Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F023005.251ON47447420780.0
CAGL0E06490g5.251ON47247420040.0
Kpol_1032.875.251ON46447419930.0
TPHA0B025505.251ON46347419900.0
SAKL0G11484g5.251ON45647419890.0
Skud_11.825.251ON46847419890.0
TDEL0E037505.251ON47147419830.0
ACR050C5.251ON47547419790.0
YKL145W (RPT1)5.251ON46747419780.0
Smik_11.915.251ON46847419770.0
TBLA0C030405.251ON46847419740.0
Suva_11.805.251ON47147419730.0
ZYRO0A10560g5.251ON46847419700.0
KLTH0G07524g5.251ON44547419650.0
KAFR0H036305.251ON44847419650.0
Ecym_82505.251ON45647419550.0
KNAG0H023005.251ON47747719510.0
KLLA0E13773g5.251ON47547819210.0
Kwal_23.28495.251ON40943218420.0
NDAI0C037805.251ON38538816770.0
Suva_7.2274.57ON4053097861e-100
KLLA0A04752g4.57ON4043097851e-100
Skud_7.2364.57ON4053097831e-99
Smik_7.2354.57ON4053097831e-99
YGL048C (RPT6)4.57ON4053097831e-99
Kwal_26.74744.57ON4053017771e-98
KLTH0D03806g4.57ON4053017752e-98
SAKL0H23672g4.57ON4083017727e-98
AGL043C4.57ON4053017711e-97
ZYRO0G22330g4.57ON4053097711e-97
CAGL0D06292g4.57ON4003117692e-97
Kpol_1041.424.57ON4033017683e-97
NCAS0A058804.57ON4073107665e-97
TDEL0E056604.57ON4063007632e-96
KAFR0F031004.57ON4053107622e-96
TBLA0B098804.57ON4013017612e-96
KNAG0D032004.57ON4003147612e-96
NDAI0D028504.57ON4053107613e-96
TPHA0F004404.57ON4033017596e-96
KLLA0C09592g8.708ON4343077209e-90
Skud_15.4258.708ON4373227201e-89
SAKL0H05764g8.708ON4213077181e-89
Smik_15.4428.708ON4373227182e-89
KLTH0D11990g8.708ON4333077163e-89
Suva_8.3088.708ON4373227155e-89
YOR259C (RPT4)8.708ON4373227131e-88
KNAG0G027208.708ON4443227122e-88
Kwal_26.89128.708ON4343077103e-88
NCAS0B011508.708ON4263227093e-88
AAL113W8.708ON4323077085e-88
Ecym_23658.708ON4273077085e-88
CAGL0K08910g8.708ON4363227077e-88
NCAS0A101803.216ON4372977078e-88
TDEL0A065308.708ON4353227052e-87
KAFR0A040108.708ON4243227024e-87
NDAI0E010208.708ON4433227026e-87
Kpol_1064.228.708ON4323207007e-87
NDAI0A072903.216ON3762816958e-87
TPHA0H017705.251ON4343087009e-87
YDL007W (RPT2)3.216ON4372847001e-86
NCAS0F033305.428ON4343086991e-86
TDEL0D040603.216ON4372977001e-86
KAFR0F024403.216ON4362846991e-86
Smik_4.2293.216ON4372846991e-86
TBLA0D012408.708ON4433206992e-86
Suva_4.2463.216ON4372846982e-86
KNAG0K015303.216ON4352606982e-86
ZYRO0A04224g3.216ON4372846973e-86
Kpol_1010.743.216ON4372846963e-86
Kwal_27.110323.216ON3763106905e-86
KLLA0E21209g5.428ON4323086955e-86
KNAG0C049605.428ON4233086946e-86
SAKL0C11440g3.216ON4363106947e-86
ZYRO0F11946g8.708ON4443226958e-86
Ecym_55275.428ON4323086939e-86
CAGL0A02750g5.428ON4293086939e-86
Smik_15.2955.428ON4343086931e-85
CAGL0I04884g3.216ON4332846931e-85
Suva_8.1705.428ON4343086931e-85
YOR117W (RPT5)5.428ON4343086931e-85
Skud_4.2473.216ON4372846921e-85
TPHA0D014708.708ON4553206942e-85
Ecym_52863.216ON4372976922e-85
TPHA0A042703.216ON4372846922e-85
KAFR0E038905.428ON4343086922e-85
SAKL0G02376g5.428ON4343086912e-85
Kpol_1062.335.428ON4343086902e-85
Skud_15.2805.428ON4343086903e-85
TBLA0F006903.216ON4342846903e-85
AEL011W3.216ON4372976894e-85
TDEL0E019705.428ON4343086894e-85
KLTH0F16214g5.428ON4343086886e-85
TBLA0A037405.428ON4343086861e-84
NDAI0B056205.428ON4823086901e-84
Kwal_55.214535.428ON4343086861e-84
KLTH0G16698g3.216ON4552976862e-84
KLLA0F14707g3.216ON4342606833e-84
AER254W5.428ON4603086844e-84
ZYRO0F09900g5.428ON4343086824e-84
Kpol_543.175.486ON4282766511e-79
ZYRO0D11528g5.486ON4532906497e-79
KLLA0C06534g5.486ON4282636451e-78
NCAS0A119805.486ON4262776451e-78
NDAI0A042905.486ON4262916441e-78
Ecym_45485.486ON4252626423e-78
Smik_4.6685.486ON4282776424e-78
TPHA0J028605.486ON4312616424e-78
YDR394W (RPT3)5.486ON4282776414e-78
AFR394W5.486ON4722596445e-78
Skud_4.6685.486ON4282776415e-78
KAFR0E035805.486ON4252776407e-78
CAGL0K09526g5.486ON4312616408e-78
TBLA0D018605.486ON4292776399e-78
SAKL0G03828g5.486ON4252636381e-77
Suva_2.5715.486ON4282776381e-77
KNAG0C045905.486ON4322946372e-77
TDEL0A035005.486ON4262776171e-74
KLTH0G02662g5.486ON4252626129e-74
Kpol_1020.97.288ON8122315308e-59
TBLA0J006407.288ON8522315311e-58
TDEL0H015607.288ON8382315292e-58
NCAS0E035807.288ON6012315182e-58
TBLA0C048407.288ON8472315264e-58
Kpol_2000.157.288ON8232315254e-58
KLLA0F05676g7.288ON8302315256e-58
SAKL0F09834g7.288ON8422315256e-58
KLTH0A05324g7.288ON8322315247e-58
NCAS0A137607.288ON8252315238e-58
KNAG0B029407.288ON8382315249e-58
NDAI0A030407.288ON8422315231e-57
NDAI0A022807.288ON8252315221e-57
Smik_4.1117.288ON8352315222e-57
Kwal_23.59967.288ON8312315212e-57
Ecym_80377.288ON8362315203e-57
KAFR0L011907.288ON8242315193e-57
Skud_4.1297.288ON8352315193e-57
CAGL0J09350g7.288ON8302315193e-57
Suva_4.1197.288ON8362315193e-57
YDL126C (CDC48)7.288ON8352315194e-57
AFR158W7.288ON8322315194e-57
ZYRO0C09262g7.288ON8302315184e-57
TPHA0A032607.288ON8262315161e-56
NCAS0E040505.34ON13292814998e-54
Kwal_47.18848singletonOFF3021564562e-52
ZYRO0D07414g5.34ON14202694846e-52
TPHA0L022105.34ON14002704847e-52
TDEL0G005905.34ON12942344821e-51
KAFR0D019005.34ON12612364821e-51
KLTH0B09130g5.34ON13332794812e-51
NDAI0B007805.34ON13482794812e-51
CAGL0G00528g5.34ON13172714812e-51
Kpol_513.195.34ON13772704793e-51
KLLA0A09823g5.34ON13192714793e-51
TBLA0C068505.34ON14262704784e-51
Kpol_483.204.259ON7832614701e-50
ABR139W5.34ON12702684741e-50
Ecym_74002.472ON8042574702e-50
TDEL0A024802.472ON8162574692e-50
TBLA0I011902.472ON8352654702e-50
ZYRO0D15290g7.168ON7272644662e-50
Kpol_401.37.168ON7862644683e-50
KNAG0K002805.34ON14082704723e-50
Kwal_23.42535.34ON13292794723e-50
KAFR0A058904.259ON7722824673e-50
KLTH0F13904g7.168ON7392634663e-50
Ecym_12587.168ON7472644663e-50
SAKL0H01276g5.34ON13372364713e-50
Ecym_47695.34ON13392364714e-50
Smik_16.385.34ON13892344688e-50
KNAG0L010607.168ON7132614611e-49
Skud_7.6035.34ON13862344671e-49
Kwal_26.77492.472ON8142574631e-49
Suva_13.2662.472ON8232574631e-49
KLTH0D05412g2.472ON8132574613e-49
AAR025C7.168ON7262644583e-49
NCAS0J015504.259ON7722844594e-49
Suva_7.5665.34ON13982364634e-49
CAGL0C02585g4.259ON7712724584e-49
YMR089C (YTA12)2.472ON8252574595e-49
Smik_13.2732.472ON8272574595e-49
Skud_13.2452.472ON8242574596e-49
Kpol_467.232.472ON8592574597e-49
YGR270W (YTA7)5.34ON13792344617e-49
Klac_YGOB_Anc_7.168b7.168ON7792634569e-49
KNAG0B061604.259ON7722674569e-49
KLLA0B03234g4.259ON8042454561e-48
KAFR0A007402.472ON7842574561e-48
ABL041W2.472ON8182564552e-48
SAKL0H02750g4.259ON7763094542e-48
KLLA0F13706g2.472ON8422574552e-48
CAGL0J01353g2.472ON8272554552e-48
TPHA0B007304.259ON7763114532e-48
TBLA0D044907.168ON7822634532e-48
CAGL0H09416g7.168ON7502644522e-48
TPHA0C015207.168ON7842644533e-48
TPHA0G031302.472ON7922664533e-48
NCAS0E020207.168ON7732644514e-48
NCAS0A078202.472ON7912574524e-48
NDAI0E035807.168ON7822644515e-48
KLTH0D14586g4.259ON7742694506e-48
SAKL0F03894g7.168ON7422634496e-48
KNAG0C033207.430ON7662544497e-48
SAKL0E03014g2.472ON8302574518e-48
NDAI0H022102.472ON8032574491e-47
KAFR0K020607.430ON7262544461e-47
NCAS0A146407.430ON7502544472e-47
KAFR0G028007.168ON7832644472e-47
TDEL0H027707.168ON7442644462e-47
KNAG0E025502.472ON8452574472e-47
ZYRO0G03212g2.472ON8302554472e-47
NDAI0J023204.259ON7782424463e-47
KLLA0E06711g7.430ON7692544453e-47
Suva_5.1097.168ON7612594453e-47
Kwal_23.41944.259ON7742824453e-47
ZYRO0F13024g7.430ON7402544443e-47
YLR397C (AFG2)4.259ON7802964454e-47
YLL034C (RIX7)4.23ON8372574438e-47
SAKL0H25630g4.23ON8302584421e-46
Skud_12.334.23ON8372574411e-46
TDEL0E011104.259ON7782674401e-46
Suva_10.5144.259ON7802964401e-46
Smik_12.224.23ON8372574412e-46
TDEL0C029307.430ON7402544392e-46
Suva_10.384.23ON8372574402e-46
NDAI0A013907.430ON7122554372e-46
Smik_5.1387.168ON7602594392e-46
Smik_12.4844.259ON7802324392e-46
TBLA0F014707.430ON8022544392e-46
Skud_5.1217.168ON7622594383e-46
ZYRO0G08008g4.23ON8262484383e-46
SAKL0F13376g7.430ON7412544364e-46
NCAS0A029404.23ON8572884384e-46
AGL274W7.430ON7322544364e-46
KNAG0E010404.23ON7852574374e-46
KLLA0E00837g4.23ON8142574375e-46
Ecym_62184.23ON8382574375e-46
CAGL0D02838g4.23ON8342574375e-46
KLTH0C05742g7.430ON7442544355e-46
YER017C (AFG3)7.168ON7612594357e-46
Suva_16.3517.430ON7472544331e-45
TBLA0A063804.259ON8082844341e-45
CAGL0K05093g7.430ON7452544331e-45
YPR024W (YME1)7.430ON7472544331e-45
Smik_16.2657.430ON7472544321e-45
Skud_12.4824.259ON7772714331e-45
KAFR0L002604.23ON7942574322e-45
ZYRO0B12606g4.259ON7772694312e-45
Skud_16.3097.430ON7472544302e-45
NDAI0E039607.430ON7772754295e-45
TBLA0E014504.23ON8612574305e-45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F02300
         (474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {O...   805   0.0  
CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly...   776   0.0  
Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa] ...   772   0.0  
TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.2...   771   0.0  
SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 ...   770   0.0  
Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W...   770   0.0  
TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.2...   768   0.0  
ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON} S...   766   0.0  
YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One o...   766   0.0  
Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W...   766   0.0  
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...   764   0.0  
Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W...   764   0.0  
ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly...   763   0.0  
KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 ...   761   0.0  
KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.2...   761   0.0  
Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar t...   757   0.0  
KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.2...   756   0.0  
KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]...   744   0.0  
Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W (...   714   0.0  
NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {O...   650   0.0  
Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON...   307   e-100
KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {...   306   e-100
Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON...   306   1e-99
Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON...   306   1e-99
YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}  ...   306   1e-99
Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {O...   303   1e-98
KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {...   303   2e-98
SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} high...   301   7e-98
AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON} S...   301   1e-97
ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]...   301   1e-97
CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly...   300   2e-97
Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON} (1108...   300   3e-97
NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa] ...   299   5e-97
TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa] ...   298   2e-96
KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {O...   298   2e-96
TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4...   297   2e-96
KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {O...   297   2e-96
NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57     297   3e-96
TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {O...   296   6e-96
KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly...   281   9e-90
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...   281   1e-89
SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly...   281   1e-89
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...   281   2e-89
KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {...   280   3e-89
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...   280   5e-89
YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON} ...   279   1e-88
KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {O...   278   2e-88
Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa] ...   278   3e-88
NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708    277   3e-88
AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic ho...   277   5e-88
Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar t...   277   5e-88
CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highl...   276   7e-88
NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa] ...   276   8e-88
TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa] ...   276   2e-87
KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {O...   275   4e-87
NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708    275   6e-87
Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {O...   274   7e-87
NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON} Anc_3...   272   8e-87
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...   274   9e-87
YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of...   274   1e-86
NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428    273   1e-86
TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.2...   274   1e-86
KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.2...   273   1e-86
Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W ...   273   1e-86
TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.7...   273   2e-86
Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W ...   273   2e-86
KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {...   273   2e-86
ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly...   273   3e-86
Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa] ...   272   3e-86
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...   270   5e-86
KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]...   272   5e-86
KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {O...   271   6e-86
SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736) ...   271   7e-86
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...   272   8e-86
Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar...   271   9e-86
CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly...   271   9e-86
Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117...   271   1e-85
CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly...   271   1e-85
Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W ...   271   1e-85
YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One o...   271   1e-85
Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W ...   271   1e-85
TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {O...   271   2e-85
Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar t...   271   2e-85
TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.2...   271   2e-85
KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.4...   271   2e-85
SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly...   270   2e-85
Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {O...   270   2e-85
Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117...   270   3e-85
TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.2...   270   3e-85
AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic ho...   270   4e-85
TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {O...   270   4e-85
KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]...   269   6e-85
TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.4...   268   1e-84
NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON} Anc_5...   270   1e-84
Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {...   268   1e-84
KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085) ...   268   2e-84
KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} high...   267   3e-84
AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic ...   268   4e-84
ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly...   267   4e-84
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...   255   1e-79
ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly...   254   7e-79
KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly...   253   1e-78
NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON} Anc_5...   253   1e-78
NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {O...   252   1e-78
Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {O...   251   3e-78
Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394...   251   4e-78
TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5....   251   4e-78
YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One ...   251   4e-78
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...   252   5e-78
Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394...   251   5e-78
KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {O...   251   7e-78
CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highl...   251   8e-78
TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {O...   250   9e-78
SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly...   250   1e-77
Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394...   250   1e-77
KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {O...   249   2e-77
TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.4...   242   1e-74
KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly...   240   9e-74
Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON...   208   8e-59
TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7....   209   1e-58
TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {O...   208   2e-58
NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288    204   2e-58
TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON} Anc_7...   207   4e-58
Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {O...   206   4e-58
KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {...   206   6e-58
SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly...   206   6e-58
KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly...   206   7e-58
NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON}            206   8e-58
KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {O...   206   9e-58
NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {O...   206   1e-57
NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {O...   205   1e-57
Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON...   205   2e-57
Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL12...   205   2e-57
Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to ...   204   3e-57
KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7....   204   3e-57
Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON...   204   3e-57
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...   204   3e-57
Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON...   204   3e-57
YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}  ...   204   4e-57
AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic ho...   204   4e-57
ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly...   204   4e-57
TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {O...   203   1e-56
NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34    196   8e-54
Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {O...   180   2e-52
ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa] ...   191   6e-52
TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5...   191   7e-52
TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {...   190   1e-51
KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {...   190   1e-51
KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} simil...   189   2e-51
NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {...   189   2e-51
CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {O...   189   2e-51
Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON} (53678.....   189   3e-51
KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} simil...   189   3e-51
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...   188   4e-51
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...   185   1e-50
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...   187   1e-50
Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}...   185   2e-50
TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.4...   185   2e-50
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...   185   2e-50
ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]...   184   2e-50
Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON} co...   184   3e-50
KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {O...   186   3e-50
Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {...   186   3e-50
KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON} Anc_4...   184   3e-50
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...   184   3e-50
Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar t...   184   3e-50
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...   186   3e-50
Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {...   186   4e-50
Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON...   184   8e-50
KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {...   182   1e-49
Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR27...   184   1e-49
Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C...   182   1e-49
Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {...   182   1e-49
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...   182   3e-49
AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON} S...   181   3e-49
NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {...   181   4e-49
Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W...   182   4e-49
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...   181   4e-49
YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON} ...   181   5e-49
Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {...   181   5e-49
Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {...   181   6e-49
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...   181   7e-49
YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}  YTA7Pro...   182   7e-49
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...   180   9e-49
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...   180   9e-49
KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} simila...   180   1e-48
KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.4...   180   1e-48
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...   179   2e-48
SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly...   179   2e-48
KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]...   179   2e-48
CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} simil...   179   2e-48
TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.2...   179   2e-48
TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa] ...   179   2e-48
CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly...   178   2e-48
TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.1...   179   3e-48
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...   179   3e-48
NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168    178   4e-48
NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa] ...   178   4e-48
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168    178   5e-48
KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]...   177   6e-48
SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} simila...   177   6e-48
KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {O...   177   7e-48
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...   178   8e-48
NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {O...   177   1e-47
KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7....   176   1e-47
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...   176   2e-47
KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {O...   176   2e-47
TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.1...   176   2e-47
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...   176   2e-47
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...   176   2e-47
NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {...   176   3e-47
KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {...   176   3e-47
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...   176   3e-47
Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C...   176   3e-47
ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} simi...   175   3e-47
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...   176   4e-47
YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}  R...   175   8e-47
SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} high...   174   1e-46
Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}...   174   1e-46
TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.2...   174   1e-46
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...   174   1e-46
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...   174   2e-46
TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.4...   173   2e-46
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...   174   2e-46
NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {O...   172   2e-46
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...   173   2e-46
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...   173   2e-46
TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.4...   173   2e-46
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...   173   3e-46
ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {...   173   3e-46
SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} high...   172   4e-46
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23     173   4e-46
AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic ho...   172   4e-46
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...   172   4e-46
KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON...   172   5e-46
Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}...   172   5e-46
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...   172   5e-46
KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {...   172   5e-46
YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}  ...   172   7e-46
Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024...   171   1e-45
TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON} Anc_4...   171   1e-45
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...   171   1e-45
YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}  YME1Catal...   171   1e-45
Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024...   171   1e-45
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...   171   1e-45
KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23...   171   2e-45
ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]...   170   2e-45
Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024...   170   2e-45
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...   169   5e-45
TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {O...   170   5e-45
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...   169   7e-45
Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {O...   168   8e-45
TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {O...   169   9e-45
Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}...   168   1e-44
Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {O...   168   1e-44
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....   168   2e-44
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...   167   3e-44
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...   167   4e-44
AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic ho...   167   4e-44
Kwal_55.20644 s55 complement(502435..504876) [2442 bp, 813 aa] {...   165   2e-43
NCAS0E01270 Chr5 complement(243168..246005) [2838 bp, 945 aa] {O...   166   2e-43
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...   164   9e-43
TBLA0I00550 Chr9 (96744..99863) [3120 bp, 1039 aa] {ON} Anc_3.9 ...   163   1e-42
NDAI0G01370 Chr7 (306715..309921) [3207 bp, 1068 aa] {ON} Anc_3.9     161   7e-42
Kwal_55.22137 s55 (1127242..1130358) [3117 bp, 1038 aa] {ON} YNL...   160   1e-41
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...   156   2e-41
KLTH0F19646g Chr6 (1592186..1595320) [3135 bp, 1044 aa] {ON} sim...   159   4e-41
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...   158   8e-41
Smik_14.3 Chr14 complement(3964..7053) [3090 bp, 1029 aa] {ON} Y...   157   1e-40
AER065C Chr5 complement(753980..756304) [2325 bp, 774 aa] {ON} S...   156   2e-40
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...   156   3e-40
KLLA0E02003g Chr5 complement(187814..190816) [3003 bp, 1000 aa] ...   156   3e-40
TDEL0A00280 Chr1 complement(46558..49620) [3063 bp, 1020 aa] {ON...   156   4e-40
Suva_14.12 Chr14 complement(14684..17773) [3090 bp, 1029 aa] {ON...   155   4e-40
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...   155   6e-40
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...   155   7e-40
AGR394W Chr7 (1452410..1455475) [3066 bp, 1021 aa] {ON} Syntenic...   153   3e-39
Kpol_1014.31 s1014 (54948..58082) [3135 bp, 1044 aa] {ON} (54948...   153   4e-39
TPHA0P01580 Chr16 (324418..327516) [3099 bp, 1032 aa] {ON} Anc_3...   152   5e-39
ZYRO0C03476g Chr3 (274719..277805) [3087 bp, 1028 aa] {ON} simil...   151   1e-38
Ecym_3259 Chr3 (495875..498199) [2325 bp, 774 aa] {ON} similar t...   150   2e-38
KLLA0B06094g Chr2 complement(541408..542490) [1083 bp, 360 aa] {...   144   2e-38
ZYRO0G04510g Chr7 complement(363004..366159) [3156 bp, 1051 aa] ...   146   6e-37
SAKL0C13684g Chr3 (1204367..1207471) [3105 bp, 1034 aa] {ON} sim...   146   8e-37
Ecym_3161 Chr3 complement(308085..311240) [3156 bp, 1051 aa] {ON...   146   8e-37
KLLA0B06523g Chr2 complement(579869..582862) [2994 bp, 997 aa] {...   144   3e-36
Kpol_385.7 s385 (17541..18629) [1089 bp, 362 aa] {ON} (17541..18...   136   2e-35
NCAS0A01990 Chr1 (381080..382165) [1086 bp, 361 aa] {ON}              135   4e-35
SAKL0D12606g Chr4 (1044200..1047274) [3075 bp, 1024 aa] {ON} sim...   140   9e-35
KNAG0F03850 Chr6 complement(729019..730323) [1305 bp, 434 aa] {O...   135   1e-34
Ecym_8344 Chr8 (694173..695261) [1089 bp, 362 aa] {ON} similar t...   133   4e-34
CAGL0K03971g Chr11 (367761..368840) [1080 bp, 359 aa] {ON} highl...   133   4e-34
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....   138   5e-34
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...   137   6e-34
SAKL0F15884g Chr6 complement(1285496..1286782) [1287 bp, 428 aa]...   134   7e-34
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...   133   9e-34
NDAI0D03930 Chr4 (928651..929715) [1065 bp, 354 aa] {ON}              131   1e-33
SAKL0B03894g Chr2 (345902..346978) [1077 bp, 358 aa] {ON} highly...   131   1e-33
Kwal_23.5338 s23 complement(1116675..1117961) [1287 bp, 428 aa] ...   133   1e-33
YPR173C Chr16 complement(886524..887837) [1314 bp, 437 aa] {ON} ...   133   1e-33
Skud_16.478 Chr16 complement(829027..830340) [1314 bp, 437 aa] {...   133   1e-33
Smik_16.438 Chr16 complement(749208..750521) [1314 bp, 437 aa] {...   133   1e-33
Suva_16.506 Chr16 complement(869082..870395) [1314 bp, 437 aa] {...   132   2e-33
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...   135   3e-33
TBLA0E00840 Chr5 (182594..183883) [1290 bp, 429 aa] {ON} Anc_7.5...   131   4e-33
Suva_7.309 Chr7 (527237..528325) [1089 bp, 362 aa] {ON} YGR028W ...   129   6e-33
AFR371W Chr6 (1105757..1108837) [3081 bp, 1026 aa] {ON} Syntenic...   134   9e-33
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....   130   9e-33
KLTH0A00968g Chr1 (96149..97432) [1284 bp, 427 aa] {ON} highly s...   130   1e-32
NCAS0A15130 Chr1 complement(2978192..2979496) [1305 bp, 434 aa] ...   130   1e-32
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...   134   1e-32
TBLA0I02090 Chr9 complement(474394..477000) [2607 bp, 868 aa] {O...   133   1e-32
NDAI0J00290 Chr10 complement(47691..49028) [1338 bp, 445 aa] {ON...   130   1e-32
KAFR0B00410 Chr2 (88947..90221) [1275 bp, 424 aa] {ON} Anc_7.530...   130   1e-32
TBLA0B02000 Chr2 complement(463205..466300) [3096 bp, 1031 aa] {...   133   1e-32
KLTH0G17930g Chr7 complement(1553688..1554764) [1077 bp, 358 aa]...   128   2e-32
