI  TT++ ++         +   D F  K P  
Sbjct: 2   PSHFDTVQLHAGQEDPNDNNHRPRAVPIYATTSYVFE-------DSKHGADLFGLKVPGY 54

Query: 81  IYSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGC 136
           +Y R  +P    LE  + +      A+  +SG +A       + H     +     Y G 
Sbjct: 55  VYGRFQNPTQAVLEDRLAALEGGAAALATASGQAAQTLAIQGLAHCGDNIVSTSFLYGGT 114

Query: 137 RAIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAH 190
                +  + + +E   +E     D EK + ++   V+LE+  NP     D  +    AH
Sbjct: 115 YNQFKVAFKRFGIEARFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAH 174

Query: 191 AKGALLCVDSTFAP-----PPLQDVWEFDADIVMHSATKYFGGHSDLLSGVLV------- 238
             G  + VD+TF        PL+    + ADIV HSATK+ GGH   L G++V       
Sbjct: 175 KHGIPVMVDNTFGAGGFFCQPLK----YGADIVTHSATKWIGGHGTTLGGIIVDSGKFPW 230

Query: 239 --------------------VKDEDVA----------RQLRDDRIYLGTNVANLESYLLL 268
                               + +E               LRD    LG+ ++   ++LL+
Sbjct: 231 KDYPEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGSMISPFAAFLLI 286

Query: 269 RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGY 325
           + + T  +R ER  +NA K+ K+L  +       +  + +  L +       KK L  G+
Sbjct: 287 QGVETLSLRGERHGQNALKLAKWLEASP-----YVSWVSYPGLPSHSHHENAKKYLSNGF 341

Query: 326 DPVFSITLKN----KEQCKKFPLL-------LKYFHHATSLGGIESLVEWRAMTD----- 369
             + S  +K+      +   F L        LK   +  ++G  ++LV     T      
Sbjct: 342 GGMLSFGVKDLPNAATETDPFKLSGAQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLA 401

Query: 370 ------PYIDQTLIRISIGCEDADDLINDLSAALNK 399
                   + + LIR+S+G E  DD+I D   A  K
Sbjct: 402 DEEKLASGVTKDLIRVSVGTEYIDDIIEDFKQAFEK 437

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 109/454 (24%), Positives = 179/454 (39%), Gaps = 98/454 (21%)

Query: 27  PIHLSTTLIHGDDK--DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--IY 82
           P H  T  +H   +  +N  +  A PI  TT++ +  ND    S+     F  +TP  IY
Sbjct: 2   PSHFDTLQLHAGQEASENSHNPRAVPIYATTSYVF--ND----SKHGAQLFGLETPGYIY 55

Query: 83  SRLGHPNSTRLES---------IFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSY 133
           SR+ +P +  LE              V +G A   +  ++    A  +        G +Y
Sbjct: 56  SRIMNPTNDVLEQRLAALEGGAAALAVASGQAA-QTVAITGLAHAGDNIVSTSFLYGGTY 114

Query: 134 HGCR-AIANILTRNYNVEQHPLEDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
           +  + A   +      V+    ED EK + +K   ++LE+  NP     D  +    AH 
Sbjct: 115 NQFKVAFKRLGIEARFVDGDKPEDFEKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHK 174

Query: 192 KGALLCVDSTFAPPPL--QDVWEFDADIVMHSATKYFGGHSDLLSGVLV------VKD-- 241
            G  + VD+TF       Q + ++ ADIV HSATK+ GGH   ++G ++       KD  
Sbjct: 175 HGIPVVVDNTFGAGGFFCQPI-KWGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYP 233

Query: 242 EDVARQLRDDRIY-------------------------LGTNVANLESYLLLRSLRTFKM 276
           E   +  +    Y                         LG  ++   S+LLL+ L T  +
Sbjct: 234 EKFPQFSKPSEGYHGLVFNDAFGPLAFIGHARTELLRDLGPALSPFSSFLLLQGLETLSL 293

Query: 277 RIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITL 333
           R ER + NA K+ ++L  +       +  + +  L++       KK L+ G+  V S  +
Sbjct: 294 RGERHAYNALKLAQWLEKSP-----YVSWVSYPGLESHTHHENAKKYLQNGFGGVLSFGV 348

Query: 334 K----NKEQCKKFPLL-------LKYFHHATSLGGIESLVEWRAMTDPY----------- 371
           K      E+   F          LK   +  ++G  ++LV       PY           
Sbjct: 349 KPLPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLV-----IAPYFTTHQQLSHEE 403

Query: 372 -----IDQTLIRISIGCEDADDLINDLSAALNKL 400
                +   LIR+S+G E  DD+I D   +  K+
Sbjct: 404 KLASGVTDDLIRVSVGTEFIDDIIADFEQSFEKI 437

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 105/242 (43%), Gaps = 23/242 (9%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     D+ E  R A   G  + VD T       DV    AD+V  S TK F
Sbjct: 419 VFMETPSNPLLKMGDLLELKRLADIYGFYVVVDETAGGFVNIDVLP-HADLVCSSLTKIF 477

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL---ESYLLLRSLRTFKMRIERQSE 283
            G S++++G LV+       +   +    G     L   ++  L R+ R F  R  + + 
Sbjct: 478 SGDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCLWCEDAIYLERNSRDFVTRTLKVNS 537

Query: 284 NATKVVKFLNDNK-GKFGNVLDKIYHSSLQTEP------FVKKQLKGGYDPVFSITLKNK 336
           NA  +   LND    + G++  KIY+  L +E        V+ +  GGY  +FS+T    
Sbjct: 538 NAEML---LNDVLIPEEGHLFSKIYYPRLTSEETKQNYDTVRCKPNGGYGGLFSLTFYEI 594

Query: 337 EQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           EQ KKF         P L   F  A     +    E   +    ++  L+R+S+G EDA+
Sbjct: 595 EQAKKFFNALELCKGPSLGTNFTLACPYAVLAHYAELEKVAQYGVEANLVRVSVGLEDAE 654

Query: 388 DL 389
            L
Sbjct: 655 HL 656

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 108/252 (42%), Gaps = 22/252 (8%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +E P NP     D+ E  R +      + VD T       DV  + ADIV  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 227 GGHSDLLSGVLVV----KDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQS 282
            G S++++G LV+    K  + AR+           +   ++  L R+ R F  R  + +
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 283 ENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF------VKKQLKGGYDPVFSITLKNK 336
            N   ++K +     + G +  KIY+ SL +E        V     GGY  +FS+T  N 
Sbjct: 506 TNTDILLKRV--LLPQVGKLFKKIYYPSLTSEDTKRNYDSVMSTKDGGYGGLFSLTFFNI 563

Query: 337 EQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387
           E+ KKF         P L   F  A     I    E   +    ++  L+R+S+G E++D
Sbjct: 564 EEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEVAQYGVETNLVRVSVGLENSD 623

Query: 388 DLINDLSAALNK 399
            L N    A+ K
Sbjct: 624 VLCNVFQRAIEK 635

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 120/260 (46%), Gaps = 37/260 (14%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V LETP NP     D+ +    A+  G  + VD T     + DV  + ADIV  S TK F
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGGLNV-DVLPY-ADIVCTSLTKLF 377

Query: 227 GGHSDLLSGVLVV--KDEDVARQLRDDRIYLGTNVANLESYLLLRS-LRTFKMRIERQSE 283
            G S+++ G +++  K    +  L+  R      +  LE  ++L +  R F+ R  R +E
Sbjct: 378 SGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTRTNE 437

Query: 284 NATKVVK-FLNDNKGKFGNVLDKIYHSSLQTEPFVK-----KQLKGGYDPVFSITLKNKE 337
           N  K+++  L   +GK   +  K+Y+ ++ ++   K     +   GGY  +FS++  N+E
Sbjct: 438 NTMKLIQEVLLPEEGK---IFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEE 494

Query: 338 QCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIRISI 381
             KKF      ++  T   G  +   +  +  PY+                  +L+R+S+
Sbjct: 495 DAKKF------YNSLTVFKGPSNGTNF-TLACPYVHLAHHFELEEVSTFGAHSSLVRVSV 547

Query: 382 GCEDADDLINDLSAALNKLQ 401
           G E+   L+N  S+ +N L+
Sbjct: 548 GLENTQWLLNAFSSVINLLR 567

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 113/259 (43%), Gaps = 32/259 (12%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     D+ E  + A A    + +D T       DV ++ ADIV  S TK F
Sbjct: 427 VFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVLQY-ADIVCSSLTKIF 485

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S++++G LV+       +L   R +   +  +L    +S  L R+ R    R  + +
Sbjct: 486 SGDSNVMAGSLVLNPSSRLYKLA-RRFFASDDYEDLLWCEDSIYLERNSRDCVSRSMKIN 544

Query: 283 ENATKVVKFLNDNKGKF----GNVLDKIYHSSLQTEP------FVKKQLKGGYDPVFSIT 332
           ENA +++      KG      G +  KIY+ SL +         VK Q  GGY  +FS+T
Sbjct: 545 ENAERLL------KGTLLPLEGTLFKKIYYPSLTSSETKANYDAVKCQPNGGYGGLFSLT 598

