Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F028605.350ON25325313280.0
NDAI0C043105.350ON2592567038e-93
Kwal_34.159845.350ON2512546602e-86
KAFR0C018605.350ON2592486473e-84
KLTH0H14828g5.350ON2512556376e-83
ZYRO0D10142g5.350ON2552496272e-81
TDEL0E027705.350ON2582436272e-81
SAKL0G08866g5.350ON2552395787e-74
CAGL0H07117g5.350ON2602505613e-71
Suva_2.4885.350ON2742605372e-67
Kpol_339.115.350ON2582495283e-66
Smik_4.5785.350ON2742515276e-66
TPHA0E011305.350ON2772645261e-65
Skud_4.5855.350ON2742515223e-65
KNAG0C055105.350ON2642595205e-65
YDR319C5.350ON2742605129e-64
KLLA0B10153g5.350ON2672465005e-62
Ecym_81835.350ON2652494902e-60
TBLA0A031105.350ON2752674651e-56
AGR350C5.350ON2612494528e-55
KAFR0A046406.117ON2371531349e-09
Skud_7.1466.117ON3161001216e-07
KNAG0F025106.117ON2462091126e-06
TPHA0J018106.117ON39071994e-04
TBLA0F025006.117ON32793986e-04
SAKL0A07062g6.117ON42921900.007
Kwal_14.17966.117ON363159860.021
CAGL0I00330g6.117ON371135850.026
TDEL0G035306.117ON368157850.028
Kpol_461.26.117ON39754820.056
YGL126W (SCS3)6.117ON38041820.064
Smik_7.1456.117ON38041820.068
KLLA0F09526g6.117ON33741810.085
AAR165W6.117ON36272800.098
Smik_10.3687.444ON43783790.16
ZYRO0A09240g6.117ON37223780.17
TPHA0G010508.804ON31435750.40
KLTH0H06556g6.117ON36346740.53
NDAI0I017506.117ON381161740.62
NCAS0D031606.117ON39046711.6
Ecym_30686.117ON36740701.7
SAKL0C11330g3.211ON248962693.0
Kpol_1002.356.240ON45361675.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F02860
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   516   0.0  
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   275   8e-93
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   258   2e-86
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   253   3e-84
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   249   6e-83
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   246   2e-81
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   246   2e-81
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   227   7e-74
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   220   3e-71
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   211   2e-67
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   207   3e-66
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   207   6e-66
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   207   1e-65
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   205   3e-65
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   204   5e-65
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   201   9e-64
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   197   5e-62
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   193   2e-60
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   183   1e-56
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   178   8e-55
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    56   9e-09
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    51   6e-07
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    48   6e-06
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    43   4e-04
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    42   6e-04
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    39   0.007
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    38   0.021
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    37   0.026
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    37   0.028
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    36   0.056
YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protei...    36   0.064
Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa...    36   0.068
KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} simila...    36   0.085
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    35   0.098
Smik_10.368 Chr10 (567777..569090) [1314 bp, 437 aa] {ON} YJR078...    35   0.16 
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    35   0.17 
TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.80...    33   0.40 
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    33   0.53 
NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.1...    33   0.62 
NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {O...    32   1.6  
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    32   1.7  
SAKL0C11330g Chr3 complement(1015136..1022605) [7470 bp, 2489 aa...    31   3.0  
Kpol_1002.35 s1002 complement(106680..108041) [1362 bp, 453 aa] ...    30   5.1  

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%)

Query: 1   MRAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLI 60
           MRAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLI
Sbjct: 1   MRAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLI 60

Query: 61  WAMLFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFI 120
           WAMLFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFI
Sbjct: 61  WAMLFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFI 120

Query: 121 DGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERY 180
           DGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERY
Sbjct: 121 DGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERY 180

Query: 181 LRDEELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWL 240
           LRDEELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWL
Sbjct: 181 LRDEELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWL 240

Query: 241 IPNHYKLNHILYS 253
           IPNHYKLNHILYS
Sbjct: 241 IPNHYKLNHILYS 253

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  275 bits (703), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 180/256 (70%), Gaps = 13/256 (5%)

Query: 7   WPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFG 66
           WP +C +YPTIL +G +IN+++  ETL   K  YY+L+SKNI N+V AYNGN +W++LF 
Sbjct: 8   WPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFI 67

Query: 67  MMAYFQVWIRIRTQDLLPR--DAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLF 124
           +++  Q+ ++    +LLPR  D+    R+ +  LIKQY++KFVLK +LL   FL ID LF
Sbjct: 68  LLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVLLAFLFLIIDSLF 127

Query: 125 LFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDE 184
           + TGG+C     IWSAE CK +GG WEGGFDISGHFCFL+N+SLILW ELS+L + L D 
Sbjct: 128 ILTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLLNKVLEDR 187

Query: 185 ELE-------METIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIM 237
           E         ME +I    ++L C LYLWM +L VTA+YYHTLLEKILGC+LG+ CP++M
Sbjct: 188 EETFTKIDKWMEGVIV---IILGC-LYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVM 243

Query: 238 YWLIPNHYKLNHILYS 253
           Y+ IPN+ KL   LY 
Sbjct: 244 YYFIPNNVKLKQTLYK 259

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  258 bits (660), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/254 (49%), Positives = 173/254 (68%), Gaps = 5/254 (1%)

Query: 1   MRAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLI 60
           M  + +     LVYP+IL  G++IN +V    L+RQ+  YY+LSS NI+N++FAY GNL 
Sbjct: 1   MDKFIEKAQFTLVYPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYRGNLT 60