TPHA0F00980 Chr6 (222909..223991) [1083 bp, 360 aa] {ON} Anc_4.1...   128   2e-32
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...   132   2e-32
YPL074W Chr16 (415763..418027) [2265 bp, 754 aa] {ON}  YTA6Putat...   132   3e-32
YGR028W Chr7 (542203..543291) [1089 bp, 362 aa] {ON}  MSP1Mitoch...   127   4e-32
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...   132   4e-32
CAGL0I06402g Chr9 (620231..621529) [1299 bp, 432 aa] {ON} highly...   129   4e-32
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...   132   5e-32
Ecym_2804 Chr2 complement(1561704..1563005) [1302 bp, 433 aa] {O...   128   5e-32
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...   131   6e-32
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....   131   7e-32
Skud_11.21 Chr11 complement(54078..57206) [3129 bp, 1042 aa] {ON...   131   7e-32
Smik_6.97 Chr6 (172621..173709) [1089 bp, 362 aa] {ON} YGR028W (...   126   8e-32
Skud_7.320 Chr7 (540689..541897) [1209 bp, 402 aa] {ON} YGR028W ...   127   9e-32
Skud_16.208 Chr16 (387144..389408) [2265 bp, 754 aa] {ON} YPL074...   130   1e-31
KLLA0B10846g Chr2 complement(949338..950630) [1293 bp, 430 aa] {...   127   1e-31
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...   130   1e-31
Suva_16.238 Chr16 (426245..428506) [2262 bp, 753 aa] {ON} YPL074...   130   1e-31
TDEL0H00410 Chr8 (63535..64839) [1305 bp, 434 aa] {ON} Anc_7.530...   127   1e-31
TDEL0D02860 Chr4 complement(543697..544785) [1089 bp, 362 aa] {O...   125   2e-31
AEL265W Chr5 (140797..142092) [1296 bp, 431 aa] {ON} Syntenic ho...   126   3e-31
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...   129   3e-31
KNAG0G00290 Chr7 complement(45891..48884) [2994 bp, 997 aa] {ON}...   129   4e-31
ZYRO0G12738g Chr7 complement(1012482..1014773) [2292 bp, 763 aa]...   128   6e-31
TBLA0G03290 Chr7 complement(873305..875593) [2289 bp, 762 aa] {O...   128   6e-31
KLLA0C14520g Chr3 complement(1269505..1271799) [2295 bp, 764 aa]...   128   6e-31
SAKL0B06402g Chr2 complement(548471..550795) [2325 bp, 774 aa] {...   128   8e-31
KNAG0D03870 Chr4 (704252..705331) [1080 bp, 359 aa] {ON} Anc_4.1...   123   9e-31
Smik_16.162 Chr16 (298702..301230) [2529 bp, 842 aa] {ON} YPL074...   127   9e-31
CAGL0E04642g Chr5 complement(447934..450141) [2208 bp, 735 aa] {...   127   1e-30
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...   127   1e-30
ZYRO0D01210g Chr4 (93236..94519) [1284 bp, 427 aa] {ON} highly s...   124   2e-30
Kpol_1052.6 s1052 (16325..18616) [2292 bp, 763 aa] {ON} (16325.....   127   2e-30
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...   127   2e-30
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...   126   2e-30
ZYRO0A12342g Chr1 (979094..980185) [1092 bp, 363 aa] {ON} highly...   122   2e-30
AER169C Chr5 complement(951174..953462) [2289 bp, 762 aa] {ON} S...   126   2e-30
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...   126   3e-30
ABR036W Chr2 (464427..465509) [1083 bp, 360 aa] {ON} Syntenic ho...   122   3e-30
Suva_4.320 Chr4 complement(565994..568270) [2277 bp, 758 aa] {ON...   125   4e-30
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...   125   5e-30
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...   125   5e-30
Skud_2.204 Chr2 complement(366362..368638) [2277 bp, 758 aa] {ON...   124   1e-29
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...   124   1e-29
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304    123   4e-29
ZYRO0D03938g Chr4 (320521..322578) [2058 bp, 685 aa] {ON} simila...   122   4e-29
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...   122   6e-29
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...   122   7e-29
TDEL0B03040 Chr2 (541376..543619) [2244 bp, 747 aa] {ON} Anc_8.5...   122   8e-29
KLTH0E14190g Chr5 complement(1255261..1257552) [2292 bp, 763 aa]...   122   9e-29
Kwal_14.1321 s14 (278328..279404) [1077 bp, 358 aa] {ON} YGR028W...   117   1e-28
Kwal_27.12376 s27 complement(1199810..1202056) [2247 bp, 749 aa]...   121   1e-28
Kwal_YGOB_27.12376 s27 complement(1199780..1202056) [2277 bp, 75...   121   1e-28
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...   121   1e-28
SAKL0H10032g Chr8 (858355..860484) [2130 bp, 709 aa] {ON} simila...   120   3e-28
KAFR0F03780 Chr6 (743830..744903) [1074 bp, 357 aa] {ON} Anc_4.1...   115   6e-28
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542    119   8e-28
NCAS0C02100 Chr3 (396101..398377) [2277 bp, 758 aa] {ON} Anc_8.542    118   1e-27
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...   117   3e-27
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...   117   3e-27
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...   117   4e-27
Ecym_7036 Chr7 complement(74300..76435) [2136 bp, 711 aa] {ON} s...   113   5e-26
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...   113   6e-26
Kpol_1018.113 s1018 (297316..298503,298553..298561,298604..29955...   112   8e-26
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...   112   9e-26
KAFR0L00730 Chr12 complement(137874..140522) [2649 bp, 882 aa] {...   111   2e-25
KLTH0E12562g Chr5 complement(1114263..1116410) [2148 bp, 715 aa]...   111   3e-25
TPHA0I01900 Chr9 (427715..429883) [2169 bp, 722 aa] {ON} Anc_8.5...   111   3e-25
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...   111   3e-25
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...   109   1e-24
KLLA0E23409g Chr5 complement(2082115..2084106) [1992 bp, 663 aa]...   108   1e-24
Kwal_27.10646 s27 complement(433603..434793) [1191 bp, 397 aa] {...   106   2e-24
SAKL0F08008g Chr6 complement(612481..614844) [2364 bp, 787 aa] {...   108   3e-24
Kwal_47.18123 s47 complement(697417..699792) [2376 bp, 791 aa] {...   107   4e-24
ZYRO0D16346g Chr4 complement(1361550..1364075) [2526 bp, 841 aa]...   107   7e-24
CAGL0J02728g Chr10 complement(269575..272382) [2808 bp, 935 aa] ...   107   8e-24
Kwal_YGOB_27.10642 s27 complement(432707..433537,433540..434793)...   106   1e-23
Kpol_1070.24 s1070 (55367..58012) [2646 bp, 881 aa] {ON} (55367....   106   1e-23
KLTH0A03696g Chr1 complement(318721..321066) [2346 bp, 781 aa] {...   106   1e-23
Kwal_55.21051 s55 complement(666773..667849) [1077 bp, 358 aa] {...   103   2e-23
KLLA0E04379g Chr5 complement(396027..398216) [2190 bp, 729 aa] {...   105   3e-23
ADL109W Chr4 (491872..494088) [2217 bp, 738 aa] {ON} Syntenic ho...   104   4e-23
YER047C Chr5 complement(243810..246503) [2694 bp, 897 aa] {ON}  ...   104   4e-23
TDEL0H02310 Chr8 (386966..389599) [2634 bp, 877 aa] {ON} Anc_7.2...   103   1e-22
Smik_5.172 Chr5 complement(248542..251214) [2673 bp, 890 aa] {ON...   102   3e-22
KNAG0L01320 Chr12 complement(236592..239342) [2751 bp, 916 aa] {...   102   4e-22
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...   101   5e-22
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}              100   8e-22
TBLA0D04260 Chr4 (1051964..1054561) [2598 bp, 865 aa] {ON} Anc_7...   100   9e-22
NDAI0G01900 Chr7 (427004..429964) [2961 bp, 986 aa] {ON} Anc_7.2...   100   2e-21
Skud_5.157 Chr5 complement(241636..244311) [2676 bp, 891 aa] {ON...    99   3e-21
Suva_5.149 Chr5 complement(220370..223057) [2688 bp, 895 aa] {ON...    99   5e-21
Kwal_47.18846 s47 complement(997109..997450) [342 bp, 113 aa] {O...    64   6e-12
ACR200C Chr3 complement(700324..701658) [1335 bp, 444 aa] {ON} S...    60   4e-09
Kwal_55.21054 s55 complement(667988..668956) [969 bp, 323 aa] {O...    57   3e-08
NCAS0H02120 Chr8 complement(412484..413905) [1422 bp, 473 aa] {O...    57   5e-08
KLLA0E02487g Chr5 complement(227048..228388) [1341 bp, 446 aa] {...    56   1e-07
TDEL0D02530 Chr4 (488653..490011) [1359 bp, 452 aa] {ON} Anc_5.4...    55   2e-07
ZYRO0G01716g Chr7 complement(131297..132646) [1350 bp, 449 aa] {...    55   2e-07
TBLA0A02720 Chr1 (660311..661660) [1350 bp, 449 aa] {ON} Anc_5.4...    55   2e-07
Ecym_4643 Chr4 (1254526..1255857) [1332 bp, 443 aa] {ON} similar...    54   4e-07
KLTH0F15730g Chr6 (1282421..1283773) [1353 bp, 450 aa] {ON} high...    54   4e-07
KAFR0D05090 Chr4 complement(1001713..1003098) [1386 bp, 461 aa] ...    54   5e-07
KNAG0B04170 Chr2 (793281..794642) [1362 bp, 453 aa] {ON} Anc_5.4...    54   7e-07
TPHA0E01660 Chr5 (337199..338557) [1359 bp, 452 aa] {ON} Anc_5.4...    53   1e-06
SAKL0G02816g Chr7 complement(231094..232560) [1467 bp, 488 aa] {...    52   1e-06
Kpol_1062.18 s1062 (44220..45560) [1341 bp, 446 aa] {ON} (44220....    52   2e-06
CAGL0A02992g Chr1 complement(308689..310062) [1374 bp, 457 aa] {...    52   2e-06
Smik_4.643 Chr4 complement(1145612..1147033) [1422 bp, 473 aa] {...    52   2e-06
Suva_2.548 Chr2 complement(975787..977157) [1371 bp, 456 aa] {ON...    52   3e-06
Kwal_55.21381 s55 (809652..811004) [1353 bp, 450 aa] {ON} YDR375...    52   3e-06
NDAI0C01530 Chr3 (325097..326557) [1461 bp, 486 aa] {ON} Anc_5.4...    52   3e-06
YDR375C Chr4 complement(1225166..1226536) [1371 bp, 456 aa] {ON}...    51   3e-06
Skud_4.645 Chr4 complement(1148035..1149405) [1371 bp, 456 aa] {...    51   3e-06
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    50   1e-05
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    49   2e-05
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    47   5e-05
KLTH0B08052g Chr2 complement(652928..654538) [1611 bp, 536 aa] {...    46   1e-04
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    46   2e-04
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    46   2e-04
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    45   4e-04
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    44   5e-04
KNAG0A01880 Chr1 (135396..137078) [1683 bp, 560 aa] {ON} Anc_8.5...    44   0.001
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    42   0.002
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    42   0.003
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    42   0.004
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    42   0.004
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    41   0.006
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    41   0.007
Kwal_23.4480 s23 (737809..739470) [1662 bp, 553 aa] {ON} YNL218W...    40   0.008
ABL183W Chr2 (63196..64839) [1644 bp, 547 aa] {ON} Syntenic homo...    40   0.008
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    40   0.013
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    40   0.014
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    40   0.015
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    40   0.016
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    40   0.017
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    39   0.018
TBLA0H03710 Chr8 complement(902121..903824) [1704 bp, 567 aa] {O...    39   0.031
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    37   0.10 
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    37   0.10 
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    37   0.12 
NCAS0G01450 Chr7 (262021..263730) [1710 bp, 569 aa] {ON} Anc_2.2...    37   0.14 
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    36   0.16 
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    36   0.17 
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    36   0.18 
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    36   0.20 
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    36   0.22 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    36   0.23 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    36   0.24 
ACR102W Chr3 (535740..538262) [2523 bp, 840 aa] {ON} Syntenic ho...    36   0.26 
KLLA0D19360g Chr4 complement(1629360..1631039) [1680 bp, 559 aa]...    36   0.26 
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    36   0.26 
Kpol_1014.42 s1014 complement(81164..82876) [1713 bp, 570 aa] {O...    35   0.29 
ZYRO0C04884g Chr3 (383579..385573) [1995 bp, 664 aa] {ON} simila...    35   0.31 
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    35   0.34 
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    35   0.39 
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    35   0.44 
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    35   0.51 
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    35   0.56 
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    35   0.60 
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    34   0.64 
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    34   0.73 
TDEL0A00690 Chr1 (116066..117724) [1659 bp, 552 aa] {ON} Anc_2.2...    34   0.77 
KLLA0B01892g Chr2 (162844..165855) [3012 bp, 1003 aa] {ON} weakl...    34   0.87 
NDAI0F03710 Chr6 complement(882364..884193) [1830 bp, 609 aa] {O...    34   0.88 
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    34   1.0  
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    34   1.1  
ZYRO0F15136g Chr6 complement(1238898..1240598) [1701 bp, 566 aa]...    34   1.1  
KAFR0A01930 Chr1 complement(401199..403541) [2343 bp, 780 aa] {O...    33   1.2  
ZYRO0B11880g Chr2 (950091..951908) [1818 bp, 605 aa] {ON} simila...    33   1.2  
Suva_14.124 Chr14 (232456..234216) [1761 bp, 586 aa] {ON} YNL218...    33   1.5  
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    33   1.6  
TDEL0E05510 Chr5 complement(1010410..1013400) [2991 bp, 996 aa] ...    33   1.7  
ZYRO0F06446g Chr6 (533651..536176) [2526 bp, 841 aa] {ON} simila...    33   1.8  
Ecym_2429 Chr2 (833794..836133) [2340 bp, 779 aa] {ON} similar t...    33   1.8  
Ecym_8322 Chr8 (654654..657074) [2421 bp, 806 aa] {ON} similar t...    33   1.8  
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    33   1.8  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   1.9  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    33   1.9  
YNL218W Chr14 (238238..240001) [1764 bp, 587 aa] {ON}  MGS1Prote...    33   2.0  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    33   2.0  
TPHA0F03230 Chr6 (704126..706663) [2538 bp, 845 aa] {ON} Anc_8.6...    33   2.0  
ZYRO0E07458g Chr5 complement(572497..575538) [3042 bp, 1013 aa] ...    33   2.0  
AFL121W Chr6 (209373..211949) [2577 bp, 858 aa] {ON} Non-synteni...    33   2.0  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    33   2.1  
Skud_14.118 Chr14 (226974..228740) [1767 bp, 588 aa] {ON} YNL218...    33   2.2  
KLLA0F09691g Chr6 complement(892208..893725) [1518 bp, 505 aa] {...    33   2.3  
Kwal_47.18662 s47 complement(919990..921402) [1413 bp, 470 aa] {...    33   2.3  
Smik_14.114 Chr14 (217529..219280) [1752 bp, 583 aa] {ON} YNL218...    32   2.6  
Ecym_2174 Chr2 (338477..341560) [3084 bp, 1027 aa] {ON} similar ...    32   2.9  
Skud_13.235 Chr13 complement(396755..398980) [2226 bp, 741 aa] {...    32   3.1  
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    32   3.1  
NCAS0F00820 Chr6 complement(166312..168531) [2220 bp, 739 aa] {O...    32   3.4  
Kpol_363.12 s363 complement(18968..20512) [1545 bp, 514 aa] {ON}...    32   3.4  
AFR013C Chr6 complement(458057..461230) [3174 bp, 1057 aa] {ON} ...    32   3.5  
ZYRO0G03806g Chr7 (304402..306522) [2121 bp, 706 aa] {ON} simila...    32   3.6  
Kpol_223.4 s223 (4546..6036) [1491 bp, 496 aa] {ON} (4546..6036)...    32   3.7  
ZYRO0E01826g Chr5 (134806..136320) [1515 bp, 504 aa] {ON} simila...    32   3.8  
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    32   3.9  
KLTH0H03542g Chr8 (320024..322993) [2970 bp, 989 aa] {ON} weakly...    32   4.9  
NDAI0E01440 Chr5 complement(285903..288581) [2679 bp, 892 aa] {O...    32   5.8  
YPL235W Chr16 (103232..104647) [1416 bp, 471 aa] {ON}  RVB2ATP-d...    31   6.4  
Suva_16.71 Chr16 (112264..113682) [1419 bp, 472 aa] {ON} YPL235W...    31   6.5  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    31   6.6  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    32   6.6  
Ecym_2154 Chr2 (289010..290413) [1404 bp, 467 aa] {ON} similar t...    31   7.6  
Skud_16.43 Chr16 (76826..78241) [1416 bp, 471 aa] {ON} YPL235W (...    31   7.7  
TBLA0A02230 Chr1 complement(537595..539022) [1428 bp, 475 aa] {O...    31   7.9  
ZYRO0E07282g Chr5 (555489..559088) [3600 bp, 1199 aa] {ON} simil...    31   9.8  

>NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {ON}
           Anc_5.251
          Length = 474

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/474 (85%), Positives = 406/474 (85%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAPV             IVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT
Sbjct: 1   MPPKEDWEKYKAPVDAEDEKEKAKEDKIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSNGNEEEQEGE 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 121 GESAASATSTTNNASTTGSGENGEDEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE
Sbjct: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 301 LFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 360

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN
Sbjct: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474

>CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145w YTA3
          Length = 472

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/474 (82%), Positives = 401/474 (84%), Gaps = 2/474 (0%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           M PKEDWEKYKAPV             I PL+EGDIQVLKTYGAAPYAAKLKE EKDLK 
Sbjct: 1   MAPKEDWEKYKAPVESDDDNKLKDDKSI-PLTEGDIQVLKTYGAAPYAAKLKETEKDLKE 59

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEKSG++ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 60  IEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSSASNEVSDES 119

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 120 AVNGANTTNSATTGSGNDGDAEGDDDED-AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 178

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPE
Sbjct: 179 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPE 238

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 239 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 298

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 299 LFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 358

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER+IRWELISRLCPN
Sbjct: 359 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERNIRWELISRLCPN 418

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 419 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 472

>Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa]
           {ON} complement(185143..186537) [1395 nt, 465 aa]
          Length = 464

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/474 (81%), Positives = 400/474 (84%), Gaps = 10/474 (2%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAP+             I PL+E DIQVLKTYGAAPYA+KLKE EKDLK 
Sbjct: 1   MPPKEDWEKYKAPLEGKENEDVSKDEKITPLTESDIQVLKTYGAAPYASKLKETEKDLKD 60

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 61  IELRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSSTEGENDN 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 121 GNGENGESASANDADDDEE----------AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 170

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPE
Sbjct: 171 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKEQIEKLREVVELPLLSPE 230

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 231 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 290

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 291 LFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 350

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+K+MSVER IRWELISRLCPN
Sbjct: 351 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKAMSVERGIRWELISRLCPN 410

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 411 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 464

>TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.251
           YKL145W
          Length = 463

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/474 (81%), Positives = 400/474 (84%), Gaps = 11/474 (2%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           M PKEDWEKYKAPV             I+PLSEGDIQVLK+YGAAPY +K+KE EKDLK 
Sbjct: 1   MAPKEDWEKYKAPVEGKDSKPNEDK--IIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKV 58

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE KIKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 59  IEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSENGDESNS 118

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 119 ESTEGNGTANTNTAADDNEE---------AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 169

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPLLSPE
Sbjct: 170 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPE 229

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 230 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 289

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 290 LFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 349

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 350 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 409

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 410 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463

>SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 456

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/474 (81%), Positives = 401/474 (84%), Gaps = 18/474 (3%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKE+WEKY AP+             +VPLSEGDIQVLKTYGAAPYA KLKEIEKDLK 
Sbjct: 1   MPPKENWEKYTAPIEEEETEEEKK---VVPLSEGDIQVLKTYGAAPYANKLKEIEKDLKD 57

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 58  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKGDSSSSSPEDT 117

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 118 QSNSSPNSEEDDED---------------AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 162

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLLSPE
Sbjct: 163 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPE 222

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 223 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 282

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 283 LFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 342

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 343 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 402

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 403 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 456

>Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/474 (82%), Positives = 400/474 (84%), Gaps = 6/474 (1%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAP+             IVPL+EGDIQVLK+YGAAPYAAKLK+ E DLK 
Sbjct: 1   MPPKEDWEKYKAPLDDDDKKPDDDK--IVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKD 58

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK           
Sbjct: 59  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGSGENDDSTTD 118

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 119 NNNDSVNGNSNSNQESADVDEDDED----AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 174

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE
Sbjct: 175 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 234

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 235 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 294

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 295 LFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 354

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPN
Sbjct: 355 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPN 414

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 415 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.251
           YKL145W
          Length = 471

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/474 (81%), Positives = 398/474 (83%), Gaps = 3/474 (0%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAP                PL+EGDIQVLKTYGAAPYA KLKE EKDLK 
Sbjct: 1   MPPKEDWEKYKAPAEEDKEKSNDEKN--TPLTEGDIQVLKTYGAAPYAGKLKETEKDLKD 58

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IEN+IKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+           
Sbjct: 59  IENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNED 118

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 119 GLDTATLARNGLDSNEPRETEEGDDDED-AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 177

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPE
Sbjct: 178 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPE 237

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 238 RFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 297

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 298 LFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 357

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 358 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 417

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 418 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471

>ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL145W
           (RPT1)
          Length = 475

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/474 (81%), Positives = 398/474 (83%), Gaps = 21/474 (4%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAPV             I PLSEGDIQVLKTYGAAPYAAKLK  EKDLK 
Sbjct: 23  MPPKEDWEKYKAPVETEEEQKQADEK-IKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKD 81

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+           
Sbjct: 82  IEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSG 141

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 142 ANTGEDDED--------------------AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 181

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPE
Sbjct: 182 VGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPE 241

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 242 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 301

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 302 LFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 361

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 362 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 421

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIR+RRKVA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 422 STGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475

>YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for optimal CDC20 transcription;
           interacts with Rpn12p and Ubr1p; mutant has aneuploidy
           tolerance
          Length = 467

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/474 (82%), Positives = 400/474 (84%), Gaps = 7/474 (1%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAP+             IVPL+EGDIQVLK+YGAAPYAAKLK+ E DLK 
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPDDDK--IVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKD 58

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK           
Sbjct: 59  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTD 118

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 119 NNNSGNSNSNSNQQSTDADEDDED-----AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 173

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE
Sbjct: 174 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 233

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 234 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 293

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 294 LFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 353

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPN
Sbjct: 354 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPN 413

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 414 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 467

>Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/474 (82%), Positives = 400/474 (84%), Gaps = 6/474 (1%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAP+             IVPL+EGDIQVLK+YGAAPYAAKLK+ E DLK 
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPNDDK--IVPLTEGDIQVLKSYGAAPYAAKLKQTESDLKD 58

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK           
Sbjct: 59  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDPTTD 118

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 119 NNSNSGNENSNSNQQSADADEDDED----AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 174

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE
Sbjct: 175 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 234

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 235 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 294

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 295 LFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 354

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPN
Sbjct: 355 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPN 414

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 415 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/474 (81%), Positives = 395/474 (83%), Gaps = 6/474 (1%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           M PKEDW+KYKAP+             I PLSEGDIQVLKTYGAAP A KLK+ EKDLK 
Sbjct: 1   MAPKEDWDKYKAPIEDDKTTVDEK---ITPLSEGDIQVLKTYGAAPCAGKLKQTEKDLKE 57

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           I  +IKEK GV+ESDTGLAPSHLWDIMGDRQRLS EHPLQVARCTKIIK           
Sbjct: 58  IRKRIKEKGGVKESDTGLAPSHLWDIMGDRQRLSSEHPLQVARCTKIIKANSDLENSNSM 117

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 118 DNNSTNNTPLDDTNHNNNIDEDNDED---AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 174

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPLLSPE
Sbjct: 175 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPE 234

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 235 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 294

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 295 LFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 354

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPN
Sbjct: 355 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPN 414

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVASEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 415 STGAELRSVCTEAGMFAIRARRKVASEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W
           (REAL)
          Length = 471

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/474 (81%), Positives = 400/474 (84%), Gaps = 3/474 (0%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKE+WEKYKAP+             IVPL+EGDIQVLK+YGAAPYAAKLK+ E DLK 
Sbjct: 1   MPPKENWEKYKAPLEDDDKKSDEDK--IVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKD 58

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK           
Sbjct: 59  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDSTTN 118

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 119 NNNDINSSNNNNSNSNQESADADEDDED-AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 177

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE
Sbjct: 178 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 237

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 238 RFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 297

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 298 LFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 357

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN
Sbjct: 358 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 417

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 418 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 471

>ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145W RPT1 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 468

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/474 (81%), Positives = 397/474 (83%), Gaps = 6/474 (1%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPP+EDWEKYKAP+               PLSEGDIQVLKTYGAAPYA KLKE EKDLK 
Sbjct: 1   MPPREDWEKYKAPIEGTGDENAEDTKG-SPLSEGDIQVLKTYGAAPYATKLKETEKDLKD 59

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEKSG++ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 60  IEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEG 119

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 120 LDGAAGPGATSENRDADDAEEDED-----AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 174

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG KDQIEKLREVVELPLLSPE
Sbjct: 175 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPE 234

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 235 RFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 294

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMAR+KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 295 LFEMARSKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 354

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVER IRWELISRLCPN
Sbjct: 355 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPN 414

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 415 STGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 445

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/474 (81%), Positives = 398/474 (83%), Gaps = 29/474 (6%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEK+KAP               VPL+EGDIQVLKTYGAAPYA KLKE EKDLK 
Sbjct: 1   MPPKEDWEKFKAPAEEEKQEEKPN----VPLTEGDIQVLKTYGAAPYADKLKETEKDLKD 56

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 57  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKPEASDESPADE 116

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        +KY+INLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 117 DEED-------------------------SKYIINLKQIAKFVVGLGERVSPTDIEEGMR 151

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QI+KLREVVELPLLSPE
Sbjct: 152 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPE 211

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 212 RFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 271

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMART+KACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 272 LFEMARTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 331

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRLCPN
Sbjct: 332 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPN 391

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 392 STGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445

>KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.251
           YKL145W
          Length = 448