Query: 333 LKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGC 383
             + E  K F         P L   F  A     +    E   +    +++ L+R+SIG 
Sbjct: 599 FFDDECAKAFFNSLDLCKGPSLGTNFTLACPYTILAHYGEMDVVAKYGLEKNLVRVSIGL 658

Query: 384 EDADDLINDLS-AALNKLQ 401
           ED   L    S AA N LQ
Sbjct: 659 EDFGYLETVFSKAAQNALQ 677

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 109/259 (42%), Gaps = 30/259 (11%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +E P NP     D+ E  R +      + VD T       DV  + ADIV  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 227 GGHSDLLSGVLVV----KDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQS 282
            G S++++G LV+    K  + AR+           +   ++  L R+ R F  R  + +
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMSTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 283 ENA----TKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF------VKKQLKGGYDPVFSIT 332
            N     TKV+        + G +  KIY+ SL +E        V     GGY  +FS+T
Sbjct: 506 TNTDVLLTKVL------LPQVGKLFKKIYYPSLTSEETKKNYDNVMSTKDGGYGGLFSLT 559

Query: 333 LKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGC 383
             N E+ KKF         P L   F  A     I    E   +    +++ L+R+S+G 
Sbjct: 560 FFNIERAKKFFNSLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGL 619

Query: 384 EDADDLINDLSAALNKLQD 402
           E++D L      A+ K  +
Sbjct: 620 ENSDVLCKVFQQAIGKASE 638

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 120/272 (44%), Gaps = 36/272 (13%)

Query: 154 LEDIEKYAQKGDIV---HLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDV 210
           +E+++K    G+ +    +E P NP     D+ E    A++ G  + VD T       DV
Sbjct: 374 MEELKKILHSGEQILALFMEAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNIDV 433

Query: 211 WEFDADIVMHSATKYFGGHSDLLSGVLVVKD--------EDVARQLRDDRIYLGTNVANL 262
             F ADIV  S TK F G S++++G +V+          E    Q  +D ++        
Sbjct: 434 LPF-ADIVCSSLTKIFSGDSNVIAGSIVLNPQSKLYSFAETFMEQQYEDCLWCE------ 486

Query: 263 ESYLLLRSLRTFKMRIERQSENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEPFVK--- 318
           ++  L R+ R F  R  + ++N  +++ K L   +GK   +  KIY+ SL ++   K   
Sbjct: 487 DALYLERNSRDFVARTLKVNQNTERLLNKVLLPQEGK---LFKKIYYPSLTSKETKKNYD 543

Query: 319 --KQLKGGYDPVFSITLKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAM 367
             +  +GGY  +FS+T  N +  K F         P L   F  A     I    E   +
Sbjct: 544 AVRGHQGGYGGLFSLTFYNLDSAKTFFNTLQLCKGPSLGTNFTLACPYAIIAHYQELDRV 603

Query: 368 TDPYIDQTLIRISIGCEDADDLINDLSAALNK 399
               ++  L+R+S+G E  D+L      A+++
Sbjct: 604 AKYGVESNLVRVSVGLEREDELCKVFQTAIDE 635

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 112/459 (24%), Positives = 175/459 (38%), Gaps = 106/459 (23%)

Query: 27  PIHLSTTLIHGDDKD-----NRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP- 80
           P H  T  +H   +D     NR   V  PI  TT++ +D       S+  +  F  +TP 
Sbjct: 2   PSHFDTIQLHAGQEDPSEHSNRPRAV--PIYSTTSYVFDD------SKHGSQLFGLETPG 53

Query: 81  -IYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHG 135
            IYSR+ +P +   E   + +  G  A+  SSG++A       + H     +     Y G
Sbjct: 54  YIYSRIMNPTADVFERRIAALEGGVGALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGG 113

Query: 136 CRAIANILTRNYNVEQHPLEDIEKYAQKGDI------VHLETPVNPYGTSLDISEFARRA 189
                 I  + + +E   +E  +    +  I      V+LET  NP     D  +    A
Sbjct: 114 TYNQFKIAFKRFGIESRFIEGDDPSGLEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIA 173

Query: 190 HAKGALLCVDSTFAPPP--LQDVWEFDADIVMHSATKYFGGHSDLLSGVLV--------- 238
           H  G  + VD+TF       Q + +  AD+V+HSATK+ GGH   + GV+V         
Sbjct: 174 HKHGVPVVVDNTFGAGGYYCQPI-KHGADVVVHSATKWIGGHGTTIGGVIVDSGNFPWKE 232

Query: 239 ------------------VKDEDVARQ----------LRDDRIYLGTNVANLESYLLLRS 270
                             V +E +  Q          LRD    LG +++   ++LLL+ 
Sbjct: 233 YPKKFPQFSEPSEGYHGLVFNEALGNQAFIGHVRAELLRD----LGPSLSPFAAFLLLQG 288

Query: 271 LRTFKMRIERQSENATKVVKFLNDN------------------------KGKFGNVL--- 303
           L T  +R ER + NA K+ ++L  +                           FG VL   
Sbjct: 289 LETLSLRAERHASNALKLAQWLEKSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVLSFG 348

Query: 304 --DKIYHSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESL 361
             D   +   +  PF     +   +   +  L N   CK   ++  YF     L   E L
Sbjct: 349 AKDLPDNPEEKENPFKAAGAQISDNLELASNLANVGDCKTL-VIAPYFTTHLQLNHEEKL 407

Query: 362 VEWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKL 400
                     + + LIR+S+G E  DD+I D   +  K+
Sbjct: 408 AAG-------VSKDLIRVSVGTEFIDDIIADFEQSFKKV 439

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 116/462 (25%), Positives = 181/462 (39%), Gaps = 105/462 (22%)

Query: 27  PIHLSTTLIHGDDK---DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +   DN     A PI  TT+F +  ND    S+     F  + P  I
Sbjct: 2   PSHFDTLQLHAGQENPDDNNHRPRAVPIYSTTSFVF--ND----SQHGAQLFGLEVPGYI 55

Query: 82  YSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYN----PKRLFMGQSY 133
           YSR  +P +  LE  I +      A+  SSG +A     A + H            G +Y
Sbjct: 56  YSRFQNPTNNVLEERIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGTY 115

Query: 134 HGCR-AIANILTRNYNVEQHPLEDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
           +  + A   +      VE    ED EK + ++   V+LE+  NP     D       AH 
Sbjct: 116 NQFKVAFKRLGIEARFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHK 175

Query: 192 KGALLCVDSTFAPPPL--QDVWEFDADIVMHSATKYF----------------------- 226
            G  + VD+TF       Q + ++ ADIV HSATK+                        
Sbjct: 176 HGIPVVVDNTFGAGGFFCQPI-KYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYP 234

Query: 227 -----------GGHSDL-------LSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLL 268
                      G H  +       L+ ++ V+ E     LRD    LG  ++   ++LLL
Sbjct: 235 EKFPQFSKPAEGYHGTVYNETYGNLAYIVHVRTE----LLRD----LGPGMSPFAAFLLL 286

Query: 269 RSLRTFKMRIERQSENATKVVKFLNDNKG----KFGNVLDKIYHSSLQTEPFVKKQLKGG 324
           + + T  +R ER  +NA  + K+L  N       +  +    +H +       KK L  G
Sbjct: 287 QGVETLSLRGERHGQNALALAKWLEKNPHVAWVSYPGLPSHSHHEN------AKKYLSNG 340

Query: 325 YDPVFSITLKNKEQCKK----FPLL-------LKYFHHATSLGGIESLV------EWRAM 367
           +  V S  +K+     K    F L        LK   +  ++G  ++LV        + +
Sbjct: 341 FGGVLSFGVKDLPNADKETDPFKLAGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQL 400

Query: 368 TDPY-----IDQTLIRISIGCEDADDLINDLSAALNKLQDTN 404
           +DP      + + LIR+S+G E  DD+I D   +  K+  +N
Sbjct: 401 SDPEKLASGVTKDLIRVSVGTEFIDDIIADFEQSFAKVYGSN 442

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 108/256 (42%), Gaps = 30/256 (11%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +E P NP     D+ E  R +      + VD T       DV  + ADIV  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 227 GGHSDLLSGVLVV----KDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQS 282
            G S++++G LV+    K  + AR+           +   ++  L R+ R F  R  + +
Sbjct: 446 SGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 283 ENA----TKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF------VKKQLKGGYDPVFSIT 332
            N     TKV+        + G +  KIY+ SL +E        V     GGY  +FS+T
Sbjct: 506 TNTNILLTKVL------LPQVGKLFKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSLT 559

Query: 333 LKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGC 383
             + E+ KKF         P L   F  A     I    E   +    +++ L+R+S+G 
Sbjct: 560 FFSIEEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGL 619

Query: 384 EDADDLINDLSAALNK 399
           E++D L      A+ K
Sbjct: 620 ENSDVLCKVFQRAIEK 635

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 120/269 (44%), Gaps = 31/269 (11%)