Query: 61  WAMLFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFI 120
           W +LF ++A FQVW+     DLLPRDA+ ++R    RL KQY VK +LK +LL++ FLFI
Sbjct: 61  WTILFTLLAVFQVWLHAEQSDLLPRDARSVHRVGGVRLAKQYTVKLILKNVLLYLAFLFI 120

Query: 121 DGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERY 180
           D LF++TGG C+      SAE+C+ EGG W+ GFDISGHFCFL N+SLILW EL  +++ 
Sbjct: 121 DNLFVWTGGSCSTS-STRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELRSIQKK 179

Query: 181 LRDEELEMET--IITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMY 238
           +  +++      I+  +S L+  +L  W  +L VTA+YYHTLLEK+LG  +GY CP IMY
Sbjct: 180 ISSDDISPTKTWIVLRWSTLI--VLITWSFILSVTAVYYHTLLEKVLGLTMGYLCPTIMY 237

Query: 239 WLIPNHYKLNHILY 252
            +IPNH  L  +LY
Sbjct: 238 LVIPNHSGLRSLLY 251

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  253 bits (647), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 171/248 (68%), Gaps = 4/248 (1%)

Query: 10  VCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMA 69
           + L+YP IL LG  ++ ++ +ET   QK   Y+L S NI+N +FAYNGNL+W +LF  +A
Sbjct: 11  ISLIYPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVA 70

Query: 70  YFQVWIRIRTQDLLPRDAQIINRQRLQR--LIKQYIVKFVLKYLLLFITFLFIDGLFLFT 127
             Q++IR  T  LLP D   ++ +   R  L+K+Y+VKF+LK  +LF+ FL ID +F+ T
Sbjct: 71  SLQIYIRSHTFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCFLIIDNIFILT 130

Query: 128 GGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEELE 187
           GG C  G    SAE+CK  GG W GGFDISGHFCFL N+SLILW EL    +Y  +EEL+
Sbjct: 131 GGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEELQ 190

Query: 188 --METIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPNHY 245
             +   I    ++++ +LY+WM +L VT+IYYHT+LEKILGC++GY CPL+MYWLIPN  
Sbjct: 191 SRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPNQP 250

Query: 246 KLNHILYS 253
           ++  +LY+
Sbjct: 251 RMKSLLYA 258

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  249 bits (637), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 167/255 (65%), Gaps = 7/255 (2%)

Query: 1   MRAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLI 60
           M  + +      VYP +L+ G +++ +    TL  QK  YY+LS  N++N VFAY GNLI
Sbjct: 1   MDKFIERGRFAFVYPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLI 60

Query: 61  WAMLFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFI 120
           W +LF  +A +Q+ IR+   DLLPRDA+     R  RL K+Y VK +LK LLL++ F  I
Sbjct: 61  WTILFVSLAAYQIKIRVSRSDLLPRDARTTYPARWHRLGKEYAVKIILKNLLLYVIFFVI 120

Query: 121 DGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERY 180
           D +F++TGG C+      SAE+C+ EGG WE GFDISGHFCFL NVSLILW ELS +++Y
Sbjct: 121 DCVFVWTGGSCSSS-ATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKY 179

Query: 181 LRDEELEMETIITNYSVLL---KCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIM 237
           L  +E     +   + VLL     +L +W  +L VTAIYYHT LEKILG L+GY CP+IM
Sbjct: 180 LNSDERTPSKL---WRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIM 236

Query: 238 YWLIPNHYKLNHILY 252
           YWL+P+H  L  +LY
Sbjct: 237 YWLVPSHTALRQLLY 251

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  246 bits (627), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 168/249 (67%), Gaps = 2/249 (0%)

Query: 6   KWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLF 65
            W    +VYP  LV+G  +  ++  E L+ Q+ E+Y L+  N +N++FAY GN IW +LF
Sbjct: 7   DWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILF 66

Query: 66  GMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFL 125
             +A  QV+++    D++PRDA+ I R+ +  L+K+Y VK +LK LLL I FLFID +F+
Sbjct: 67  CGLAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVKIILKNLLLAIIFLFIDNIFI 126

Query: 126 FTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEE 185
            TGG C+   G  SAEKC   GG+WEGGFDISGHFCFL+++S+ILW EL  LE +L +E+
Sbjct: 127 LTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEED 186

Query: 186 LEMETIITNYSVLLKCILYL--WMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN 243
           +     +   +++   +  L  W  +L VT+IYYHTLLEKILGC +GY CP+IMYWLIPN
Sbjct: 187 MVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPN 246

Query: 244 HYKLNHILY 252
           H  +  +LY
Sbjct: 247 HDIVRKVLY 255

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  246 bits (627), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 119/243 (48%), Positives = 164/243 (67%), Gaps = 2/243 (0%)

Query: 13  VYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQ 72
           +YP  LVLG +I  I+ E+ L+ Q+  YY+L SKNI+N +FAY GNL+W + F  +A  Q
Sbjct: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75

Query: 73  VWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFLFTGGQCT 132
           ++++ R   LLPRDA+  +   L+ L+KQY  K +LK +LL ITF  ID +F+ TGG C 
Sbjct: 76  IYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLTGGSCL 135

Query: 133 YGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEEL--EMET 190
            G    SAE+C+  GG W+GGFDISGHFCFL+N+S+ILW ELS    Y+  E +   +  
Sbjct: 136 NGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVVFPVSK 195