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/474 (80%), Positives = 399/474 (84%), Gaps = 26/474 (5%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPK+DWEKYK P+             I PL+EGDIQVLKTYGAAPYA KLK  E+DLK 
Sbjct: 1   MPPKQDWEKYKTPIDEESSKEKKEEQ-IAPLTEGDIQVLKTYGAAPYADKLKVTEEDLKK 59

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSH+WD+MGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 60  IEARIKEKAGVKESDTGLAPSHMWDVMGDRQRLSEEHPLQVARCTKIIKSSSEEGAEGNE 119

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 120 DEDD-------------------------AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 154

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY+IELPLPPRIDP+VTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPE
Sbjct: 155 VGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPE 214

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 215 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 274

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 275 LFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 334

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK+MSVER+IRWELISRLCPN
Sbjct: 335 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKAMSVERNIRWELISRLCPN 394

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 395 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 448

>Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR050C
          Length = 456

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/474 (80%), Positives = 395/474 (83%), Gaps = 18/474 (3%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           M PKEDWEKYK PV             I PL+EGDIQVLKTYGAAPYAAKLK  EKDLK 
Sbjct: 1   MSPKEDWEKYKPPVETEDEQKQADDK-IKPLTEGDIQVLKTYGAAPYAAKLKSTEKDLKD 59

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GV+ESDTGLAPSHLWDI+GDRQ+LSE HPLQVARCTKIIK           
Sbjct: 60  IEQRIKEKAGVKESDTGLAPSHLWDILGDRQKLSERHPLQVARCTKIIKSEPSRDSAGGS 119

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180
                                        AKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 120 SSATTVGDDDED-----------------AKYVINLKQIAKFVVGLGERVSPTDIEEGMR 162

Query: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240
           VGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPE
Sbjct: 163 VGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPE 222

Query: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300
           RFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 223 RFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 282

Query: 301 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 360
           LFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 283 LFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 342

Query: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 343 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 402

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           +TGAELRSVCTEAGMFAIR+RRKVA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 403 STGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 456

>KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.251
           YKL145W
          Length = 477

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/477 (80%), Positives = 392/477 (82%), Gaps = 3/477 (0%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEK K  V             + PL+E DIQVLKTYG APYA KLKE E DLK 
Sbjct: 1   MPPKEDWEKQKPAVENAEDDAAKKGEDVAPLTEDDIQVLKTYGVAPYAVKLKETENDLKE 60

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXX 120
           IE +IKEK+GVRESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK           
Sbjct: 61  IEARIKEKAGVRESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKSGEGDGNGSGN 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXX---AKYVINLKQIAKFVVGLGERVSPTDIEE 177
                                           +KYVINLKQIAKFVVGLGERVSPTDIEE
Sbjct: 121 NSNGAAADGAGAAAAAGENAAQAAGADDDEDDSKYVINLKQIAKFVVGLGERVSPTDIEE 180

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
           GMRVGVDRSKY+IELPLPPRIDP+VTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL
Sbjct: 181 GMRVGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 240

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
           SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM
Sbjct: 241 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 300

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VRELFEMARTK+ACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIK
Sbjct: 301 VRELFEMARTKRACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIK 360

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRL 417
           VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER IRWELISRL
Sbjct: 361 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL 420

Query: 418 CPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           CPN TGAELRSVCTEAGMFAIRARRKVASEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 CPNATGAELRSVCTEAGMFAIRARRKVASEKDFLKAVDKVINGYKKFSSTSRYMQYN 477

>KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 475

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/478 (80%), Positives = 397/478 (83%), Gaps = 7/478 (1%)

Query: 1   MPPKEDWEKYKAPVXXXXXXXXXXXXXIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60
           MPPKEDWEKYKAP+             +VPLSEGDI+VLKTYGAAPYA KLK IE DLK 
Sbjct: 1   MPPKEDWEKYKAPIEDEESKEEKK---VVPLSEGDIEVLKTYGAAPYAKKLKSIENDLKE 57

Query: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXX- 119
           IE KIKEK+GV+ESDTGLAPSHLWDI+GDRQRLSEE PLQVARCTKIIK           
Sbjct: 58  IEKKIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVARCTKIIKAEKPQRSGNAL 117

Query: 120 ---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKFVVGLGERVSPTDIE 176
                                            AKYVINLKQIAKFVVGLGERVSPTDIE
Sbjct: 118 GGDADGNGVAAAAAAAAAAAAAASGTEDEDDDDAKYVINLKQIAKFVVGLGERVSPTDIE 177

Query: 177 EGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPL 236
           EGMRVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPL
Sbjct: 178 EGMRVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPL 237

Query: 237 LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 296
           LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR
Sbjct: 238 LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 297

Query: 297 MVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNI 356
           MVRELFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNI
Sbjct: 298 MVRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNI 357

Query: 357 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISR
Sbjct: 358 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISR 417

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           LCPN+TGAELRSVCTEAGMFAIRARRKV +EKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 418 LCPNSTGAELRSVCTEAGMFAIRARRKVTTEKDFLKAVEKVINGYKKFSSTSRYMQYN 475

>Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W
           (RPT1) - putative ATPase, 26S protease subunit component
           [contig 246] FULL
          Length = 409

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/432 (82%), Positives = 371/432 (85%), Gaps = 25/432 (5%)

Query: 43  GAAPYAAKLKEIEKDLKTIENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 102
           GAAPYA KLK I+KDLK IE KIKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 3   GAAPYADKLKAIDKDLKDIEAKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62

Query: 103 RCTKIIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKYVINLKQIAKF 162
           RCTKIIK                                        +KY+INLKQIAKF
Sbjct: 63  RCTKIIKPEASEDNTGEEDEED-------------------------SKYIINLKQIAKF 97

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           VVGLGERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK
Sbjct: 98  VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 157

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
           +QI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI
Sbjct: 158 EQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 217

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
           GSELVQKYVGEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLE
Sbjct: 218 GSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLE 277

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS
Sbjct: 278 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 337

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           MSVER IRWELISRLCPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AVEKVINGYK
Sbjct: 338 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 397

Query: 463 KFSSTSRYMQYN 474
           KFSSTS+YMQYN
Sbjct: 398 KFSSTSQYMQYN 409

>NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {ON}
           Anc_5.251
          Length = 385

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/388 (84%), Positives = 331/388 (85%), Gaps = 3/388 (0%)

Query: 87  MGDRQRLSEEHPLQVARCTKIIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 146
           MGDRQRLSEEHPLQVARCTKIIK                                     
Sbjct: 1   MGDRQRLSEEHPLQVARCTKIIKGNAASATEGEDGGDEQINPTSTSNNSNAENAEEDEED 60

Query: 147 XXXAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMT 206
               KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMT
Sbjct: 61  ---NKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMT 117

Query: 207 VEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLC 266
           VEEKPD+TYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLC
Sbjct: 118 VEEKPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLC 177

Query: 267 ARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
           ARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI        
Sbjct: 178 ARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARF 237

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                  NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL
Sbjct: 238 DDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 297

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVAS 446
           PDLEGRANIFRIHSKSMSVER IRWELISRLCPN+TGAELRSVCTEAGMFAIRARRKVAS
Sbjct: 298 PDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAS 357

Query: 447 EKDFLKAVEKVINGYKKFSSTSRYMQYN 474
           EKDFLKAVEKVINGYKKFSSTSRYMQYN
Sbjct: 358 EKDFLKAVEKVINGYKKFSSTSRYMQYN 385

>Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 154/309 (49%), Positives = 207/309 (66%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
            RA I RIHS+ M++ R I    ++      +GA+++ VCTEAGMFA+R RR   +++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDF 382

Query: 451 LKAVEKVIN 459
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates
          Length = 404

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 207/309 (66%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVEKV 141

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSG 261

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 262 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVA 321

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
            R  I RIHS+ M++ R I    ++      +GA+++ VCTEAGM+A+R RR   +++DF
Sbjct: 322 ARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 381

Query: 451 LKAVEKVIN 459
             AV KV+N
Sbjct: 382 ELAVAKVMN 390

>Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  306 bits (783), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 207/309 (66%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
            RA I RIHS+ M++ R I    ++      +GA+++ VCTEAGM+A+R RR   +++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 451 LKAVEKVIN 459
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  306 bits (783), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 207/309 (66%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
            RA I RIHS+ M++ R I    ++      +GA+++ VCTEAGM+A+R RR   +++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 451 LKAVEKVIN 459
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}
           RPT6One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in the degradation of
           ubiquitinated substrates; bound by ubiquitin-protein
           ligases Ubr1p and Ufd4p; localized mainly to the nucleus
           throughout the cell cycle
          Length = 405

 Score =  306 bits (783), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 207/309 (66%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
            RA I RIHS+ M++ R I    ++      +GA+++ VCTEAGM+A+R RR   +++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 451 LKAVEKVIN 459
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {ON}
           YGL048C (RPT6) - ATPase [contig 51] FULL
          Length = 405

 Score =  303 bits (777), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 338
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 339 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 398
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 399 HSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
           HS+ M++ R I    I+      +GA+++ VCTEAGMFA+R RR   +++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 459 N 459
           N
Sbjct: 391 N 391

>KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  303 bits (775), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 338
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 339 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 398
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 399 HSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
           HS+ M++ R I    I+      +GA+++ VCTEAGMFA+R RR   +++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 459 N 459
           N
Sbjct: 391 N 391

>SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048C RPT6 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 408

 Score =  301 bits (772), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 202/301 (67%), Gaps = 1/301 (0%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V + + +   D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 94  GKYIVDIAKDIDVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 153

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 154 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 213

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 338
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 214 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 273

Query: 339 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 398
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 274 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTIAARTEILRI 333

Query: 399 HSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
           HS+ M++ R I  + I+      +GA+++ VCTEAGM+A+R RR   +++DF  AV KV+
Sbjct: 334 HSRKMNLTRGINLKKIAEQMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 393

Query: 459 N 459
           N
Sbjct: 394 N 394

>AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL048C
           (RPT6)
          Length = 405

 Score =  301 bits (771), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 202/301 (67%), Gaps = 1/301 (0%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 338
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 339 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 398
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 271 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 330

Query: 399 HSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
           HS+ M++ R I    I+      +GA+++ VCTEAGM+A+R RR   +++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 390

Query: 459 N 459
           N
Sbjct: 391 N 391

>ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]
           {ON} highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  301 bits (771), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 151/309 (48%), Positives = 205/309 (66%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDISKDINIKDLKPSQRVCLKSDSYTLHKILENKADPLVSLMMVEKV 142

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  +GG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMLGGLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAV 202

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARENAPSIIFMDEIDSIGSSRVEGSG 262

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIVMATNRLDILDPALLRPGRIDRKIEFPPPTVA 322

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
            R  I RIHS+ M++ R I    I+      +GA+++ VCTEAGM+A+R RR   +++D 
Sbjct: 323 ARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDL 382

Query: 451 LKAVEKVIN 459
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048c SUG1 26S proteasome regulatory subunit
          Length = 400

 Score =  300 bits (769), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 207/311 (66%), Gaps = 2/311 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 76  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLVNKADPLVSLMMVEKV 135

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 136 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 195

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXX--XXXXXXXX 328
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 196 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGG 255

Query: 329 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 388
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 256 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPT 315

Query: 389 LEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           +  RA I RIHS+ M++ R I    I+      +GA+++ VCTEAGM+A+R RR   +++
Sbjct: 316 VAARAEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 375

Query: 449 DFLKAVEKVIN 459
           DF  AV KV+N
Sbjct: 376 DFELAVGKVMN 386

>Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON}
           (110852..112063) [1212 nt, 404 aa]
          Length = 403

 Score =  300 bits (768), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 201/301 (66%), Gaps = 1/301 (0%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ PD TY  VG
Sbjct: 89  GKYIVDVAKDINVKDLKPSQRVCLKSDTYMLHKVLENKADPLVSLMMVEKVPDSTYDMVG 148

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 149 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 208

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 338
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 209 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 268

Query: 339 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 398
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 269 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 328

Query: 399 HSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
           HS+ M++ R I    ++      +GA+++ VCTEAGM+A+R RR   +++DF  AV KV+
Sbjct: 329 HSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVSKVM 388

Query: 459 N 459
           N
Sbjct: 389 N 389

>NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa]
           {ON} Anc_4.57
          Length = 407

 Score =  299 bits (766), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 84  KVLVKVQPEGKYIVDIAKDINVKDLKTSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 143

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 144 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 203

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 204 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 263

Query: 331 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 264 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 323

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
             R  I RIHS+ M++ R I    I+      +GA+++ VCTEAGM+A+R RR   +++D
Sbjct: 324 AARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 383

Query: 450 FLKAVEKVIN 459
           F  AV KV+N
Sbjct: 384 FELAVGKVMN 393

>TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa]
           {ON} Anc_4.57 YGL048C
          Length = 406

 Score =  298 bits (763), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 149/300 (49%), Positives = 200/300 (66%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  +G
Sbjct: 93  GKYIVDISKDINIKELKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLG 152

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 153 GLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 212

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRT 339
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               +EVQRT
Sbjct: 213 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRT 272

Query: 340 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 399
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RIH
Sbjct: 273 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIH 332

Query: 400 SKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVIN 459
           S+ M++ R I    I+      +GA+++ VCTEAGM+A+R RR   +++D   AV KV+N
Sbjct: 333 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN 392

>KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {ON}
           Anc_4.57 YGL048C
          Length = 405

 Score =  298 bits (762), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 141

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESGS 261

Query: 331 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
             R  I RIHS+ M++ R I    I+      +GA+++ VCTEAGM+A+R RR   +++D
Sbjct: 322 AARTEILRIHSRKMNLTRGINLRKIADKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 450 FLKAVEKVIN 459
           F  AV KV+N
Sbjct: 382 FELAVGKVMN 391

>TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4.57
           YGL048C
          Length = 401

 Score =  297 bits (761), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 201/301 (66%), Gaps = 1/301 (0%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  VG
Sbjct: 87  GKYIVDVAKDINIKELKPSQRVCLKSDSYLLHKVLKNKSDPLVSLMMVEKVPDSTYDMVG 146

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 147 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 206

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 338
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 207 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 266

Query: 339 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 398
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 267 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 326

Query: 399 HSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
           HS+ M++ R I    I+      +GA+++ VCTEAGM+A+R RR   +++DF  AV KV+
Sbjct: 327 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 386

Query: 459 N 459
           N
Sbjct: 387 N 387

>KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {ON}
           Anc_4.57 YGL048C
          Length = 400

 Score =  297 bits (761), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 153/314 (48%), Positives = 205/314 (65%), Gaps = 4/314 (1%)

Query: 150 AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEE 209
            K ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+
Sbjct: 73  TKVLVKVQPEGKYIVDVAKDINVKELKVSQRVCLKSDSYMLHKVLENKADPLVSLMMVEK 132

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
            PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARA
Sbjct: 133 VPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARA 192

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXX----XXXXX 325
           VA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI           
Sbjct: 193 VAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESS 252

Query: 326 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 385
                   +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF 
Sbjct: 253 SGGGGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFP 312

Query: 386 LPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVA 445
            P L  R  I RIHS+ M++ R I    I       +GA+++ VCTEAGM+A+R RR   
Sbjct: 313 APTLAARTEILRIHSRKMNLTRGINLRKIVEKMNGCSGADVKGVCTEAGMYALRERRIHV 372

Query: 446 SEKDFLKAVEKVIN 459
           +++DF  AV KV+N
Sbjct: 373 TQEDFELAVGKVMN 386

>NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57
          Length = 405

 Score =  297 bits (761), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           K ++ ++   K++V + + +   +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDIDIKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVEKV 141

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEGGS 261

Query: 331 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
             RA I RIHS+ M++ R I    ++      +GA+++ VCTEAGM+A+R RR   +++D
Sbjct: 322 AARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 450 FLKAVEKVIN 459
           F  AV KV+N
Sbjct: 382 FELAVGKVMN 391

>TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {ON}
           Anc_4.57 YGL048C
          Length = 403

 Score =  296 bits (759), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 150/301 (49%), Positives = 201/301 (66%), Gaps = 1/301 (0%)

Query: 160 AKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 219
            K++V +   ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  VG
Sbjct: 89  GKYIVDVAPDINVKELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVEKVPDSTYDMVG 148

Query: 220 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 279
           G   QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 149 GLTKQIREIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 208

Query: 280 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 338
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 209 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 268

Query: 339 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 398
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I +I
Sbjct: 269 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILKI 328

Query: 399 HSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
           HS+ M++ R I  + ++      +GA+++ VCTEAGM+A+R RR   +++DF  AV KV+
Sbjct: 329 HSRKMNLTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 388

Query: 459 N 459
           N
Sbjct: 389 N 389

>KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 434

 Score =  281 bits (720), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 198/307 (64%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 172

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 232

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 352

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+ ++    +  +E   ++     GA++R+  TEAG FAIR  R   +++D 
Sbjct: 353 GRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDYINQEDL 412

Query: 451 LKAVEKV 457
           +KAV KV
Sbjct: 413 MKAVRKV 419

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  281 bits (720), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++T+  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH++ +    +  +E   ++     GA++R+  TEAG FAIR  R   +  D 
Sbjct: 356 GRLEIFKIHTEKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIREDRDHITSDDL 415

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 421

 Score =  281 bits (718), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 194/307 (63%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E 
Sbjct: 100 KYIVKASSGPRYIVGVRNSVDRSKLKKGIRVTLDITTLTIMRILPRETDPLVYNMTTFEP 159

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 160 GEISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 219

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 220 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 279

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 280 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 339

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 340 GRLEIFKIHTAHVKKSGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIQDDL 399

Query: 451 LKAVEKV 457
           +KAV KV
Sbjct: 400 MKAVRKV 406

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  281 bits (718), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V+ + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVNRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++T+  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R   +  D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 433

 Score =  280 bits (716), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 195/307 (63%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 112 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFEQ 171

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            D+T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 172 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 231

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 232 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 291

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 292 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 351

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IHS  +    +  +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 352 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 411

Query: 451 LKAVEKV 457
           +KAV KV
Sbjct: 412 MKAVRKV 418

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  280 bits (715), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++T+  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKLEIPLPNEA 355

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R   + +D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPEDL 415

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON}
           RPT4One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in degradation of
           ubiquitinated substrates; contributes preferentially to
           ERAD; required for spindle pole body duplication; mainly
           nuclear localization
          Length = 437

 Score =  279 bits (713), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R   +  D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {ON}
           Anc_8.708 YOR259C
          Length = 444

 Score =  278 bits (712), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 202/322 (62%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  T +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 123 KYIVKASSGPRYIVGVRNSVDRTKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 182

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 183 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 242

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 303 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNEA 362

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+ ++    +  ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEIFKIHTANVKKHGEFDFDAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV +  KK   T  Y +
Sbjct: 423 MKAVRKV-SETKKLEGTIEYQK 443

>Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa]
           {ON} YOR259C (RPT4) - ATPase; component of the 26S
           proteasome cap subunit [contig 68] FULL
          Length = 434

 Score =  278 bits (710), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 194/307 (63%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 172

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            D+T+  +GG  +QI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 232

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 352

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IHS  +    +  +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 353 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 412

Query: 451 LKAVEKV 457
           +KAV KV
Sbjct: 413 MKAVRKV 419

>NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708
          Length = 426

 Score =  277 bits (709), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 105 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 164

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 165 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 224

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 225 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 284

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 285 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 344

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +  + D  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 345 GRLEIFKIHTAKVKKQGDFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 404

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   +  Y +
Sbjct: 405 MKAVRKVAE-VKKLEGSLEYQK 425

>AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR259C (RPT4)
          Length = 432

 Score =  277 bits (708), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 194/307 (63%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 170

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 230

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 350

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           G   IF+IH+  +    +  +E   ++C    GA++R+  TEAG FAIR  R    ++D 
Sbjct: 351 GMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 410

Query: 451 LKAVEKV 457
           +KAV KV
Sbjct: 411 MKAVRKV 417

>Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar to
           Ashbya gossypii AAL113W
          Length = 427

 Score =  277 bits (708), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 195/307 (63%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 106 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 165

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI+ PKG+LLYGPPGTGKTL A+AV
Sbjct: 166 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGINSPKGVLLYGPPGTGKTLLAKAV 225

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 226 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 285

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 286 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 345

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 346 GRLEIFKIHTAKVKKTGEFDFEATVKMSDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 405

Query: 451 LKAVEKV 457
           +KAV KV
Sbjct: 406 MKAVRKV 412

>CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259c CRL13
          Length = 436

 Score =  276 bits (707), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 115 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 174

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 175 GEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 234

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 235 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 294

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 295 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 354

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 355 GRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 414

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   T  Y +
Sbjct: 415 MKAVRKVAE-VKKLEGTLEYQK 435

>NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa]
           {ON} Anc_3.216
          Length = 437

 Score =  276 bits (707), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 198/297 (66%)

Query: 162 FVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 221
           F V +   V    +E G  V +     +I   L    DP V++M +++ P  +YSD+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGL 187

Query: 222 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 281
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 ESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 282 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 341
           +GSEL+QKY+G+G R+ R++F++A  +   IIF DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAGEQAPSIIFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 342 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 401
           EL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTS 367

Query: 402 SMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
            M++ +D+ +E +     + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 368 KMNLSKDVDFETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTGEDFKQAKERVM 424

>TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa]
           {ON} Anc_8.708 YOR259C
          Length = 435

 Score =  276 bits (705), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 114 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 173

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            D+++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 174 GDISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 233

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 234 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 293

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 294 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 353

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 354 GRLEIFKIHTVHVKKSGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 413

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   +  Y +
Sbjct: 414 MKAVRKVAE-VKKLEGSLDYQK 434

>KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {ON}
           Anc_8.708 YOR259C
          Length = 424

 Score =  275 bits (702), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 202/322 (62%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 103 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 162

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            +++++ +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 163 GEISFNGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 222

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           +    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 223 SATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 282

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 283 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 342

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+ ++    +  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 343 GRLEIFKIHTANVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 402

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV +  KK   T  Y +
Sbjct: 403 MKAVRKV-SEVKKLEGTLEYQK 423

>NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708
          Length = 443

 Score =  275 bits (702), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V    +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 181

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            +VT+  +GG  +QI  LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 301

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH++ +    +  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 421

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   +  Y +
Sbjct: 422 MKAVRKVAE-VKKLEGSLEYQK 442

>Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {ON}
           complement(38724..40022) [1299 nt, 433 aa]
          Length = 432

 Score =  274 bits (700), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 170

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 230

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 350

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 351 GRLEIFKIHTAHVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 410

Query: 451 LKAVEKVINGYKKFSSTSRY 470
           +KAV KV    KK   +  Y
Sbjct: 411 MKAVRKVAE-VKKLEGSLEY 429

>NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON}
           Anc_3.216
          Length = 376

 Score =  272 bits (695), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 188/281 (66%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
           G  V +     +I   L   +DP V++M +++ P  +Y D+GG + QI++++E VELPL 
Sbjct: 83  GCAVSLHHKTMSIVGVLQDDVDPMVSVMKIDKSPTESYGDIGGLEAQIQEIKEAVELPLT 142

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
            PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+
Sbjct: 143 HPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRL 202

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F++A      IIF DEI                E+QRTMLEL+ QLDGFD    +K
Sbjct: 203 VRQIFKVASENSPSIIFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSEVK 262

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRL 417
           V+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+ +E +   
Sbjct: 263 VIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDFETLVTT 322

Query: 418 CPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
             + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 323 KDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 363

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score =  274 bits (700), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P +++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 LVGL---VDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEESRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W  ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWSELARSTDEFNGAQLKAVAVEAGMIALRNGQSSVKHEDFVEAISEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for normal peptide hydrolysis by
           the core 20S particle
          Length = 437

 Score =  274 bits (700), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 191/284 (67%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+  E +
Sbjct: 321 DVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 381 VTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 424

>NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428
          Length = 434

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V PT ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPTKLKPNDLVGVNKDSYLILEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  +GRA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDGRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  274 bits (700), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 196/297 (65%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP +++M +++ P  +YSD+GG ++QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDTDPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYESNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PDL  +  I  IH+  MS+  D+  E +
Sbjct: 321 DVKVIMATNKIESLDPALIRPGRIDRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEEL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYM 471
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+    + +    YM
Sbjct: 381 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYM 437

>KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.216
           YDL007W
          Length = 436

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 191/284 (67%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 140 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVEL 199

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 200 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 259

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 260 PRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 319

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+  E +
Sbjct: 320 DVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDLEKL 379

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 380 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTSEDFEQAKERVL 423

>Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 191/284 (67%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+  E +
Sbjct: 321 DVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 381 VTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 424

>TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.708
           YOR259C
          Length = 443

 Score =  273 bits (699), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 200/320 (62%), Gaps = 1/320 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTAFEQ 181

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 301

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR +IF+IH+  +    +  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLDIFKIHTSKVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 421

Query: 451 LKAVEKVINGYKKFSSTSRY 470
           +KAV KV +  KK   +  Y
Sbjct: 422 MKAVRKV-SEVKKLEGSLEY 440

>Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  273 bits (698), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 191/284 (67%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEKEIQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+  E +
Sbjct: 321 DVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 381 VTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 424

>KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {ON}
           Anc_3.216 YDL007W
          Length = 435

 Score =  273 bits (698), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 183/260 (70%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 163 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 222

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 223 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGDNAPSIVFIDEI 282

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 283 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 342

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           DRK+ F  PDL  +  I  IH+  M++  D+  E +     + +GA++++VCTEAG+ A+
Sbjct: 343 DRKILFESPDLATKKKILGIHTSKMNLSADVDLEKLVTSKDDLSGADIQAVCTEAGLLAL 402

Query: 439 RARRKVASEKDFLKAVEKVI 458
           R RR   + +DF +A E+V+
Sbjct: 403 RERRMQVTAEDFKQAKERVM 422

>ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 437

 Score =  273 bits (697), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 189/284 (66%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP +  M +++ P   YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDADPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIRPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                EVQRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAAEHSPSIVFIDEIDAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           +IKV+ ATNR  TLDPAL+RPGRIDRK+ F  PD+  +  I  IH+  M++  D+R + +
Sbjct: 321 DIKVVMATNRIETLDPALIRPGRIDRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDEL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 381 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 424

>Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa]
           {ON} complement(182279..183592) [1314 nt, 438 aa]
          Length = 437