Query: 154 LEDIEKYAQKGD---IVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDV 210
           +ED++K  Q G+    V +E P NP     D+ E  + A+  G  + VD T       DV
Sbjct: 381 MEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDETAGGFVNIDV 440

Query: 211 WEFDADIVMHSATKYFGGHSDLLSGVLVVKDE----DVARQ-LRDDRIYLGTNVANLESY 265
               AD+V  S TK F G S+L++G LV+  +    D A+Q L   + Y  T     ++ 
Sbjct: 441 LP-HADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCE-DAL 498

Query: 266 LLLRSLRTFKMRIERQSENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEP-------FV 317
            L R+ R F  R  + + N   ++ K L   +GK   +  KIY+ SL T P        V
Sbjct: 499 ALERNSRDFVQRTIQVNHNTEYLLNKVLIPLEGK---LFKKIYYPSL-TSPETKRHYDAV 554

Query: 318 KKQLKGGYDPVFSITLKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMT 368
           K  +  GY  +FS+T  N  Q + F         P L   F  A     +    E   + 
Sbjct: 555 KCSIDAGYGGLFSLTFFNLAQARVFFDSLQLCKGPSLGTNFTLACPYAILAHYQELDEVA 614

Query: 369 DPYIDQTLIRISIGCEDADDLINDLSAAL 397
              ++++L+R+S+G E+ + L      A+
Sbjct: 615 RYGVEKSLVRVSVGLENRESLCQVFQHAI 643

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 132/325 (40%), Gaps = 60/325 (18%)

Query: 117 AAMVHYNP---KRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEKYAQKGDIVH----- 168
            A+V Y P   K +  G  Y    +I  +    + +      D +  AQ  DI+H     
Sbjct: 332 GALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFLGSG---DHKAMAQLEDILHSGEPI 388

Query: 169 ----LETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATK 224
               +ETP NP     D+    R A   G  L VD T       DV    AD+V  S TK
Sbjct: 389 LAVFIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGFVNIDVLP-HADLVCSSLTK 447

Query: 225 YFGGHSDLLSGVLVVKDE----DVARQL-----------RDDRIYLGTNVANLESYLLLR 269
            F G S++++G LVV       D A+              +D IYL  N  +  S    R
Sbjct: 448 IFSGDSNVMAGSLVVNPASRLYDFAQGFFHNGSYEDLLWCEDAIYLERNSRDCAS----R 503

Query: 270 SLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEP------FVKKQLKG 323
           SL     R+ + +E   + V   +      G++  KI++ +L +E        V+ +  G
Sbjct: 504 SL-----RVNKNTELLLEKVLLPHQ-----GSLFKKIFYPTLTSEETKRNYDAVRCKPDG 553

Query: 324 GYDPVFSITLKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQ 374
           GY  +FS+T   + + K F         P L   F  A     +    E   + +  +++
Sbjct: 554 GYGGLFSLTFHEENRAKVFFDTLELCKGPSLGTNFTLACPYTVLAHYAEMDVVAEYGLER 613

Query: 375 TLIRISIGCEDADDLINDLSAALNK 399
           +L+R+S+G ED D L      A++K
Sbjct: 614 SLVRVSVGLEDFDHLRKVFQRAIDK 638

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 108/256 (42%), Gaps = 30/256 (11%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +E P NP     D+ E  R +      + VD T       DV  + ADI+  S TK F
Sbjct: 388 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIICSSLTKIF 446

Query: 227 GGHSDLLSGVLVV----KDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQS 282
            G S++++G LV+    K  + A++           +   ++  L R+ R F  R  + +
Sbjct: 447 SGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDCLWCEDALCLERNSRDFVERTIKVN 506

Query: 283 ENA----TKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF------VKKQLKGGYDPVFSIT 332
            N     TKV+        + G +  KIY+ SL +E        V     GGY  +FS+T
Sbjct: 507 TNTDILLTKVL------LPQVGKLFKKIYYPSLTSEETKRNYDSVMATRDGGYGGLFSLT 560

Query: 333 LKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGC 383
             + E+ KKF         P L   F  A     I    E   +    +++ L+R+S+G 
Sbjct: 561 FFDIEKAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGL 620

Query: 384 EDADDLINDLSAALNK 399
           E++D L      A+ K
Sbjct: 621 ENSDVLCRVFQRAIEK 636

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 114/448 (25%), Positives = 178/448 (39%), Gaps = 85/448 (18%)

Query: 27  PIHLSTTLIHGDDK---DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +   DN     A PI  TT++ ++       S+  +  F  + P  +
Sbjct: 2   PSHFDTVQLHAGQENAGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYV 55

Query: 82  YSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR  +P S  LE  I +      A+  SSG +A       + H     +     Y G  
Sbjct: 56  YSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTY 115

Query: 138 AIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               I  + + +E   +E     D EK + ++   V+LET  NP     D  +    AH 
Sbjct: 116 NQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHK 175

Query: 192 KGALLCVDSTF-APPPLQDVWEFDADIVMHSATKYFGGHSDLL------SGVLVVKD--E 242
            G  + VD+TF A        ++ ADIV HSATK+ GGH   +      SG    KD  E
Sbjct: 176 HGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPE 235

Query: 243 DVARQLRDDRIYLGT-------NVANL------------------ESYLLLRSLRTFKMR 277
              +  +    Y GT       N+A +                   S+LLL+ + T  +R
Sbjct: 236 KFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLR 295

Query: 278 IERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITLK 334
            ER  ENA K+ K+L ++       +  + +  L +       KK L  G+  V S  +K
Sbjct: 296 AERHGENALKLAKWLEESP-----YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVK 350

Query: 335 NKEQCKK----FPLL-------LKYFHHATSLGGIESLV------EWRAMTDPY-----I 372
           +     K    F L        LK   +  ++G  ++LV        + + D       +
Sbjct: 351 DLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGV 410

Query: 373 DQTLIRISIGCEDADDLINDLSAALNKL 400
            + LIR+S+G E  DD+I D   +   +
Sbjct: 411 TKDLIRVSVGIEFIDDIIADFQQSFETV 438

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 120/269 (44%), Gaps = 29/269 (10%)

Query: 156 DIEKYAQKGD----IVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVW 211
           +++KY    D       +ETP NP     D++   + A+  G  + +D T     + D+ 
Sbjct: 287 ELKKYLDTSDHRILAAFVETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGGLNV-DIL 345

Query: 212 EFDADIVMHSATKYFGGHSDLLSGVLVVKDEDV----ARQLRDDRIYLGTNVANLESYLL 267
            + ADIV  S TK F G S+++ G L++  +      AR   +   +           L 
Sbjct: 346 PY-ADIVCTSLTKLFNGSSNVMGGSLILNPKSSLYSSARAFVESDGFEDLLWCEDAKVLE 404

Query: 268 LRSLRTFKMRIERQSENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEPFVK-----KQL 321
           + S R F+ R  R ++N  +++ + +  N+GK   V  KIY+ ++ +E   K     +  
Sbjct: 405 INS-RDFEDRTVRANKNTERLLSELILVNEGK---VFKKIYYPTVSSEETFKNYEAVRNK 460

Query: 322 KGGYDPVFSITLKNKEQCKKFPLLLKYFHH---------ATSLGGIESLVEWRAMTDPYI 372
            GGY  +FS+   ++E  K F   LK F           A     +    E   ++    
Sbjct: 461 LGGYGCMFSMAFYSEEDSKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGA 520

Query: 373 DQTLIRISIGCEDADDLINDLSAALNKLQ 401
           D  LIR+S+G ED+  L++  S A+N L+
Sbjct: 521 DPNLIRVSVGLEDSQWLLDVFSDAINMLE 549

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 122/284 (42%), Gaps = 44/284 (15%)

Query: 154 LEDIEKYAQKGD---IVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDV 210
           ++++E+    G+    V +E P NP     D+      A+  G  + +D T       DV
Sbjct: 440 MKELEQTLHSGEQILAVFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNIDV 499

Query: 211 WEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESY----- 265
             F ADIV  S ++ FGG S++++G +V+  ++   Q    +++L   +   E+Y     
Sbjct: 500 LPF-ADIVCSSLSQSFGGDSNVMAGSMVLNPQEKLYQFA--QLFL-NQLGEYENYVWCED 555

Query: 266 --LLLRSLRTFKMR---IERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTE------ 314
             +L R+ R F  R   I   SE     V   N+   K   +  KIY+ SL ++      
Sbjct: 556 AIILERNSRDFIPRSITINHNSEYLINEVLLPNEGPDK---IFKKIYYPSLTSDETKENY 612

Query: 315 --------PFVKKQLKGGYDPVFSITLKNKEQCKKF--------PLLLKYFHHATSLGGI 358
                   P  +K+ +GGY  + S+T  N +  K+F           L   H       I
Sbjct: 613 DKLRCKKIPNFEKE-EGGYGGIISLTFHNLDTSKRFFDEINITKGPSLSTNHTLACPYTI 671