Query: 191 IITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPNHYKLNHI 250
           ++    V+   +L +W+ ML VTA+YYHT+LEK+LGC LGY C L+MYWLIP   + N +
Sbjct: 196 VVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSRRFNGL 255

Query: 251 LYS 253
           LYS
Sbjct: 256 LYS 258

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  227 bits (578), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 164/239 (68%), Gaps = 1/239 (0%)

Query: 14  YPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQV 73
           YP +L+LG ++N +V  + LDRQKHEYY+LSS+N++N+VFAY GN I+ + F ++A  Q+
Sbjct: 18  YPLVLLLGLLVNLLVSAQELDRQKHEYYLLSSRNVINKVFAYQGNQIFLITFILLAALQI 77

Query: 74  WIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFLFTGGQCTY 133
            I  + QDLLPR++    R     L +QY +KF+LK LLL++ F  ID +F++TGG C+ 
Sbjct: 78  HIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSI 137

Query: 134 GLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEELEMETIIT 193
                SAE+C+  GG WEGGFDISGHFCFL NVSLILW EL   ++Y+ D EL +     
Sbjct: 138 S-KTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVNRKFA 196

Query: 194 NYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPNHYKLNHILY 252
               L   +L +W+ +L VTA YYHT+ EK+LG ++GY CP +MY LIP+  KLN ++Y
Sbjct: 197 WIKYLTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLMY 255

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  220 bits (561), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 160/250 (64%), Gaps = 6/250 (2%)

Query: 9   NVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMM 68
            V L YP IL+LG  ++ ++ EE    Q+  YY+L+SKN+ N++ AY GN +W  LF  +
Sbjct: 8   QVSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMGV 67

Query: 69  AYFQVWIRIRTQDLLPRDAQ---IINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFL 125
           A  Q  +R ++Q LLP D +   + N+ +LQ +IK+Y  K+ LK  +L + FL IDG+F+
Sbjct: 68  AAVQYNLRTKSQSLLPTDTRALVVSNKTKLQ-IIKEYFCKYFLKLFILDVIFLVIDGVFI 126

Query: 126 FTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYL--RD 183
            TGG CT      SAE CK+ GG W GGFDISGHFCFL+N+S+ILW EL  +  ++   D
Sbjct: 127 MTGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGYD 186

Query: 184 EELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN 243
             + + ++  +   +   +L  WM ML VTA YYHT+ EK++GC+ GY CP +MY LIPN
Sbjct: 187 TVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPN 246

Query: 244 HYKLNHILYS 253
            + LN + Y+
Sbjct: 247 SHDLNKLFYA 256

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  211 bits (537), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 111/260 (42%), Positives = 164/260 (63%), Gaps = 19/260 (7%)

Query: 12  LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYF 71
           LVYP  +++G +I+ +V EETL+ QK  Y +L S N+LN +FAY  N IW + F  +A  
Sbjct: 14  LVYPIQVLVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKANKIWPIFFFSLALL 73

Query: 72  QVWIRIRTQ-DLLP----------------RDAQIINRQRLQRLIKQYIVKFVLKYLLLF 114
           Q++     + D+LP                    ++  + +  +  QY  KFVLK LLLF
Sbjct: 74  QIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVITTMAAQYACKFVLKNLLLF 133

Query: 115 ITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL 174
           ++F FID +F++TGGQC+ G G  SAEKC+ E G W GGFDISGHFCFL+N+S+ILW EL
Sbjct: 134 LSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFCFLVNISMILWMEL 193

Query: 175 SILERYLRDEEL--EMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYC 232
            +  R+++ E++   +   +    V++  +L +W+ +L VTAIYYHT+LEK+LGCL+GY 
Sbjct: 194 HLFSRFVQAEDMLWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKMLGCLMGYI 253

Query: 233 CPLIMYWLIPNHYKLNHILY 252
           CP+ +Y ++P    L+  LY
Sbjct: 254 CPVFIYHILPRIELLHDYLY 273

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  207 bits (528), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 164/249 (65%), Gaps = 6/249 (2%)

Query: 10  VCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMA 69
           V L+YP  +++G  ++ I+ +  L+ Q++ +YIL S NI+N +FAY+GN +W +LF  + 
Sbjct: 9   VSLIYPFEVLIGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFIFLC 68

Query: 70  YFQVWIRIRTQDLLPRDAQIINRQRL----QRLIKQYIVKFVLKYLLLFITFLFIDGLFL 125
             Q++ R +   LL        R +L    + L+KQYI K +LK L+L + F  ID +F+
Sbjct: 69  LVQIYYRSKRFSLLISSESFNGRDQLIARGKPLVKQYICKLILKNLMLILVFSVIDNVFI 128

Query: 126 FTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEE 185
           F+GG+CT G G  S+++C++E GHWEGGFDISGHFCFL+ +S+ILW EL   ++++  E 
Sbjct: 129 FSGGECTSGSGTRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFKKHVDLEG 188

Query: 186 LEMETIITNYSVLLK--CILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN 243
           L  +  + +  +L+    +L +W+ +L +T++YYHT +EK+LGC +GY  P +MY +IPN
Sbjct: 189 LSGQLSLYSKIILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMYHIIPN 248

Query: 244 HYKLNHILY 252
           +  L  ILY
Sbjct: 249 NEFLYSILY 257

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  207 bits (527), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 164/251 (65%), Gaps = 19/251 (7%)

Query: 12  LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYF 71
           L+YP  +++G +I+ +V  +TLD QK  + +L S N+ N +FAY  N +W +LF  +A+ 
Sbjct: 14  LIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFL 73