 Score =  272 bits (696), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 191/284 (67%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKEAVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PDL+ +  I  IH+  M++  D+  E +
Sbjct: 321 DVKVIMATNKIESLDPALIRPGRIDRKILFEQPDLQTKRKILTIHTSKMNLSEDVNLEQL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +  E+V+
Sbjct: 381 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQGKERVL 424

>Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007W
           (RPT2) - (putative) 26S protease subunit [contig 31]
           FULL
          Length = 376

 Score =  270 bits (690), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 198/310 (63%)

Query: 162 FVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 221
           F V +   V    +E G  V +     +I   L    DP + +M +++ P  +YSD+GG 
Sbjct: 67  FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPTESYSDIGGL 126

Query: 222 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 281
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 127 ESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 186

Query: 282 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 341
           +GSEL+QKY+G+G R+ R++F+ A      I+F DEI                E+QRTML
Sbjct: 187 VGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 246

Query: 342 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 401
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 247 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILTIHTS 306

Query: 402 SMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGY 461
            M++  D+  E +     + +GA+++++CTEAG+ A+R RR   + +DF +A E+++   
Sbjct: 307 KMNLAPDVDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERILKNK 366

Query: 462 KKFSSTSRYM 471
            + +  S Y+
Sbjct: 367 VEENLESLYL 376

>KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 432

 Score =  272 bits (695), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 129 MVGL---VDPVKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 185

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQGEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNAQSTIKHEDFVEAIGEV--QAR 423

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 424 KSKSVSFY 431

>KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {ON}
           Anc_5.428 YOR117W
          Length = 423

 Score =  271 bits (694), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 120 MVGL---VDPDTLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 176

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 177 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 236

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 237 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 296

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF    N+KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 297 LLNQLDGFSSDDNVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 356

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 357 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQASVKHEDFVDAIGEV--QAR 414

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 415 KSKSVSFY 422

>SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736)
           [1311 bp, 436 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 436

 Score =  271 bits (694), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 200/310 (64%)

Query: 162 FVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 221
           F V +   V    +E G  V +     +I   L    DP V++M +++ P  +YSD+GG 
Sbjct: 127 FYVSILSFVDKEMLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGL 186

Query: 222 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 281
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 187 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 246

Query: 282 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 341
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 247 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 306

Query: 342 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 401
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 307 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILGIHTS 366

Query: 402 SMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGY 461
            M++  DI  E +     + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+   
Sbjct: 367 KMNLSGDIDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNK 426

Query: 462 KKFSSTSRYM 471
            + +  S Y+
Sbjct: 427 VEENLESLYL 436

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score =  272 bits (695), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  ++
Sbjct: 123 KYIVKASSGPRYIVGVRNSVERSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFDQ 182

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  DQI +LREV+ELPL +PE F  +GI  P G+LLYGPPGTGKTL A+AV
Sbjct: 183 DNISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKSPTGVLLYGPPGTGKTLLAKAV 242

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 303 SADREIQRTLMELLTQMDGFDSLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 362

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  +F+IH+ ++    +  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEVFKIHTTNVKKAGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 451 LKAVEKVINGYKKFSSTSRYMQ 472
           +KAV KV    KK   T  Y +
Sbjct: 423 MKAVRKVAES-KKLEGTVDYQK 443

>Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AER254W
          Length = 432

 Score =  271 bits (693), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V+P  ++    VGV++  Y +   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 129 MVGL---VNPKKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 185

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQAEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVVKHEDFVEAISEV--QAR 423

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 424 KTKSVSFY 431

>CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117w YTA1
          Length = 429

 Score =  271 bits (693), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 126 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 182

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 183 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 242

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 243 APQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 302

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 303 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 362

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 363 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALRNGQSSVKHEDFVEAIGEV--QAR 420

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 421 KSKSVSFY 428

>Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  271 bits (693), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007w YTA5
          Length = 433

 Score =  271 bits (693), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 191/284 (67%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 137 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVEL 196

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 197 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 256

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 257 PRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 316

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+  E +
Sbjct: 317 DVKVIMATNKIESLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDLENL 376

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 377 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 420

>Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  271 bits (693), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; recruited to the GAL1-10 promoter region
           upon induction of transcription; similar to human TBP1
          Length = 434

 Score =  271 bits (693), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  271 bits (692), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 191/284 (67%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+  E +
Sbjct: 321 DVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLCEDVNLETL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 381 VTTKDDLSGADIQAMCTEAGLLALRERRMQVTGEDFKQAKERVM 424

>TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {ON}
           Anc_8.708 YOR259C
          Length = 455

 Score =  271 bits (694), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 199/320 (62%), Gaps = 1/320 (0%)

Query: 151 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEK 210
           KY++      +++VG+   +  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 134 KYIVKASSGPRYIVGVRNSIDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 193

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 194 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 253

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 254 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKDHEPCIIFMDEVDAIGGRRFSEGT 313

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
               E+QRT++EL+TQ+DGF+  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 314 SADREIQRTLMELLTQMDGFENLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 373

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDF 450
           GR  IF+IH++ +    +  +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 374 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNHIIPEDL 433

Query: 451 LKAVEKVINGYKKFSSTSRY 470
           +KAV KV    KK   +  Y
Sbjct: 434 MKAVRKVAE-VKKLEGSLEY 452

>Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL011W
          Length = 437

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 194/297 (65%)

Query: 162 FVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 221
           F V +   V    +E G  V +     +I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGALQDDADPMVSVMKIDKSPAESYNDIGGL 187

Query: 222 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 281
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 282 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 341
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 342 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 401
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTKRKILGIHTS 367

Query: 402 SMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
            M++  D+  E +       +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 368 KMNLSEDVNLETLVTSKDELSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 190/284 (66%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHNKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLEAQIQEIKEAVEL 200

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+ R++F++A      I+F DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IH+  M++  D+  E +
Sbjct: 321 DVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLAEDVDLETL 380

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + +DF +  E+V+
Sbjct: 381 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQGKERVL 424

>KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMQRADKFKDLGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  270 bits (691), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKQSEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEEARAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KTKSVSFY 433

>Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {ON}
           complement(71197..72501) [1305 nt, 435 aa]
          Length = 434

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+   DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTADDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.216
           YDL007W
          Length = 434

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 189/284 (66%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVEL 234
           +E G  V +     +I   L    DP V++M +++ P  TYSD+GG + QI++++E VEL
Sbjct: 138 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTETYSDIGGLESQIQEIKEAVEL 197

Query: 235 PLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 294
           PL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 198 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 257

Query: 295 ARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 354
            R+VR++F++A      I+F DEI                E+QRTMLEL+ QLDGFD   
Sbjct: 258 PRLVRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTS 317

Query: 355 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELI 414
           ++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PDL  +  I  IH+  MS+  D+  + +
Sbjct: 318 DVKVIMATNKIESLDPALIRPGRIDRKILFENPDLSTKRKILAIHTSKMSLSEDVSLDEL 377

Query: 415 SRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
                + +GA+++++CTEAG+ A+R RR   + KDF +  E+V+
Sbjct: 378 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAKDFEQGKERVL 421

>AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL007W (RPT2)
          Length = 437

 Score =  270 bits (689), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 195/297 (65%)

Query: 162 FVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 221
           F V +   V    +E G  V +     +I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYNDIGGL 187

Query: 222 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 281
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 282 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 341
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 342 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 401
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDVSTKRKILGIHTS 367

Query: 402 SMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
            M++  D+  E +     + +GA+++++CTEAG+ A+R RR   + +DF +A E+V+
Sbjct: 368 KMNLSADVDLETLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {ON}
           Anc_5.428 YOR117W
          Length = 434

 Score =  270 bits (689), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDTLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVDAIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 434

 Score =  269 bits (688), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEG+++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  268 bits (686), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP   YSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTENYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     IKV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON}
           Anc_5.428
          Length = 482

 Score =  270 bits (690), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V PT ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 179 MVGL---VDPTKLKPNDLVGVNKDSYLVLEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 235

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 236 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 295

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 296 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 355

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 356 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 415

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 416 MTTDNDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 473

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 474 KSKSVSFY 481

>Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {ON}
           YOR117W (RPT5) - 26S protease regulatory subunit [contig
           130] FULL
          Length = 434

 Score =  268 bits (686), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEG+++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085)
           [1368 bp, 455 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 455

 Score =  268 bits (686), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 192/297 (64%)

Query: 162 FVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC 221
           F V +   V    +E G  V +     +I   L    DP + +M +++ P   YSD+GG 
Sbjct: 146 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPTENYSDIGGL 205

Query: 222 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 281
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 206 ESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 265

Query: 282 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 341
           +GSEL+QKY+G+G R+ R++F+ A      I+F DEI                E+QRTML
Sbjct: 266 VGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 325

Query: 342 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSK 401
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IH+ 
Sbjct: 326 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTKRKILAIHTS 385

Query: 402 SMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVI 458
            M++  D+  + +     + +GA+++++CTEAG+ A+R RR   + +DF +A E+++
Sbjct: 386 KMNLATDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERIL 442

>KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 434

 Score =  267 bits (683), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 122/260 (46%), Positives = 182/260 (70%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           DP V++M +++ P   YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTENYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 281

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYESNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 341

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           DRK+ F  PD+  +  I  IH+  M++  D+  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDITTKRKIVGIHTSKMNLAEDVDLDNLVTSKDDLSGADIKAMCTEAGLLAL 401

Query: 439 RARRKVASEKDFLKAVEKVI 458
           R RR   + +DF +A E+V+
Sbjct: 402 RERRMQVTAQDFKEAKERVL 421

>AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR117W (RPT5)
          Length = 460

 Score =  268 bits (684), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 157 MVGL---VDPKQLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 213

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 214 KQIEELVEAIVLPMKQADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 273

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 274 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 333

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IHS+ 
Sbjct: 334 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 393

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 394 MTSDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVIKHEDFVEAIGEV--QAR 451

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 452 KTKSVSFY 459

>ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  267 bits (682), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 163 VVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 222
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 223 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 282
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFTDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 283 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 342
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 343 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS 402
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF +P  + RA I +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVVAATNRVDVLDPALLRSGRLDRKIEFPIPSEDSRAQILQIHSRK 367

Query: 403 MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYK 462
           M+ + DI W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MATDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 463 KFSSTSRY 470
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score =  255 bits (651), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 177/276 (64%), Gaps = 1/276 (0%)

Query: 179 MRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLS 238
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+ 
Sbjct: 135 MSVALHRHSNALVDILPPDSDSSISIMGANEKPDVTYADVGGLDMQKQEIREAVELPLVQ 194

Query: 239 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 298
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 195 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 254

Query: 299 RELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 358
           R++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 255 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 314

Query: 359 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISRL 417
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +   
Sbjct: 315 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIVR 374

Query: 418 CPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
             + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 375 NDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 453

 Score =  254 bits (649), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 135/290 (46%), Positives = 180/290 (62%), Gaps = 4/290 (1%)

Query: 179 MRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLS 238
           M V + R    + + LPP  D S+++M   EKPDVTYSDVGG   Q +++RE VELPL  
Sbjct: 160 MSVALHRHSNALVVILPPDSDSSISIMNESEKPDVTYSDVGGLDIQKQEIREAVELPLTQ 219

Query: 239 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 298
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMV
Sbjct: 220 ADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMV 279

Query: 299 RELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 358
           R++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 280 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELMTQMDGFDQSTNVKV 339

Query: 359 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISRL 417
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +   
Sbjct: 340 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIR 399

Query: 418 CPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVE---KVINGYKKF 464
             + +GA + ++  EAG+ A+R  R V  + D  +A +   K  N   KF
Sbjct: 400 NDSLSGAVIAAIMQEAGLRAVRRNRYVILQSDLEEAYDAQVKTENDVDKF 449

>KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates
          Length = 428

 Score =  253 bits (645), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 174/263 (66%), Gaps = 5/263 (1%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 150 LPPDSDSSISIMAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 209

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 210 LLYGPPGTGKTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 269

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 270 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 329

Query: 374 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSV--ERDIRWELISRLCPNTTGAELRSVC 430
           RPGR+DRK+EF SL D   R  IF   +  MS+  E D+   LI R  P  +GA + ++ 
Sbjct: 330 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLD-SLIIRNDP-LSGALIAAIM 387

Query: 431 TEAGMFAIRARRKVASEKDFLKA 453
            EAG+ A+R  R V  + D  +A
Sbjct: 388 QEAGLRAVRKNRYVILQSDLEEA 410

>NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  253 bits (645), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 130/277 (46%), Positives = 177/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 251

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLII 371

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 RNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  252 bits (644), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 134/291 (46%), Positives = 180/291 (61%), Gaps = 4/291 (1%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGSNEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QGDLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVASKMSLAPEADLDSLII 371

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVE---KVINGYKKF 464
              + +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 372 RNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYTAQVKTDNDVDKF 422

>Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {ON}
           similar to Ashbya gossypii AFR394W
          Length = 425

 Score =  251 bits (642), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 130/262 (49%), Positives = 175/262 (66%), Gaps = 3/262 (1%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISILGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 326

Query: 374 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWE-LISRLCPNTTGAELRSVCT 431
           RPGR+DRK+EF SL D   R  IF   +  MS+  ++  + LI R  P  +GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDP-LSGALIAAIMQ 385