Query: 359 ESLVEWRAMTDPY-IDQTLIRISIGCEDADDLINDLSAALNKLQ 401
            S  +  A  + + +++ LIRI IGCE  +DL      A+ K Q
Sbjct: 672 LSYFDNLAQVEKFGVEENLIRIKIGCESKEDLAKVFLHAIEKAQ 715

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 114/458 (24%), Positives = 174/458 (37%), Gaps = 103/458 (22%)

Query: 27  PIHLSTTLIHG-----DDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP- 80
           P H  T  +H      DD  NR   V  PI  TT++ +  ND    S+  +  F  +TP 
Sbjct: 2   PSHFDTVQLHAGQENPDDNANRPRAV--PIYATTSYVF--ND----SKHGSQLFGLETPG 53

Query: 81  -IYSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYN----PKRLFMGQ 131
            IYSR+ +P    LE  I +      A+  +SG ++     + + H            G 
Sbjct: 54  YIYSRIMNPTVDVLEKRIAALEGGAAALAVASGQASQALAISGLAHTGDNIVATSFLYGG 113

Query: 132 SYHGCR-AIANILTRNYNVEQHPLEDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRA 189
           +Y+  + A   +      VE    ED EK + ++   V+LET  NP     D       A
Sbjct: 114 TYNQFKVAFKRLGIETRFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVA 173

Query: 190 HAKGALLCVDSTF-APPPLQDVWEFDADIVMHSATKYF---------------------- 226
           H  G  + VD+TF A        ++ ADIV HSATK+                       
Sbjct: 174 HKHGIPVVVDNTFGAGGFFAQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDY 233

Query: 227 ------------GGHSDLLS---GVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRSL 271
                       G H  + +   G L          LRD    LG  +    ++ LL+ +
Sbjct: 234 PEKFPQFSIPSEGYHGMIFNDAFGPLAFIGHVRTELLRD----LGPALNPFAAFQLLQGV 289

Query: 272 RTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPV 328
            T  +R ER  ENA K+  +L  +       +  + +  L +       KK L  G+  V
Sbjct: 290 ETLSLRAERHGENALKLAAWLEQSP-----YVSWVSYPGLPSHSHHENAKKYLTNGFGGV 344

Query: 329 FSITLK----NKEQCKKFPLL---------LKYFHHATSLGGIESLV------------- 362
            S   K    N E   K P           LK   +  ++G  ++LV             
Sbjct: 345 LSFGAKDLPNNAEAEAKNPFAAAGAKVVDNLKLASNLANVGDCKTLVIAPYFTTHLQLTH 404

Query: 363 EWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNKL 400
           E +A +   + + LIR+S+G E  DD+IND   +  ++
Sbjct: 405 EEKASSG--VTKDLIRVSVGTEFIDDIINDFQQSFEQV 440

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 114/448 (25%), Positives = 177/448 (39%), Gaps = 85/448 (18%)

Query: 27  PIHLSTTLIHGDDK---DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +   DN     A PI  TT++ ++       S+  +  F  + P  +
Sbjct: 2   PSHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYV 55

Query: 82  YSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR  +P S  LE  I +      A+  SSG +A       + H     +     Y G  
Sbjct: 56  YSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTY 115

Query: 138 AIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               I  + + +E   +E     D EK + ++   V+LET  NP     D  +    AH 
Sbjct: 116 NQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHK 175

Query: 192 KGALLCVDSTF-APPPLQDVWEFDADIVMHSATKYFGGHSDLL------SGVLVVKD--E 242
            G  + VD+TF A        ++ ADIV HSATK+ GGH   +      SG    KD  E
Sbjct: 176 HGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPE 235

Query: 243 DVARQLRDDRIYLGT-------NVANL------------------ESYLLLRSLRTFKMR 277
              +  +    Y GT       N+A +                   S+LLL+ + T  +R
Sbjct: 236 KFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLR 295

Query: 278 IERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITLK 334
            ER  ENA K+ K+L  +       +  + +  L +       KK L  G+  V S  +K
Sbjct: 296 AERHGENALKLAKWLEQSP-----YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVK 350

Query: 335 NKEQCKK----FPLL-------LKYFHHATSLGGIESLV------EWRAMTDPY-----I 372
           +     K    F L        LK   +  ++G  ++LV        + + D       +
Sbjct: 351 DLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGV 410

Query: 373 DQTLIRISIGCEDADDLINDLSAALNKL 400
            + LIR+S+G E  DD+I D   +   +
Sbjct: 411 TKDLIRVSVGIEFIDDIIADFQQSFETV 438

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 115/453 (25%), Positives = 176/453 (38%), Gaps = 95/453 (20%)

Query: 27  PIHLSTTLIHGDDK---DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +   DN     A PI  TT++ ++       S+  +  F  + P  +
Sbjct: 2   PSHFDTVQLHAGQENPSDNAHRTRAVPIYATTSYCFEN------SKHGSQLFGLEVPGYV 55

Query: 82  YSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR  +P S  LE  I +      A+  SSG +A       + H     +     Y G  
Sbjct: 56  YSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTY 115

Query: 138 AIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               I  + + +E   +E     D EK + ++   V+LET  NP     D  +    AH 
Sbjct: 116 NQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHK 175

Query: 192 KGALLCVDSTF-APPPLQDVWEFDADIVMHSATKYFGGHSDLL------SGVLVVKD--E 242
            G  + VD+TF A        ++ ADIV HSATK+ GGH   +      SG    KD  E
Sbjct: 176 HGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPE 235

Query: 243 DVARQLRDDRIYLGT-------NVANL------------------ESYLLLRSLRTFKMR 277
              +  +    Y GT       N+A +                   S+LLL+ + T  +R
Sbjct: 236 KFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLR 295

Query: 278 IERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITLK 334
            ER  ENA K+ K+L  +       +  + +  L +       KK L  G+  V S  +K
Sbjct: 296 AERHGENALKLAKWLEQSP-----YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVK 350

Query: 335 NKEQCKK----FPL-------LLKYFHHATSLGGIESLVEWRAMTDPY------------ 371
           +     K    F L        LK   +  ++G  ++LV       PY            
Sbjct: 351 DLPNADKETDPFKLSGAQVVDSLKLASNLANVGDAKTLV-----IAPYFTTHKQLNDTEK 405

Query: 372 ----IDQTLIRISIGCEDADDLINDLSAALNKL 400
               + + LIR+S+G E  DD+I D   +   +
Sbjct: 406 LASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 106/445 (23%), Positives = 173/445 (38%), Gaps = 79/445 (17%)

Query: 27  PIHLSTTLIHGDDKD---NRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +D   N  +  A PI  T+++ +  ND    S+     F  + P  +
Sbjct: 2   PSHFDTLQLHAGQEDATENAHNPRAVPIYATSSYVF--ND----SQHGAQLFGLEKPGYM 55

Query: 82  YSRLGHPNSTRLESIFSEVLNGHAVI-YSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR+ +P     E   + +  G A +  +SG +A     + + H     +     Y G  
Sbjct: 56  YSRIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGTY 115

Query: 138 AIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               +  R   +E   +E     D EK +  K   V+LET  NP     D  +    AH 
Sbjct: 116 NQFKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAHK 175

Query: 192 KGALLCVDSTF-APPPLQDVWEFDADIVMHSATKY------------------------- 225
            G  + VD+TF A        ++ ADIV HSATK+                         
Sbjct: 176 HGIPVVVDNTFGAGGYFAQPIKYGADIVTHSATKWIGGHGTTIGGVIVDSGKFPWKEYPE 235

Query: 226 ----FGGHSDLLSGVLVVKDEDVARQLRDDRIY----LGTNVANLESYLLLRSLRTFKMR 277
               F   S+   G+++         +   RI     LG  +    ++ LL+ + T  +R
Sbjct: 236 KFPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFAAFQLLQGVETLSLR 295

Query: 278 IERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVFSITLKN-- 335
            ER + NA K+ ++L   K  + + +     SS       KK L+ G+  V S  +K+  
Sbjct: 296 CERHATNALKLAQYL--EKSPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVLSFGVKDLP 353

Query: 336 ---------KEQCKKFPLLLKYFHHATSLGGIESLV------EWRAMTDPY-----IDQT 375
                    K    +    LK   +  ++G  ++LV        + +TD       + + 
Sbjct: 354 NAHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKD 413

Query: 376 LIRISIGCEDADDLINDLSAALNKL 400
           LIR+S+G E  DD+I D   A  K+
Sbjct: 414 LIRVSVGTEFIDDIIGDFEQAFEKV 438

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 117/271 (43%), Gaps = 31/271 (11%)

Query: 154 LEDIEKYAQKGD---IVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDV 210
           L+D++     G+    V +E P NP     D+ E  + +   G  + VD T       D 
Sbjct: 391 LQDLQTILHSGEQILAVFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGFVNLDG 450

Query: 211 WEFDADIVMHSATKYFGGHSDLLSGVLVV----KDEDVARQLRDDRIYLGTNVANLESYL 266
             F ADIV  S TK F G S++++G +V+    K  + A+Q  +    +  ++   +   
Sbjct: 451 L-FHADIVCSSLTKVFNGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDLIY 509