Query: 72  QVWIR-IRTQDLLP--------RDAQII--NRQRLQR------LIKQYIVKFVLKYLLLF 114
           QV+   +   D+LP        R + +   NR  L +      +I QY  KF+LKY+LLF
Sbjct: 74  QVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLF 133

Query: 115 ITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL 174
           ++F FID +F++TGG+C+ G G  SAEKC+ E G W GGFDISGHFCFL+N+S+ILW EL
Sbjct: 134 LSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMEL 193

Query: 175 SILERYLRDEEL--EMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYC 232
            +  R+++ E++   +   +     ++  +L +W+ +L VTAIYYHT+LEKILGCL+GY 
Sbjct: 194 HMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYI 253

Query: 233 CPLIMYWLIPN 243
           CP+ +Y ++P 
Sbjct: 254 CPIFIYHILPK 264

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  207 bits (526), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 164/264 (62%), Gaps = 13/264 (4%)

Query: 2   RAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIW 61
           + +F    + + Y  +L+ G  ++ I+  ETL+  K  +Y L+SKN +N++FAYNGNL+W
Sbjct: 13  KNHFPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVW 72

Query: 62  AMLFGMMAYFQVWIR-IRTQDLLPRDAQII----NR--QRLQR----LIKQYIVKFVLKY 110
            +LF ++ Y  +    + +++LLP  A +     +R  Q  QR    L KQY  K+ +K 
Sbjct: 73  FLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKS 132

Query: 111 LLLFITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLIL 170
             LF+ F  ID LF+ +GG C  G G   +E C++  G WEGGFDISGHFCFL+ +SLIL
Sbjct: 133 ASLFVIFFAIDTLFVLSGGSCDDGSGTTFSETCRSNKGKWEGGFDISGHFCFLITISLIL 192

Query: 171 WCELSILERYLRDE--ELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCL 228
           WCEL  L + +  E  E+E+  + T    L+  ++ +W  +L +TAIYYHT  EK+LGC+
Sbjct: 193 WCELYKLHKRMESESFEVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCM 252

Query: 229 LGYCCPLIMYWLIPNHYKLNHILY 252
           LG+  PL+MY+ IP++  LN +LY
Sbjct: 253 LGFVTPLLMYYTIPSNEFLNGLLY 276

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  205 bits (522), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 157/251 (62%), Gaps = 19/251 (7%)

Query: 12  LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYF 71
           L+YP  +++G II+ +V  ETL  QK  Y +L S N+ N +FAY  N +W  LF  +A+ 
Sbjct: 14  LIYPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLFFSLAFL 73

Query: 72  QVW-----------IRIRTQDLLPRDAQIINRQRLQR------LIKQYIVKFVLKYLLLF 114
           Q++           + I + +  P  +  INR  L +      +  QY  KF+LK LLL+
Sbjct: 74  QIYFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQYACKFILKSLLLY 133

Query: 115 ITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL 174
           + F FID +F++TGG+C+ G G  SAEKC+ E G W+GGFDISGHFCFL+N+S+ILW EL
Sbjct: 134 VCFQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNISMILWMEL 193

Query: 175 SILERYLRDEEL--EMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYC 232
            +  ++++ E++       +     ++  IL +W+ +L VTAIYYHT+LEKILGC +GY 
Sbjct: 194 HLFSKFVQAEDMFWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKILGCFMGYI 253

Query: 233 CPLIMYWLIPN 243
           CP+ +Y ++P 
Sbjct: 254 CPIFIYHVLPK 264

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  204 bits (520), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 118/259 (45%), Positives = 163/259 (62%), Gaps = 14/259 (5%)

Query: 7   WPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFG 66
           WPNV L+YP +L +G I++ +V E+  D+ K   Y  +SKN+LN+VFAY GNL+W +LF 
Sbjct: 8   WPNVVLLYPFVLSIGLILHVLVPEQVQDQLKQHVYFFNSKNVLNQVFAYKGNLVWTVLFL 67

Query: 67  MMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFLF 126
            +A    +I+  ++D  P + +   RQ   ++++QY  K +LK  LL++ FL IDG+F+ 
Sbjct: 68  YIAVLSYFIKTMSRD--PLEQRAGGRQVDWQIVRQYCWKLLLKNGLLYLCFLVIDGVFIA 125

Query: 127 TGGQCTYGLG----IWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLR 182
           TGG CT   G    I SAE CK  GG WE GFDISGHFCFLMN+SLILW EL +L+  +R
Sbjct: 126 TGGVCTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQDAIR 185

Query: 183 DEELEMETI--------ITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCP 234
            EEL  E +        + +    +K  LY+W+ +L VTA +YHT  EK++GC  GY CP
Sbjct: 186 REELGEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFGYVCP 245

Query: 235 LIMYWLIPNHYKLNHILYS 253
            +MY LIP   +LN   Y 
Sbjct: 246 FVMYHLIPTSPRLNEFFYG 264

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  201 bits (512), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 162/260 (62%), Gaps = 19/260 (7%)

Query: 12  LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYF 71
           L+YP  + +G +++ +V  ETL+ QK    +L S NI N +FAY  N +W  LF  +A+ 
Sbjct: 14  LIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLFFSLAFL 73

Query: 72  QVWIR-IRTQDLLPRDAQ----------------IINRQRLQRLIKQYIVKFVLKYLLLF 114
           Q++   +   D+LP                    ++  + +  +I QY  KFVLKYLLLF
Sbjct: 74  QIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQYACKFVLKYLLLF 133

Query: 115 ITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL 174
           + F FID +F++TGG+C+ G    SAEKC+ E G W+GGFDISGHFCFL+++S+ILW EL
Sbjct: 134 LNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSISMILWMEL 193

Query: 175 SILERYLRDEEL--EMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYC 232
            +  R+++ E++   +   +     ++  +L +W+ +L VTAIYYHT+LEK+LGCL+G+ 
Sbjct: 194 HLFSRFVQAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVLGCLMGFI 253

Query: 233 CPLIMYWLIPNHYKLNHILY 252
           CP+ +Y ++P    L++ LY
Sbjct: 254 CPVFIYHILPKIGILHNYLY 273

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  197 bits (500), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 161/246 (65%), Gaps = 8/246 (3%)

Query: 13  VYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQ 72
           +YP +++ G  I+ ++ E+ L+R++ E+Y +  +N++N +FAY G  I+ +LFG++   Q
Sbjct: 21  IYPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQ 80

Query: 73  VWIRIRTQD-LLPRDAQIINR------QRLQRLIKQYIVKFVLKYLLLFITFLFIDGLFL 125
           V++R++ ++ LLP      +R      +++ +++K Y +KFVL YL+L+  FLFID LF+
Sbjct: 81  VYVRMKHEESLLPTSNGEQDRNSPDLLKQVGKVLKVYSIKFVLVYLVLWACFLFIDHLFV 140

Query: 126 FTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEE 185
           +TGG C       SAEKC++ GG W GGFDISGHFCFL N+SL LW EL +L +Y     
Sbjct: 141 WTGGNCDLS-DTKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQHT 199

Query: 186 LEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPNHY 245
           +   +  + Y  ++  +L +W+++L +T+IYYHT  EK+LGC  GY C L++Y+++P   
Sbjct: 200 ISWNSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILPRIK 259

Query: 246 KLNHIL 251
            +N  L
Sbjct: 260 HVNKFL 265

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  193 bits (490), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 154/249 (61%), Gaps = 11/249 (4%)

Query: 12  LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYF 71
           LVYP+++  G ++  +   E L+  +  +Y+L+  N++N +F  NGN +W +L+ +MA  
Sbjct: 20  LVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGV 79

Query: 72  QVWIRIRTQDLLPRDAQIINRQRLQR------LIKQYIVKFVLKYLLLFITFLFIDGLFL 125
           Q +IR +  D LP    +      +R      L+KQ+IVK  LK +LL   F  ID +F+
Sbjct: 80  QCYIRTKESDSLPLGGSVPGSSSRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFI 139

Query: 126 FTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEE 185
           +TGG+CT      S+ +C    G W GGFDISGHFCF+ N+SLILWCEL  LE+YL   E
Sbjct: 140 WTGGRCTVS-DTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANE 198

Query: 186 LEMET--IITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN 243
           + +    I   Y +LL   L  W+ +L VTA++YHTLLEK+LG +LGY CP++MY +IP 
Sbjct: 199 IRLRKRLIWIKYMILLA--LVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPY 256

Query: 244 HYKLNHILY 252
           + KL  ILY
Sbjct: 257 YPKLQRILY 265

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  183 bits (465), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 160/267 (59%), Gaps = 26/267 (9%)

Query: 10  VCLVYPTILVLGTIINTIVREETLDRQKH------------EYYILSSKNILNRVFAYNG 57
           VCL YP+I++ G++  ++      +   H            +++++ S +  N++FAYNG
Sbjct: 12  VCL-YPSIMLFGSLTGSLGGYNKSNGNGHNDIDDLPSEPSDKFWLIRSNSWFNQLFAYNG 70

Query: 58  NLIWAMLFGMMAYFQVWIRIRTQDL-LPRDAQIINR-QRLQ-----RLIKQYIVKFVLKY 110
           N ++  LF ++   QV+       L LP + + I+R ++ Q     R+ K+YI K +LKY
Sbjct: 71  NTVFLGLFLIIVSLQVYFSREDARLSLPIEIRTISRIKQFQTKHYLRIAKEYICKLILKY 130

Query: 111 LLLFITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLIL 170
             L++ FLFID LF+ TGG CT G G   A  C++  G W GGFDISGHFCFL+ +SLI+
Sbjct: 131 FFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMICRSGNGEWVGGFDISGHFCFLVTLSLII 190

Query: 171 WCELSILERYLRDEELEMETIITNYSVLL----KCILYLWMSMLCVTAIYYHTLLEKILG 226
           W EL  LE ++R  +L+    +TN  + +      IL LW+ MLCVT++YYHT +EK+LG
Sbjct: 191 WLELFKLEEFIRSRDLKSN--VTNEVIFMVFFIVSILILWIVMLCVTSLYYHTFVEKLLG 248

Query: 227 CLLGYCCPLIMYWLIPNHYKLNHILYS 253
           C++GY CP++MY ++P +      +Y 
Sbjct: 249 CIMGYICPIVMYRVLPRNTIFTRYIYK 275

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  178 bits (452), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 151/249 (60%), Gaps = 8/249 (3%)

Query: 1   MRAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLI 60
           M  Y      C +YP +L+ G +I  I+ EET++  +  +Y+L+  N +N++F ++G L+
Sbjct: 7   MDEYISERRYCYLYPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHHGVLL 66

Query: 61  WAMLFGMMAYFQVWIRIRTQDLLPRDAQ---IINRQRLQRLIK---QYIVKFVLKYLLLF 114
           W +L G++   Q  +R    D LP DA+    + R  L+ L     Q ++K +L   +L 
Sbjct: 67  WTLLMGLVLALQYHVRTTEFDPLPLDARELGPVKRHPLKMLGSMAVQTVIKVLLVVTVLQ 126

Query: 115 ITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL 174
             F F+D LF++TGG+CT       +  C+  GG W GGFDISGHFC +MN+SL+LW EL
Sbjct: 127 ALFWFMDHLFVWTGGRCTVS-DTKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLWLEL 185

Query: 175 SILERYLRDEELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCP 234
           + L+RY+  +E+++       + +L   L +W+++L +TAIYYHT +EK+LG + GY   
Sbjct: 186 TELQRYMHSQEIQLRKFAWARTTVLGA-LGVWLALLAITAIYYHTFVEKLLGTIFGYSTS 244

Query: 235 LIMYWLIPN 243
           L++Y+++P 
Sbjct: 245 LVIYYVLPR 253

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 70/153 (45%), Gaps = 22/153 (14%)

Query: 113 LFITFLFIDGLFLFTGGQCTYGLGIWSAE----KCKNEGGHWEGGFDISGHFCFLMNVSL 168
           +F     +D +F++TGG+C  G            CK  GG+W  G D SGH   L  ++ 
Sbjct: 85  MFSNHAIMDLIFVWTGGKCDGGSTSSKLLKSSKHCKKIGGNWINGHDPSGHIFLLSIMTT 144

Query: 169 ILWCELSILERY----LR----------DEELEMETI--ITNYSV--LLKCILYLWMSML 210
            +  E S + R     LR          D +L ++ I  I+N  V  +L  IL  W S++
Sbjct: 145 FMINEFSKIRRVSMTQLRQDFVETDWNLDRQLPVKIILFISNNPVIIMLSFILLWWHSLV 204

Query: 211 CVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN 243
             +  YYHTL E++ G L  Y     +Y  +P+
Sbjct: 205 ITSINYYHTLSEQLSGLLFAYIIMGPLYLFLPS 237

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEELEMETIITNYSVL 198
           ++ +C+  GGHW GG D SGH      + + L  EL +  R        +  +      L
Sbjct: 213 TSAQCRRFGGHWAGGHDPSGHVFLTTLMCMFLLGELRVFGRR------ALAHLYAQKWHL 266

Query: 199 LKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMY 238
           L  + +LW  +L   A ++HT+ E I G L  Y    ++Y
Sbjct: 267 LGMVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

 Score = 32.3 bits (72), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 56/134 (41%), Gaps = 21/134 (15%)

Query: 6   KWPNVC--LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAM 63
           KW N    LV P  ++LG +IN       L         L+   ++N VF   G   W  
Sbjct: 5   KWFNAVHLLVCPVTVLLGYLINAYGYGTALQA------TLNKDGLVNAVFVKKG-WFWTS 57

Query: 64  LFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLL----FITFLF 119
           L G       W  IR + +     +   R+R+ + +K+Y +  V  Y+      F     
Sbjct: 58  LVGW------WCIIRYRAVPGATGR--GRRRIAQSLKRYTILTVWWYVFTQGIWFGVGPI 109

Query: 120 IDGLFLFTGGQCTY 133
           +D +F++TGG C Y
Sbjct: 110 MDLVFVYTGGHCHY 123

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 84/209 (40%), Gaps = 33/209 (15%)

Query: 42  ILSSKN-ILNRVFAYNGNLIWAMLFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIK 100
           + S+K+ +LN VF   G       +    ++ V +R R +D       +  R  L  L++
Sbjct: 36  VASTKDSLLNTVFVKRG-----WFWTSTVFWWVVVRYRMED------SVTTRTPLLPLLR 84

Query: 101 QYIVKFVLKYLLLFITFL----FIDGLFLFTGGQC-----TYGLGIW--SAEKCKNEGGH 149
           +Y +     Y+     +L     +D +F+++GG C     T    +W  ++  C+  GG 
Sbjct: 85  RYTITTAAWYVFTQQLWLNVPPLMDLVFVWSGGSCLLDPATTPGTLWLSTSAACRRHGGL 144

Query: 150 WEGGFDISGHFCFLMNVSLILWCELSILERYLRDEELEMET----------IITNYSVLL 199
           W+GG D SGH   L  + + L  EL       R                  +     VL 
Sbjct: 145 WQGGHDPSGHMFLLSLMLMFLLSELPAGSSGGRRRGKHAAFASAAAAARFILWDEPGVLA 204

Query: 200 KCILYLWMSMLCVTAIYYHTLLEKILGCL 228
             +   W   L VTA  +HTL E+  G L
Sbjct: 205 LALTACWTWALLVTAARFHTLPEQTSGLL 233

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 140 AEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILER-------YLRDEELEMETII 192
           + KCK  GGHW GG D SGH   L  + +++  EL  + R       Y +D ++    I+
Sbjct: 222 SSKCKRNGGHWVGGHDPSGHIFLLTLMMMMIIAELPKINRIRKQNMIYQKDSKIRRVNIV 281

Query: 193 TNYSVLLKCIL 203
              S ++  I+
Sbjct: 282 EKISKIIGEII 292

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 196 SVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLI 241
           +VLL  +L +W     +T I +HT  E++ G L  Y   +I+Y L+
Sbjct: 344 AVLLISLLGMWCYSFLITIIVFHTFYEQVTGFLSAYIVAVIIYRLV 389