Query: 267 LLRSLRTFKMRIERQSENATKVVKFLNDN--KGKFGNVLDKIYHSSLQTEPF------VK 318
           L ++ R F  +  R         ++L DN  K   G +  +IY+ S  +E        +K
Sbjct: 510 LEKNSRDFVAKTLR----INYTTEYLLDNVFKPHVGKLFKRIYYPSQNSEEIKQNYEAIK 565

Query: 319 KQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLV----------EWRAMT 368
            +  GGY  VFS+T    +Q K F   LK     T LG   + V          E   + 
Sbjct: 566 CKKDGGYGGVFSVTFFQLDQAKVFFNNLKLTKQIT-LGNNSTTVCPYTMLKHKDELERVK 624

Query: 369 DPYIDQTLIRISIGCEDADDLINDLSAALNK 399
           +  ++  LIR+ +G E+ + L +    A++K
Sbjct: 625 EYGLEDNLIRVCVGLENKNTLRDIFQFAIDK 655

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 118/266 (44%), Gaps = 26/266 (9%)

Query: 154 LEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEF 213
           L+DI    ++   V +E P NP     D+ E    A+A G  + VD T       DV   
Sbjct: 384 LKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDETAGGFVNIDVLP- 442

Query: 214 DADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLR 269
            ADIV  S TK F G S++++G +V+            + +   +  +L    ++  L R
Sbjct: 443 HADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFA-QQFFSSDSFEDLLWCEDAIYLER 501

Query: 270 SLRTFKMRIERQSENATKVVK-FLNDNKGKFGNVLDKIYHSSLQTEPFVKKQL------K 322
           + R F  R    ++N  ++++  L   +GK   +  KI+  SL +E   K+        +
Sbjct: 502 NSRDFATRTLTVNKNTQRLLEDVLLPQEGK---LFKKIFFPSLTSEE-TKRNYDVVLCPQ 557

Query: 323 GGYDPVFSITLKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYID 373
           GGY  +FS+T   +EQ + F         P L   F  A     +    E   +    ++
Sbjct: 558 GGYGGLFSLTFYREEQARVFFDVLELCKGPSLGTNFTLACPYAILAHYAELEEVAKYGVE 617

Query: 374 QTLIRISIGCEDADDLINDLSAALNK 399
           ++L+R+S+G E A+ L +  S A+ +
Sbjct: 618 RSLVRVSVGLESAESLNHVFSHAIKE 643

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 114/453 (25%), Positives = 176/453 (38%), Gaps = 95/453 (20%)

Query: 27  PIHLSTTLIHGDDK---DNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTP--I 81
           P H  T  +H   +   DN     A PI  TT++ ++       S+  +  F  + P  +
Sbjct: 2   PSHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYV 55

Query: 82  YSRLGHPNSTRLES-IFSEVLNGHAVIYSSGVSA---FFAAMVHYNPKRLFMGQSYHGCR 137
           YSR  +P S  LE  I +      A+  SSG +A       + H     +     Y G  
Sbjct: 56  YSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTY 115

Query: 138 AIANILTRNYNVEQHPLE-----DIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHA 191
               I  + + +E   +E     + EK + ++   V+LET  NP     D  +    AH 
Sbjct: 116 NQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHK 175

Query: 192 KGALLCVDSTF-APPPLQDVWEFDADIVMHSATKYFGGHSDLL------SGVLVVKD--E 242
            G  + VD+TF A        ++ ADIV HSATK+ GGH   +      SG    KD  E
Sbjct: 176 HGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPE 235

Query: 243 DVARQLRDDRIYLGT-------NVANL------------------ESYLLLRSLRTFKMR 277
              +  +    Y GT       N+A +                   S+LLL+ + T  +R
Sbjct: 236 KFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLR 295

Query: 278 IERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITLK 334
            ER  ENA K+ K+L  +       +  + +  L +       KK L  G+  V S  +K
Sbjct: 296 AERHGENALKLAKWLEQSP-----YVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVK 350

Query: 335 NKEQCKK----FPLL-------LKYFHHATSLGGIESLVEWRAMTDPY------------ 371
           +     K    F L        LK   +  ++G  ++LV       PY            
Sbjct: 351 DLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLV-----IAPYFTTHKQLNDKEK 405

Query: 372 ----IDQTLIRISIGCEDADDLINDLSAALNKL 400
               + + LIR+S+G E  DD+I D   +   +
Sbjct: 406 LASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 112/252 (44%), Gaps = 27/252 (10%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     D+ E  R A A G  + VD T     + DV  + ADIV  S TK F
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIGGLNV-DVLPY-ADIVCTSLTKLF 375

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S+ + G +++  +        +  +      +L    ++ +L  + R F+ R  R +
Sbjct: 376 NGSSNAMGGSIILNPKSSLYSSACE-YFKSAEFEDLLWCEDAVVLEANSRDFQDRTLRAN 434

Query: 283 ENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEPFVK-----KQLKGGYDPVFSITLKNK 336
            N  K++ + L   +GK   +  KIY+ ++ ++         +   GGY  +FS+   N+
Sbjct: 435 INTEKLLNEVLLPEEGK---ICKKIYYPTVSSKETFNNYESVRNKHGGYGCLFSMAFYNE 491

Query: 337 EQCKKFPLLLKYFHHATSLGGIESLV----------EWRAMTDPYIDQTLIRISIGCEDA 386
              K F   LK F    S G   +L           E   ++    D  LIR+S+G ED 
Sbjct: 492 GDAKTFYDTLKVF-KGPSNGTNFTLACPYVHLAHHSELEEVSKFGADPNLIRVSVGLEDT 550

Query: 387 DDLINDLSAALN 398
             L++  S+A++
Sbjct: 551 QTLLDVFSSAID 562

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 115/257 (44%), Gaps = 37/257 (14%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     ++ E  R A A G  + +D T     + D+  + ADIV  S TK F
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLF 374

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S+++ G +V+  +    Q R    +      +L    ++ +L R+ R F+ R  R +
Sbjct: 375 NGASNVMGGSVVLNPKSALYQ-RAREYFKSGEFEDLLWGEDAVVLERNSRDFEDRTLRAN 433

Query: 283 ENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVK-----KQLKGGYDPVFSITLKNKE 337
            N  K++K L   +   G    KIY+ ++ ++  +      +  +GGY  +FS+   ++ 
Sbjct: 434 TNTEKLLKELLLPEQ--GKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAFHSEG 491

Query: 338 QCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIRISI 381
             + F   LK F   ++            +  PY+                D ++IR+S+
Sbjct: 492 DAEAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADSSIIRVSV 544

Query: 382 GCEDADDLINDLSAALN 398
           G E+   L++  S+AL+
Sbjct: 545 GLEETQLLLDVFSSALD 561

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 111/447 (24%), Positives = 178/447 (39%), Gaps = 90/447 (20%)

Query: 27  PIHLSTTLIHGDDKDNRVSDV----APPINVTTTFRYDPNDLIPWSERENLDFMDKTP-- 80
           P H  T  +H   +  + +D     A PI  TT++ +  ND    S+     F  +TP  
Sbjct: 2   PSHFDTLQLHAGQE--KTADAHNPRAVPIYATTSYVF--ND----SKHGAQLFGLETPGY 53

Query: 81  IYSRLGHPNSTRLESIFSEVLNGHAVIY-SSGVSA---FFAAMVHYNPKRLFMGQSYHGC 136
           IYSR+ +P    LE   + +  G A +  SSG +A       + H     +     Y G 
Sbjct: 54  IYSRIMNPTLDVLEKRLAALEGGIAALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGT 113

Query: 137 RAIANILTRNYNVEQHPL-----EDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAH 190
                +  +   +E   +     ED EK + +K   ++LE+  NP     D  +    AH
Sbjct: 114 YNQFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAH 173

Query: 191 AKGALLCVDSTFAPPPL--QDVWEFDADIVMHSATKYFGGHSD------LLSGVLVVKD- 241
             G  + VD+TF       Q + ++ ADIV HSATK+ GGH        + SG    KD 
Sbjct: 174 KHGIPVVVDNTFGAGGFFCQPI-KYGADIVTHSATKWIGGHGVTVGGVIIDSGKFPWKDY 232

Query: 242 -EDVARQLRDDRIY-------------------------LGTNVANLESYLLLRSLRTFK 275
            E   +  +    Y                         LG  ++    +LLL+ L T  
Sbjct: 233 PEKFPQFSQPSEGYHGLIFNDAFGPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLETLS 292

Query: 276 MRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSIT 332
           +R ER   NA K+ ++L  +       +  + +  L +       KK L+ G+  V S  
Sbjct: 293 LRGERHGSNALKLAQYLESSP-----YVSWVSYPGLPSHSHHENAKKYLENGFGGVLSFG 347

Query: 333 LKN----KEQCKKFPLL-------LKYFHHATSLGGIESLV------EWRAMTDPY---- 371
           +K+     E+   F          LK   +  ++G  ++LV        + +TD      
Sbjct: 348 VKDLPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLAS 407

Query: 372 -IDQTLIRISIGCEDADDLINDLSAAL 397
            + + LIR+S+G E  DD+I D  A+ 
Sbjct: 408 GVTKDLIRVSVGTEFIDDIIADFEASF 434

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 109/249 (43%), Gaps = 39/249 (15%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     D+ +  + A   G  + +D T     + D+  + ADIV  S TK F
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLF 374

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S+++ G +++ + D +        +      +L    ++ +L  + R F+ R  R +
Sbjct: 375 SGTSNVMGGSVLL-NPDSSLYPYAQEYFQSCEFEDLLWSEDAVVLEANSRDFEARTLRTN 433

Query: 283 ENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEPFVK-----KQLKGGYDPVFSITLKNK 336
           EN   ++ K L   +GK   ++ K+Y+ ++ +E   K     +  +GGY  +FSI   N+
Sbjct: 434 ENTVNLLTKVLLPEEGK---LIKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSIAFHNE 490

Query: 337 EQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYI----------------DQTLIRIS 380
           E  K F   LK F   ++            +  PY+                D  L+R+S
Sbjct: 491 EDAKCFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHFELVEVAELGADPNLVRVS 543

Query: 381 IGCEDADDL 389
           +G E+   L
Sbjct: 544 VGLEEFQGL 552

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 122/310 (39%), Gaps = 73/310 (23%)

Query: 155 EDIEK-YAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTF-APPPLQDVWE 212
           ED EK +  K   V+LE+  NP     D  +    AH  G  + VD+TF A       ++
Sbjct: 138 EDFEKAFDDKTKAVYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQPFK 197

Query: 213 FDADIVMHSATKYF----------------------------------GGHSDLLS---G 235
           F ADI+ HSATK+                                   G H  + +   G
Sbjct: 198 FGADIITHSATKWIGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDALG 257

Query: 236 VLVVKDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDN 295
            L          LRD    LG  +    ++ LL+ + T  +R ER + NA K+ ++L  +
Sbjct: 258 PLAYIAHVRVELLRD----LGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYLESS 313

Query: 296 KGKFGNVLDKIYHSSLQTEPF---VKKQLKGGYDPVFSITLKN----KEQCKKFPL---- 344
                  +  + +  L +       KK L+ G+  V SI +K+     E+   F      
Sbjct: 314 P-----YVSWVSYPGLPSHSHHENAKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQ 368

Query: 345 ---LLKYFHHATSLGGIESLV------EWRAMTDPY-----IDQTLIRISIGCEDADDLI 390
               LK   +  ++G  ++LV        + ++D       + + LIRIS+G E  DD+I
Sbjct: 369 VVDSLKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDII 428

Query: 391 NDLSAALNKL 400
            D   A  K+
Sbjct: 429 GDFEQAFEKV 438

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 113/257 (43%), Gaps = 25/257 (9%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V LE P NP     D+S+  + +   G  + VD T +     D+  +  DIV  S TK F
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSY-CDIVCSSLTKIF 376

Query: 227 GGHSDLLSGVLVV----KDEDVARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQS 282
            G S++++G LVV    K  D A    +D       +   +S  L R+ R F  R ++ +
Sbjct: 377 SGDSNVIAGSLVVNPASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKIN 436

Query: 283 ENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVK------KQLKGGYDPVFSITLKNK 336
           + A  +V  +   +     +L+KIY+ SL T P  K      K   GGY  + SI  K +
Sbjct: 437 KIAEDLVSTVLLEEEG--QLLEKIYYPSL-TSPESKLNYDSVKCNNGGYGGLISIVFKRE 493

Query: 337 EQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYID----------QTLIRISIGCEDA 386
           +Q K F   L   +   SLG   +LV   A+   Y +          + L+RIS+G E  
Sbjct: 494 DQAKVFYDNLS-LNKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGLESL 552

Query: 387 DDLINDLSAALNKLQDT 403
           + L      A +  +D 
Sbjct: 553 ETLQTIFRKAFDAAKDV 569

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 122/289 (42%), Gaps = 50/289 (17%)

Query: 150 EQHPLEDIEKYAQKGD---IVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPP 206
           + + L+D+E     G+    V +ETP NP     D++   R A+  G  + +D T     
Sbjct: 408 DSNSLKDLECTLHSGEQILAVFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFV 467

Query: 207 LQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYL 266
             DV  + ADIV  S TK F G S++++G +V+  ++   +L        + +   E +L
Sbjct: 468 NIDVLPY-ADIVCSSLTKIFSGSSNVIAGSMVLNPQE---KLYSFAQVFMSQLGEYEDHL 523

Query: 267 -------LLRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQT-EPFVK 318
                  L R+ R F  R  + ++N   ++K +   +     +  KI++ SL + E  V 
Sbjct: 524 WCEDAIYLERNSRDFIARTIKTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSAESKVN 583

Query: 319 ------------KQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRA 366
                          +GGY  +FS+     EQ        K F +  +L    SL     
Sbjct: 584 YDAVRCKSIDKDSDEEGGYGGLFSLAFNKIEQA-------KIFFNELNLSKGPSLGTNFT 636

Query: 367 MTDPY----------------IDQTLIRISIGCEDADDLINDLSAALNK 399
           ++ PY                ++++L+R+SIG E  D+L      A+++
Sbjct: 637 LSCPYTVLMYYDKLDEVAKYEVEESLVRVSIGIESQDELQKAFQHAIDE 685

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 112/254 (44%), Gaps = 24/254 (9%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     ++ E  R +   G  + +D T       D   F ADIV  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S+++ G +V+  +    +     + L     +L    ++  L R+ R F  R  R +
Sbjct: 504 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 563

Query: 283 ENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEP------FVKKQLKGGYDPVFSITLKN 335
            +   ++ K L  + G+ G +  KIY+ SL ++        V+ + +GGY  +FS+T  +
Sbjct: 564 YSTEYLLDKILKAHVGENG-LFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLFSLTFHD 622

Query: 336 KEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRISIGCED 385
           ++    F   L+  +   SLG   +L     +   Y          +++ L+RIS+G E 
Sbjct: 623 EDHAAAFYNNLQ-LNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRISVGLES 681

Query: 386 ADDLINDLSAALNK 399
              L      A++K
Sbjct: 682 QSTLGKIFQEAIDK 695

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 117/272 (43%), Gaps = 47/272 (17%)

Query: 157 IEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDAD 216
           +E   Q+   V +ETP NP     D+ +    A   G  + +D T     + D+  + AD
Sbjct: 311 LETSKQRILAVFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGGLNV-DILPY-AD 368

Query: 217 IVMHSATKYFGGHSDLLSGVLVVKDED----VARQLRDDRIYLGTNVANL----ESYLLL 268
           IV  S TK F G S+++ G +V+  +      AR+      +   N  +L    ++ +L 
Sbjct: 369 IVSTSLTKLFNGASNVMGGSVVLNPKSSLYPYAREY-----FRSANFEDLLWCEDAIVLE 423

Query: 269 RSLRTFKMRIERQSENATKVVK-FLNDNKGKFGNVLDKIYHSSLQTEPFVK-----KQLK 322
           R+ R F+ R  R + N   ++   L   +GK   +  KIY+ ++ ++   +     +  +
Sbjct: 424 RNSRDFEDRTLRANANTGILLNDLLLPEEGK---ICKKIYYPTVTSKETFENYESVRNER 480

Query: 323 GGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYI---------- 372
           GGY  +FS+   N+   K F   LK F   ++            +  PY+          
Sbjct: 481 GGYGCLFSVAFFNEGDAKAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEE 533

Query: 373 ------DQTLIRISIGCEDADDLINDLSAALN 398
                 D  +IR+S+G ED   L+   S+AL+
Sbjct: 534 VSKFGADPNIIRVSVGLEDIQWLLKVFSSALD 565

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 120/271 (44%), Gaps = 29/271 (10%)

Query: 150 EQHPLEDIEKYAQKGD---IVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPP 206
           ++  +E +++    G+    V +E P NP     ++ E    A A G  + +D T     
Sbjct: 381 DEKSMEQLKEILHSGEQILAVFMEAPSNPLLKMGNLIELRELADAYGFYVVIDETAGGFV 440

Query: 207 LQDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDE----DVARQLRDDRIYLGTNVANL 262
             DV    AD+V  S TK F G S++++G LV+  +      A+Q   D  +   ++   
Sbjct: 441 NIDVLP-HADMVCSSLTKIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEF--EDLLWC 497

Query: 263 ESYLLL-RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQL 321
           E  + L R+ R F  R    ++N  ++++ +   + K   +  KI++ SL T P  K+  
Sbjct: 498 EDVIYLERNSRDFVTRTLTVNKNTAQLLEEVLIPQEK--KLFKKIFYPSL-TSPETKRNY 554

Query: 322 ------KGGYDPVFSITLKNKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRA 366
                 KGGY  +FS+T  N++Q + F         P L   F  A     +    E   
Sbjct: 555 DAILCPKGGYGGLFSLTFYNEKQARVFFDTLELCKGPSLGTNFTLACPYAILAHYTELEE 614