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 12/93 (12%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEELEMETIITNYSVL 198
           S++KC+  GG W GG D SGH  FL+ + ++ +  +SI     +D  L +  I   + ++
Sbjct: 236 SSQKCRKIGGAWSGGHDPSGHM-FLLTLMIMTFLTISI----SKDNYLFVRLIAAMFGLM 290

Query: 199 LKCILYLWMSMLCVTAIYYHTLLEKILGCLLGY 231
                Y +M    VT   +HT  E+I G +  Y
Sbjct: 291 SS---YSFM----VTIFNFHTFAEQITGFMAAY 316

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 17/21 (80%)

Query: 139 SAEKCKNEGGHWEGGFDISGH 159
           S++KCK+ GGHW GG D SGH
Sbjct: 266 SSQKCKSLGGHWSGGHDPSGH 286

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 194 NYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLI 241
           N  +LL  ++++W     VT I +HT+ E++ G +  Y    ++YW +
Sbjct: 381 NPIILLVSLVFVWWWNFLVTTIVFHTISEQLSGLICAYVVAGLVYWKV 428

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 59/159 (37%), Gaps = 58/159 (36%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSIL-ERYLR----DEELEME---- 189
           S+  C++ GG+W GG D SGH   +  + + L  EL +L +R LR    D +   E    
Sbjct: 202 SSNLCRSLGGNWVGGHDPSGHIFLITLMCMFLLGELQVLGKRALRVLRSDRKFWQEVSSC 261

Query: 190 -----------TIITNYSV--------------------------------------LLK 200
                      ++I+N ++                                      LL 
Sbjct: 262 FVEIAKLGGIRSVISNSAIDKKEVIRQLGQMPLFFAKQLLALAGATLKFVVWRNPVILLV 321

Query: 201 CILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYW 239
              +LW   L +T I +HTL E++ G L  Y     +YW
Sbjct: 322 LFTFLWWWSLLITTIAFHTLWEQLSGLLCAYVVAGFVYW 360

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 55/135 (40%), Gaps = 38/135 (28%)

Query: 143 CKNEGGHWEGGFDISGHFCFLMNVSLILWCE-----LSILERYLRDEELEMETI------ 191
           C+  GG+W+GG D SGH   L  + L L  E     +  + R +   +  M+ I      
Sbjct: 235 CRLNGGYWQGGHDPSGHIFLLTLMILFLVGESKQFIVGAVMRVVDTRKYVMDKIKKICNE 294

Query: 192 -ITNYSV-------LLKCILY-------------------LWMSMLCVTAIYYHTLLEKI 224
            + N SV       L++C+ +                   +W+    +T I +HTL E++
Sbjct: 295 PMANASVYERRVRKLMRCLSFSASYILWENPVILLLLLLAIWVWNFVITVIVFHTLTEQL 354

Query: 225 LGCLLGYCCPLIMYW 239
            G    Y    ++Y+
Sbjct: 355 SGLFFAYVVGALLYY 369

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 53/157 (33%), Gaps = 56/157 (35%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSIL-----ERYLRDEELEMETIIT 193
           S+  C+  GG+W GG D SGH   +  + + L  EL I       R LR++ +  +  I 
Sbjct: 201 SSAVCRTLGGYWVGGHDPSGHIFLITLMIMYLLGELHIFGKRAFSRILREKNMSFKPFID 260

Query: 194 ---------------------------------------------------NYSVLLKCI 202
                                                              N  +LL  +
Sbjct: 261 LFDNGAIWNVLSKKPETYSQLFFMTVVQPPLTFANSFTVFSLQLIKFVVLENPVILLVGL 320

Query: 203 LYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYW 239
             +W     VT++ +HTL E++ G    Y    ++YW
Sbjct: 321 FLMWWWSFLVTSVVFHTLSEQVSGLAFAYLVAGVIYW 357

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 140 AEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELS--ILERYLRDE-ELEMET 190
           +  C+  GGHW GG D SGH   L  + +++  E+   I  +YLR    +E E+
Sbjct: 230 SSNCRAHGGHWVGGHDPSGHMFILTLMIMLISSEIPRIIKFKYLRSNGRIEDES 283

>YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protein
           required for inositol prototrophy, identified as an
           ortholog of the FIT family of proteins involved in
           triglyceride droplet biosynthesis; disputed role in the
           synthesis of inositol phospholipids from inositol
          Length = 380

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILER 179
           ++ +C+  GGHW GG D SGH      + + L  EL +  R
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELRVFGR 255

>Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa]
           {ON} YGL126W (REAL)
          Length = 380

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILER 179
           ++ +C+  GGHW GG D SGH      + + L  EL +  R
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELRVFGR 255

>KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q75EB2 Ashbya gossypii AAR165W AAR165Wp and
           weakly similar to YGL126W uniprot|P53012 Saccharomyces
           cerevisiae SCS3 Protein required for inositol
           prototrophy
          Length = 337

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILER 179
           S+  C   GGHW GG D SGH   +  + ++++ ELS+ + 
Sbjct: 174 SSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGELSLYQS 214

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 35.4 bits (80), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 30/72 (41%), Gaps = 17/72 (23%)

Query: 125 LFTGGQC-TYGL----------------GIWSAEKCKNEGGHWEGGFDISGHFCFLMNVS 167
           + TGGQC   GL                 I S+  C   GGHW GG D SGH   +  + 
Sbjct: 171 MLTGGQCENTGLDPTELNSYIQDSVTASAIRSSHACSRLGGHWMGGHDPSGHVFLITLMC 230