Query: 367 MTDPYIDQTLIRISIGCEDADDLINDLSAAL 397
           +    ++++L+R+S+G E    L    S A+
Sbjct: 615 VAKFGVERSLVRVSVGLESPQVLNAVFSRAI 645

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 116/254 (45%), Gaps = 24/254 (9%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     ++ E  R +   G  + +D T       D   F AD+V  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S+++ G +V+  +    +     + L     +L    ++  L R+ R F  R  R +
Sbjct: 493 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 552

Query: 283 ENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEP------FVKKQLKGGYDPVFSITLKN 335
            N   ++ K +  + G+   +  KIY+ +L ++        V+ + +GGY  +FS+T  +
Sbjct: 553 YNTEYLLDKIIKPHVGE-NALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHD 611

Query: 336 KEQCKKFPLLLKYFHHATSLGGIESLV---------EWRAMTDPY-IDQTLIRISIGCED 385
           ++  + F   L+  +   SLG   +LV            AM + + +++ L+RIS+G E+
Sbjct: 612 EDHAEAFYDNLQ-LNKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRISVGLEN 670

Query: 386 ADDLINDLSAALNK 399
              L      A+++
Sbjct: 671 QLTLGKIFQKAIDQ 684

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 114/255 (44%), Gaps = 26/255 (10%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     ++ E  R +   G  + +D T       D   F ADIV  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S+++ G +V+  +    +     + L     +L    ++  L R+ R F  R  R +
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFATRFMRLEDEYEDLLWCEDAIYLERNSRDFIARTVRIN 513

Query: 283 ENATKVV-KFLNDNKGKFGNVL-DKIYHSSLQTEP------FVKKQLKGGYDPVFSITLK 334
            +   ++ K L  + G  GN L  KIY+ +L ++        V+ + +GGY  +FS+T  
Sbjct: 514 YSTEYLLDKILKPHVG--GNELFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFH 571

Query: 335 NKEQCKKFPLLLKYFHHATSLGGIESLV---------EWRAMTDPY-IDQTLIRISIGCE 384
           ++     F   L+  +   SLG   +L          +  AM + + +++ L+RIS+G E
Sbjct: 572 DEHHAAAFYDNLQ-LNKGPSLGTNFTLAFPYTLMTYYQELAMAEKFGVERNLLRISVGLE 630

Query: 385 DADDLINDLSAALNK 399
               L      A++K
Sbjct: 631 SQSTLGKIFQEAIDK 645

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 111/254 (43%), Gaps = 24/254 (9%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     ++ E  R +   G  + +D T       D   F ADIV  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRIERQS 282
            G S+++ G +V+  +    +     + L     +L    ++  L R+ R F  R  R +
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 513

Query: 283 ENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEP------FVKKQLKGGYDPVFSITLKN 335
            +   ++ K L  + G+   +  KIY+ +L ++        V+ + +GGY  +FS+T  +
Sbjct: 514 YSTEYLLDKILKPHVGE-NKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHD 572

Query: 336 KEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPY----------IDQTLIRISIGCED 385
           ++    F   LK  +   SLG   +L     +   Y          +++ L+RIS+G E 
Sbjct: 573 EDHAAAFYDNLK-LNKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISVGLES 631

Query: 386 ADDLINDLSAALNK 399
              L      A++K
Sbjct: 632 QSILGKIFQEAIDK 645

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 126/298 (42%), Gaps = 31/298 (10%)

Query: 121 HYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIEKYAQ---KGD---IVHLETPVN 174
            ++ K + +G   H    +   L+++Y + ++  + + K  +    G+    V  ETP N
Sbjct: 342 QHSKKTVVLGVPCHDTYEMVTTLSKSYFIPENGTDGLSKLKEILHSGEQILAVITETPTN 401

Query: 175 PYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDLLS 234
                 ++ E  + +   G  + VD +       D   +  DIV  S  K F G  D++S
Sbjct: 402 GLLDVTNLVELKQLSELFGFYIVVDESVGGFVNVDALVY-CDIVCSSLVKMFSGTEDVVS 460

Query: 235 GVLVVKDED---------VARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENA 285
           G +VV  +          +A +     +    ++  LE     ++ R F  + +R +  A
Sbjct: 461 GSMVVNPQSKLYDFAQTFMASEHEPSSVLWCEDIIQLE-----QNSRDFVSKSKRIN-TA 514

Query: 286 TKVVKFLNDN-KGKFGNVLDKIYHSSLQTEP---FVKKQLKGGYDPVFSITLKNKEQCKK 341
           TK  + L D    + G +  +++H S+        +K +  GGY  VF++     E+ + 
Sbjct: 515 TK--RLLRDVILPQRGTIFTEVHHPSITDRAQYNLIKGKQDGGYGGVFAVQFSTLERARS 572

Query: 342 FPLLLKYFHHATSLGGIESLVEWRAMTDPY--IDQTLIRISIGCEDADDLINDLSAAL 397
           F   L        LGG  ++     + + Y  +D+TLIR+S+G ED D L      A+
Sbjct: 573 FYDRLNVCK-GPGLGGDYTVACPWQLLNQYDEVDKTLIRVSVGLEDYDVLKRAFEEAI 629

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 119/287 (41%), Gaps = 48/287 (16%)

Query: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207
           N     L++I    ++   V +E P NP     D+ E  R +   G  + VD T A   +
Sbjct: 419 NSAMSKLKEILHSGEQILAVFIEAPSNPLLKMGDLIELKRLSDMYGFFIIVDETIAGF-V 477

Query: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVV----KDEDVARQLR------------DD 251
                  ADI+  S TK F G S++++G +V+    K  D A++              +D
Sbjct: 478 NIDAIIHADIICSSLTKVFTGDSNVIAGSMVLNPMSKIYDFAKRFLSFPDGFEDCLWCED 537

Query: 252 RIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVVKFLNDNKGK---FGNVLDKIYH 308
            +YL  N          R   +   RI   +E     V  L+   GK    G +  KIY+
Sbjct: 538 ILYLEKNS---------RDFLSKTTRINNTTEYLVNTV--LSPYVGKKEANGKLFKKIYY 586

Query: 309 SSLQTEPF------VKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLV 362
            +  ++        +K +  GGY  VFSIT  + E+ K F   LK      SLG   + V
Sbjct: 587 PTTTSKETKMCYDAIKCKTYGGYGGVFSITFHDIEKAKLFFNNLK-LSKTISLGSNYTTV 645

Query: 363 ----------EWRAMTDPYIDQTLIRISIGCEDADDLINDLSAALNK 399
                     E   +++  +D+TLIR+ +G E+   L  + S A+ K
Sbjct: 646 CPYTVLKHGDELEKVSEYGLDETLIRVCVGLENKTSLKENFSRAIEK 692

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 119/262 (45%), Gaps = 35/262 (13%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +ETP NP     ++ +  R A   G  + +D T     + D+  + ADIV  S TK F
Sbjct: 312 VFVETPSNPLLNMPNLKDLRRLADQYGFFIIIDDTIGGINV-DILPY-ADIVCTSLTKLF 369

Query: 227 GGHSDLLSGVLVVKDED----VARQLRDDRIYLGTNVANL----ESYLLLRSLRTFKMRI 278
            G S+++ G +V+  +      AR+      +   +  +L    ++ +L R+ R F+ R 
Sbjct: 370 NGASNVMGGSIVLNPKSSIYPYAREY-----FKSADFEDLLWCEDAVVLERNSRDFENRT 424

Query: 279 ERQSENATKVV-KFLNDNKGKFGNVLDKIYHSSLQTEPFVK-----KQLKGGYDPVFSIT 332
              + N  K++ + L   +GK   +  K+Y+ ++ +E   +     +  +GGY  +FS+ 
Sbjct: 425 LHANANTEKLLNEVLIPEQGK---LCKKVYYPTVTSEETFRNYESVRNERGGYGCLFSVA 481

Query: 333 LKNKEQCKKFPLLLKYFHHATSLGGIESLV----------EWRAMTDPYIDQTLIRISIG 382
             N+   K F   LK F    S G   +L           E  A++    D  +IR+S+G
Sbjct: 482 FYNEGDAKAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEAVSKFGADPNIIRVSVG 540

Query: 383 CEDADDLINDLSAALNKLQDTN 404
            ED   L+   S AL+ ++  N
Sbjct: 541 LEDTQWLLEVFSNALDVVRGRN 562

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 104/253 (41%), Gaps = 22/253 (8%)

Query: 167 VHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYF 226
           V +E+P NP     D+ E  R +   G  + +D T       DV  + AD+V  S TK F
Sbjct: 431 VFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNIDVLPY-ADVVCSSLTKIF 489

Query: 227 GGHSDLLSGVLVVKDEDVARQLRDDRIYLGTN-----VANLESYLLLRSLRTFKMR---I 278
            G S++++G +V+       +     ++L        +   ++  L R+ R F  R   +
Sbjct: 490 SGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLLWCEDAICLERNSRDFISRSILV 549

Query: 279 ERQSENATKVVKFLNDNKGK-FGNVLDKIYHSSLQTEPF--VKKQLKG-GYDPVFSITLK 334
              +E+  + V      +GK F  V    Y ++   + +  VK +  G GY  +FS+T  
Sbjct: 550 NENTESLLEKVILPQQGEGKLFKKVFYPKYTNAETKKNYDQVKAKTAGSGYGGLFSVTFY 609

Query: 335 NKEQCKKF---------PLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCED 385
           N EQ K F         P L   F  A     +    E   +    ++  L+R+S+G E 
Sbjct: 610 NIEQAKMFFNSLNLCKGPSLGTNFTLACPYTVLAHYQEMEEVAKFGLEDNLVRVSVGLES 669

Query: 386 ADDLINDLSAALN 398
              L      A++
Sbjct: 670 KQHLEKVFQTAID 682

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 120/293 (40%), Gaps = 28/293 (9%)

Query: 132 SYHGCRAIANILTRNYNVEQHPLEDIEKYAQKGD---IVHLETPVNPYGTSLDISEFARR 188
           +Y   + + N+    Y  E   +  ++     G+    V +E P  P     ++ E    
Sbjct: 372 TYKMLKTLNNVYCLPYVSEIDCMNKLKNILHSGEQILAVLIEAPSTPLLKMGNLLELKEL 431

Query: 189 AHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGH-SDLLSGVLVVKDE----D 243
           ++  G ++ VD T       D     AD+V  S TK F G   ++++G + +       +
Sbjct: 432 SNLFGFIIIVDETVGGFFNVDAL-VHADVVCTSLTKIFSGDVGNVMAGAMALNSNSTIYN 490

Query: 244 VARQLRDDRIYLGTNVANLESYLLLRSLRTFKMRIERQSENATKVV-KFLNDNKGKFGNV 302
            A+    D      N+   ++ ++ R+ R F  ++ + +     ++ K L  + G+  N+
Sbjct: 491 FAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAKMLKINYTTDYLLDKVLIPHIGEH-NL 549

Query: 303 LDKIYHSSL------QTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLLLKYFHHATSLG 356
             KIYH  L      Q    +K +  GGY  VFSI   N EQ K F   L       SLG
Sbjct: 550 FKKIYHPRLTSNETKQNYEKIKCKSDGGYGGVFSIDFNNLEQAKLFYNCLN-VAKGPSLG 608

Query: 357 GIESLVEWRAMTDPYID----------QTLIRISIGCEDADDLINDLSAALNK 399
              +L     +   Y D          ++LIR+S+G E+   L     AA+++
Sbjct: 609 TTMTLACPYTILYHYADIEKVSKYGLSESLIRVSVGLENRKQLCQLFQAAIDE 661

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 42.7 bits (99), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 37/63 (58%), Gaps = 11/63 (17%)

Query: 347 KYFHHATSLGGIESLVEWRA-MTDPYI--DQ--------TLIRISIGCEDADDLINDLSA 395
           + F  A SLGGIESL+E  A MT   I  DQ         LIR+S+G ED DDL++D+  
Sbjct: 21  RLFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLLDDIKN 80

Query: 396 ALN 398
           AL 
Sbjct: 81  ALT 83

>Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 152

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 27/135 (20%)

Query: 22  QLATRPIHLST-TLIHGDDKDNRVSDVAPPINVTTTFR-YDPNDLIPWSERENLDFMDKT 79
           + AT+ +H  T T +HG         V  PI+++TTF+ + P    P  E E        
Sbjct: 7   KFATKAVHAGTHTDVHGS--------VIEPISLSTTFKQHSPAQ--PVGEYE-------- 48

Query: 80  PIYSRLGHPNSTRLESIFSEVLNG-HAVIYSSGVSAFFAAMVHYNPK---RLFMGQSYHG 135
             YSR  +PN   LE   + + N  HA+ +SSG SA  A ++   P+    + +G  Y G
Sbjct: 49  --YSRSQNPNRKNLEDAVAALENAKHALAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGG 105

Query: 136 CRAIANILTRNYNVE 150
                + +   + VE
Sbjct: 106 THRYFSKVAAAHGVE 120

>TBLA0A10490 Chr1 (2583135..2583986) [852 bp, 283 aa] {ON} Anc_5.263
           YKL154W
          Length = 283

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 190 HAKGALLCVDSTFAPPPLQDVWEFDADI-VMHSATKYFGGHSDLL 233
           + KG +  VDST  P  L D  +F  DI V+   TKYF    D+L
Sbjct: 129 NLKGLIFLVDSTIDPKNLTDTAQFLYDILVITENTKYFNNGVDIL 173

>Kpol_344.6 s344 (13142..19165) [6024 bp, 2007 aa] {ON} (13142..19165)
            [6024 nt, 2008 aa]
          Length = 2007

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 17/116 (14%)

Query: 155  EDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKG-ALLCV-DSTFAPPPLQDVWE 212
            E +EKYA +    ++  P+N  G          RA AK   LLCV ++ +   P      
Sbjct: 1632 EPVEKYANQS--RNVSEPINDIGNV--------RASAKNFGLLCVPENAYISTPNAPTPN 1681

Query: 213  FDADIVMHSA--TKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYL 266
             D D+V+ S+   +    +   LSGV    + D+ +++R   + + +N AN+ S+L
Sbjct: 1682 PDEDVVLPSSYYQQLLSTNDVSLSGVT---NSDLEQEVRKRGLTISSNEANINSFL 1734

>SAKL0C09328g Chr3 complement(847128..849143) [2016 bp, 671 aa] {ON}
           similar to Q04373 YDR496C uniprot|Q04373 Saccharomyces
           cerevisiae PUF6 Pumilio-homology domain protein that
           binds ASH1 mRNA at PUF consensus sequences
          Length = 671

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 20/92 (21%)

Query: 99  EVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNVEQHPLEDIE 158
           E+LN  A ++ S +S  ++ ++  N           GC+ ++ +L  +   EQ   +DI+
Sbjct: 488 ELLNRFAPVFLSNISKHYSEILSENI----------GCQFVSEVLVNDDLYEQLGEKDIQ 537

Query: 159 KYAQ---------KGDIVHLETPVN-PYGTSL 180
           +Y           KGDI   E P+N P+   L
Sbjct: 538 RYQGVVELVLTSFKGDISEEEHPINRPFSVRL 569

>Suva_11.72 Chr11 (147555..148292) [738 bp, 245 aa] {ON} YKL154W
           (REAL)
          Length = 245

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 45/122 (36%), Gaps = 13/122 (10%)

Query: 121 HYNPKRLFMGQSYHGCRAIANILT----RNYNVEQHPLEDIEKYAQKGDIVHLETPVNPY 176
            Y P  +  G    G  +   +LT    R   V Q PL           +V       P 
Sbjct: 37  SYQPSIVIAGPQNAGKTSFLTLLTTDSVRPTVVSQEPLSAANYNNSNASLVDF-----PG 91

Query: 177 GTSL--DISEF--ARRAHAKGALLCVDSTFAPPPLQDVWEFDADIVMHSATKYFGGHSDL 232
              L   +SE+   R A  KG +  VDST  P  L    EF  DI+M + +    G   L
Sbjct: 92  HVKLRYKLSEYLKTRAASIKGLIFMVDSTIDPKKLTTTAEFLVDILMITESSCENGVDIL 151

Query: 233 LS 234
           ++
Sbjct: 152 IA 153

>TDEL0C06370 Chr3 complement(1165302..1167209) [1908 bp, 635 aa]
           {ON} Anc_1.65 YNL279W
          Length = 635

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 33  TLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENL-DFMDKTPIYSRLGHPNST 91
           +L  G++KD+  SD    +N+T +   D    IP S  + L +  DKTP ++ L +   T
Sbjct: 176 SLFTGNNKDDGASDKIKQVNLTISSLRDFQ--IPSSIDDKLRNLSDKTPDFATLKNMTKT 233

Query: 92  RLESIFSEVLNGHAVIYSSGV 112
            +   F+EV N    + ++G+
Sbjct: 234 LISVPFTEVRNEIDAMNATGI 254

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1431

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 16/113 (14%)

Query: 302 VLDKIYHSSLQTEPFVKKQLKGGYDPVFSITLKNKEQCKKFPLL--------LKYFHHAT 353
           VL +++ S+LQ       +   G  P F   L   EQ  +  L+        +  FH   
Sbjct: 344 VLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSCLDVSLFHTEN 403

Query: 354 SLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADDLI------NDLSAALNKL 400
           +   +E L EW A++D  +D++   ++   E AD+L        D  AALN L
Sbjct: 404 ANRLVELLSEWLALSDEPLDES--ELNAANEVADELYKILETNQDSQAALNIL 454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,952,611
Number of extensions: 2024145
Number of successful extensions: 5665
Number of sequences better than 10.0: 127
Number of HSP's gapped: 5587
Number of HSP's successfully gapped: 146
Length of query: 404
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 292
Effective length of database: 40,638,807
Effective search space: 11866531644
Effective search space used: 11866531644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)