Query: 168 LILWCELSILER 179
           + +  EL +  R
Sbjct: 231 MFMLGELQVFGR 242

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 191 IITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLI 241
           ++ N  +LL  ++  W   L VT + +H+  E + G L  Y   L +YW I
Sbjct: 312 VLENPILLLVGLILTWTWSLLVTILSFHSFAEHLTGLLFAYLLVLALYWYI 362

>Smik_10.368 Chr10 (567777..569090) [1314 bp, 437 aa] {ON} YJR078W
           (REAL)
          Length = 437

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 4   YFKWPNVCLVYPTILVLGTIINTIVRE-ETLDRQKHEYYILSSKNILNRVFAYNGNLIWA 62
           Y KW  +    P++L  G+ + T++ E E LD       IL     L R ++        
Sbjct: 33  YMKWEEIVAKLPSLLQEGSKVRTVIDELEVLDLDDS---ILGEVRELRRAYS-------- 81

Query: 63  MLFGMMAYFQVWIRIRTQDLLPR 85
            + G MA+  +W     QD+LP 
Sbjct: 82  -ILGFMAHAYIWASGTPQDVLPE 103

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 137 IWSAEKCKNEGGHWEGGFDISGH 159
           I ++  C+  GGHW+GG D SGH
Sbjct: 202 ISTSAACRATGGHWKGGHDPSGH 224

>TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.804
           YMR253C
          Length = 314

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 6   KWPNVCLVYPTILVLGTIINTIVREETLDRQKHEY 40
           KWPNV  +   IL++G+ I  I  +E L  ++ EY
Sbjct: 273 KWPNVFSIIGMILIIGSTITVIKMKEKLSERQSEY 307

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 194 NYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYW 239
           N  VLL    +LW   L +T I +HTL E++ G L  Y     +YW
Sbjct: 315 NPVVLLVLFTFLWWWSLLITTIAFHTLWEQLSGLLCAYIVAGFVYW 360

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL-SILERYLR 182
           S+  C++ GG+W GG D SGH   +  + + L  EL +I +R LR
Sbjct: 202 SSNLCRSMGGYWIGGHDPSGHIFLITLMCMFLLGELQAIGKRALR 246

>NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.117
           YGL126W
          Length = 381

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 56/161 (34%), Gaps = 61/161 (37%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILE-------------------- 178
           ++ +C+  GG+W  G D SGH   L  + + L  ELS                       
Sbjct: 220 TSAQCRMHGGYWTKGHDPSGHIFLLTLMVMFLSGELSTFAPRAFKVLFQRKKIFHLVEYV 279

Query: 179 ------------RYLRDEELEMETIITNYSVLLKCILYL--------------------- 205
                         +RDEE +   +I + +V+L+ I+ L                     
Sbjct: 280 TKLFDNGLLWDVAKMRDEERKNWKVILHRAVVLQPIICLRDLSRLLFATVKFIIWDNPVI 339

Query: 206 --------WMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMY 238
                   W+    +T + +HT+ E++ G L  Y   L +Y
Sbjct: 340 VLIALIMTWLWSFVITILAFHTVWEQLSGFLFAYLVALAVY 380

>NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {ON}
           Anc_6.117 YGL126W
          Length = 390

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 194 NYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYW 239
           N  +LL  +L +W+    +T + +HT+ E++ G    Y    I+YW
Sbjct: 342 NPIILLITLLVVWLWSFLITTLVFHTVSEQLSGLFFAYMVAGILYW 387

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 21/36 (58%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL 174
           ++  C++ GG+W  G D SGH   +  +++ +  EL
Sbjct: 226 TSAMCRSHGGYWTMGHDPSGHIFLITLMTMFILGEL 261

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 139 SAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILE 178
           + + C+  GG+W GG D SGH   +  +++ L  EL +  
Sbjct: 204 NGQMCRKLGGYWTGGHDPSGHVFLITLMTMFLIGELRLFS 243

>SAKL0C11330g Chr3 complement(1015136..1022605) [7470 bp, 2489 aa]
            {ON} similar to uniprot|P35194 Saccharomyces cerevisiae
            YBL004W UTP20 Possible snoRNA-binding protein based on
            computational analysis of large-scale protein-protein
            interaction data
          Length = 2489

 Score = 31.2 bits (69), Expect = 3.0,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 32/62 (51%), Gaps = 6/62 (9%)

Query: 41   YILSSKNILNRVFAYNGNLIWAMLFGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIK 100
            YI  S+N+  + F+      W+ + G + Y   W+R+    L+  +A + N ++L++ + 
Sbjct: 2217 YITKSENVYEKAFSST----WSKIVGCLLYPHAWVRMSAARLV--NALVSNLRKLEKPLT 2270

Query: 101  QY 102
             Y
Sbjct: 2271 DY 2272

>Kpol_1002.35 s1002 complement(106680..108041) [1362 bp, 453 aa]
           {ON} complement(106680..108041) [1362 nt, 454 aa]
          Length = 453

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 162 FLMNVSLILWCELSILERYLRDEELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLL 221
           F+  V + LW  LSI+E+Y+        TII+ Y   LK +   W ++   T  + + L+
Sbjct: 400 FVNRVEIELWKNLSIIEKYI--------TIISKYRNELKPVEQKWKNLTLSTEHFDYLLV 451

Query: 222 E 222
           +
Sbjct: 452 D 452

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.147    0.488 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,371,683
Number of extensions: 1128271
Number of successful extensions: 3738
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3816
Number of HSP's successfully gapped: 60
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 64 (29.3 bits)