Query: 432 EAGMFAIRARRKVASEKDFLKA 453
           EAG+ A+R  R V  ++D  +A
Sbjct: 386 EAGLRAVRKNRYVILQRDLEEA 407

>Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  251 bits (642), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 130/277 (46%), Positives = 175/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLII 373

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 374 RNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5.486
           YDR394W
          Length = 431

 Score =  251 bits (642), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 127/261 (48%), Positives = 172/261 (65%), Gaps = 1/261 (0%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISIMGDNEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 272

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 374 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTE 432
           RPGR+DRK+EF SL D   R  IF   +  MS+  +   + +     + +GA + ++  E
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIVRNDSLSGAIIAAIMQE 392

Query: 433 AGMFAIRARRKVASEKDFLKA 453
           AG+ A+R  R V  + D  +A
Sbjct: 393 AGLRAVRKNRYVILQSDLEEA 413

>YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; substrate of N-acetyltransferase B
          Length = 428

 Score =  251 bits (641), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 130/277 (46%), Positives = 175/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLII 373

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 374 RNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score =  252 bits (644), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 172/259 (66%), Gaps = 3/259 (1%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 189 LPPDSDSSISIMGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 248

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 249 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 308

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 309 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 368

Query: 374 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWE-LISRLCPNTTGAELRSVCT 431
           RPGR+DRK+EF SL D   R  IF   +  MS+  ++  + LI R  P  +GA + ++  
Sbjct: 369 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDP-LSGALIAAIMQ 427

Query: 432 EAGMFAIRARRKVASEKDF 450
           EAG+ A+R  R V  + D 
Sbjct: 428 EAGLRAVRKNRYVILQSDL 446

>Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  251 bits (641), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 130/277 (46%), Positives = 175/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLII 373

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 374 RNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {ON}
           Anc_5.486 YDR394W
          Length = 425

 Score =  251 bits (640), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 175/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL 
Sbjct: 131 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLT 190

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +G+DPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 191 QADLYEQIGVDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 250

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 251 VRDVFRLARENAPAIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 310

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 311 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFSTIAGKMSLAPETDLDSLII 370

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 371 RNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 407

>CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394w YTA2 26S proteasome regulatory subunit
          Length = 431

 Score =  251 bits (640), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 127/261 (48%), Positives = 170/261 (65%), Gaps = 1/261 (0%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T A FIRV GSE VQKY+GEG RMVR++F +AR     I+
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIV 272

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 374 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTE 432
           RPGR+DRK+EF SL D   R  IF   +  MS+  +   + +       +GA + ++  E
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDAISGAVIAAIMQE 392

Query: 433 AGMFAIRARRKVASEKDFLKA 453
           AG+ A+R  R V  + D  +A
Sbjct: 393 AGLRAVRKNRYVILQSDLEEA 413

>TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {ON}
           Anc_5.486 YDR394W
          Length = 429

 Score =  250 bits (639), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 175/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 135 SMSVALHRHSNALVDILPPDSDSSISILGSGEKPDVTYADVGGLDMQKQEIREAVELPLV 194

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 195 QADLYEQIGIDPPSGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 254

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 255 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 314

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 315 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLII 374

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 375 RNDSLSGATIAAIMQEAGLRAVRKNRYVILQNDLEEA 411

>SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  250 bits (638), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 173/263 (65%), Gaps = 5/263 (1%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 266

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 326

Query: 374 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSV--ERDIRWELISRLCPNTTGAELRSVC 430
           RPGR+DRK+EF SL D   R  IF   +  MS+  E D+   LI R  P  +GA + ++ 
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLD-SLIIRNDP-LSGALIAAIM 384

Query: 431 TEAGMFAIRARRKVASEKDFLKA 453
            EAG+ A+R  R V  + D  +A
Sbjct: 385 QEAGLRAVRKNRYVILQSDLEEA 407

>Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  250 bits (638), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 175/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M   EKPDV+Y+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGESEKPDVSYADVGGLDMQKQEIREAVELPLV 193

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLII 373

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 374 RNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {ON}
           Anc_5.486 YDR394W
          Length = 432

 Score =  249 bits (637), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/294 (44%), Positives = 181/294 (61%), Gaps = 1/294 (0%)

Query: 161 KFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 220
            +VV +   +    ++  M V + R    +   LPP  D S+ +M   EKPDVTY+DVGG
Sbjct: 121 NYVVRILSTLDREQLKPSMSVALHRHSNALVDILPPDSDSSIAVMGENEKPDVTYADVGG 180

Query: 221 CKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 280
              Q +++RE VELPL   + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIR
Sbjct: 181 LDMQKQEIREAVELPLTQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIR 240

Query: 281 VIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTM 340
           V GSE V KY+GEG RMVR++F +AR     IIF DE+                EVQR +
Sbjct: 241 VNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRIL 300

Query: 341 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIH 399
           +EL+TQ+DGFD   N+KV+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   
Sbjct: 301 IELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTV 360

Query: 400 SKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
           +  M++  +   + +     + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 361 AAKMALAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 414

>TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.486
           YDR394W
          Length = 426

 Score =  242 bits (617), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 130/277 (46%), Positives = 176/277 (63%), Gaps = 1/277 (0%)

Query: 178 GMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 237
            M V + R    +   LPP  D S+++M+  EKPDVTY+DVGG   Q +++RE VELPL 
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISIMSENEKPDVTYADVGGLDMQKQEIREAVELPLT 191

Query: 238 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 297
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 298 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 357
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 358 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWELISR 416
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   +  MS+  +   + +  
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPETDLDSLII 371

Query: 417 LCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKA 453
              + +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 RNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  240 bits (612), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 174/262 (66%), Gaps = 3/262 (1%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S+++M+  EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMSANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T+  FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALL 326

Query: 374 RPGRIDRKVEF-SLPDLEGRANIFRIHSKSMSVERDIRWE-LISRLCPNTTGAELRSVCT 431
           RPGR+DRK+EF SL D   R  IF   +  M++  ++  + LI R  P  +GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDP-LSGALIAAIMQ 385

Query: 432 EAGMFAIRARRKVASEKDFLKA 453
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON}
           complement(19429..21867) [2439 nt, 813 aa]
          Length = 812

 Score =  208 bits (530), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F T+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 202 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 261

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 262 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 317

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 318 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 377

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E I+       GA++ S+C+EA M  IR +
Sbjct: 378 GRLEVLRIHTKNMKLADDVDLESIAAETHGFVGADIASLCSEAAMQQIREK 428

 Score =  175 bits (443), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 137/241 (56%), Gaps = 3/241 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 462 NPSALRETVVENVNVTWDDIGGLDEIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 521

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 522 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 581

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 582 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 638

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I +   +   +E  +    I++     +GA+L  +   A  FAI
Sbjct: 639 DQLIYVPLPDETARLSILKAQLRKSPLEPGLDLNAIAKSTQGFSGADLSYIAQRAAKFAI 698

Query: 439 R 439
           +
Sbjct: 699 K 699

>TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7.288
           YDL126C
          Length = 852

 Score =  209 bits (531), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 214 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 273

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 274 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 329

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 330 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAA 389

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E+I+       GA++ S+C+EA M  IR +
Sbjct: 390 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 440

 Score =  178 bits (452), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 135/241 (56%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 474 NPSALRETVVENVNVTWDDIGGLDDIKNELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 533

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 534 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 593

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 594 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 653

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     +   +E  +    I++     +GA+L  +   A  FAI
Sbjct: 654 DQLIYVPLPDEVARESILSAQLRKSPIEPGVDLTAIAKATKGFSGADLSYIAQRAAKFAI 713

Query: 439 R 439
           +
Sbjct: 714 K 714

>TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  208 bits (529), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREK 436

 Score =  180 bits (457), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I +   +   +E  +    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDLNAISKATQGFSGADLSYIVQRAAKFAI 709

Query: 439 R----ARRKVASEK 448
           +    A+R++ ++K
Sbjct: 710 KDSIEAQRQLEAKK 723

>NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288
          Length = 601

 Score =  204 bits (518), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 43  DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 102

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 103 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 158

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN +DPAL R GR DR+V+  +PD  
Sbjct: 159 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNAIDPALRRFGRFDREVDIGIPDAV 218

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I RIH+K+M +  D+  E ++       G+++ S+C+EA M  IR +
Sbjct: 219 GRLEILRIHTKNMKLADDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 269

 Score =  174 bits (442), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 138/241 (57%), Gaps = 1/241 (0%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 303 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 362

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 363 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 422

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 423 -DSIAKARGGSMGEGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 481

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     ++  +E  +   LI++     +GA+L  +   A  FAI
Sbjct: 482 DQLIYVPLPDEVARLSILHAQLRNTPLEPGLDLSLIAKASQGFSGADLSYIVQRAAKFAI 541

Query: 439 R 439
           +
Sbjct: 542 K 542

>TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON}
           Anc_7.288 YDL126C
          Length = 847

 Score =  207 bits (526), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           D+ Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 217 DIGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLIYGPPGTGKTLMARAVA 276

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 277 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 332

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 333 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAT 392

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E+I+       GA++ S+C+EA M  IR +
Sbjct: 393 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 443

 Score =  177 bits (448), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 147/258 (56%), Gaps = 4/258 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  D   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 477 NPSALRETVVENVNVTWDDIGGLDDIKSELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 536

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 537 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 596

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ LDPA+LRPGR+
Sbjct: 597 DSIAKARGHNAGDDASD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQLDPAILRPGRL 654

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I +   +   +E  +    I++     +GA+L  +   A  +AI
Sbjct: 655 DQLIYVPLPDEVARLSILKAQLRKSPLEPGVDLTAIAKATKGFSGADLSYIAQRAAKYAI 714

Query: 439 RARRKVASEKDFLKAVEK 456
             +  + ++ +F K+ E+
Sbjct: 715 --KESIEAQIEFEKSKEE 730

>Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {ON}
           complement(25249..27720) [2472 nt, 824 aa]
          Length = 823

 Score =  206 bits (525), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F T+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLVDDVDLESLAAETHGYVGADIASLCSEAAMQQIREK 435

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 143/254 (56%), Gaps = 3/254 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG +D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWDDIGGLEDIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 528

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     +   +E  +    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILNAQLRKTPLEPGLDLGAIAKTTQGFSGADLSYIVQRAAKFAI 708

Query: 439 RAR---RKVASEKD 449
           +     ++V SE+D
Sbjct: 709 KESIEAQRVKSEED 722

>KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane
           and cytosol with homology to mammalian p97 in a complex
           with Npl4p and Ufd1p participates in retrotranslocation
           of ubiquitinated proteins from the ER into the cytosol
           for degradation by the proteasome
          Length = 830

 Score =  206 bits (525), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD+ 
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 139/241 (57%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD  GR +I     ++  +E  +  + I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDETGRLSILSAQLRNTPLEPGLDLKTIAQATQGFSGADLLYIVQRAAKFAI 709

Query: 439 R 439
           +
Sbjct: 710 K 710

>SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 842

 Score =  206 bits (525), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPSIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  179 bits (454), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 144/255 (56%), Gaps = 4/255 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG     E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDGIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I +   ++  +E  +    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDDTARLSILKAQLRNTPLEPGLDLGAISKATQGFSGADLSYIAQRAAKFAI 709

Query: 439 R----ARRKVASEKD 449
           +    A+R+   E++
Sbjct: 710 KDSIEAQRRAQIERE 724

>KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 832

 Score =  206 bits (524), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  180 bits (457), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 144/254 (56%), Gaps = 4/254 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     ++  +E  +    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 439 R----ARRKVASEK 448
           +    A+R+  +E+
Sbjct: 710 KDSIEAQRRALAEQ 723

>NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON} 
          Length = 825

 Score =  206 bits (523), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 270

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E I+       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEVLRIHTKNMKLADDVDLEYIASETHGYVGADIASLCSEAAMQQIREK 437

 Score =  177 bits (450), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 147/262 (56%), Gaps = 5/262 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDIGGLDEIKQELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 530

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARASAPTVVFLDEL 590

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 --DSIAKARGNSAGDNGSDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I +   +   +E  +    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLNAIAKAAQGFSGADLSYIVQRAAKFAI 708

Query: 439 RAR---RKVASEKDFLKAVEKV 457
           +     +K+  E   +KA E +
Sbjct: 709 KESIELQKLLEESKEVKAEEDI 730

>KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  206 bits (524), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  176 bits (447), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 137/241 (56%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     ++  +E  +    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILGAQLRNTPLEPGLDLTAIAKATTGFSGADLSYIAQRAAKYAI 709

Query: 439 R 439
           +
Sbjct: 710 K 710

>NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {ON} 
          Length = 842

 Score =  206 bits (523), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 216 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 275

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 276 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 331

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 332 TNGEVERRVVSQLLTLMDGMKTRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAV 391

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I RIH+K+M +  D+  E ++       G+++ S+C+EA M  IR +
Sbjct: 392 GRLEILRIHTKNMKLSDDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 442

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 141/250 (56%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 476 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 535

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 536 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 595

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 596 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 655

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I R   +   +E  +  E I++     +GA+L  +   A  FAI
Sbjct: 656 DQLIYVPLPDEIARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 715

Query: 439 RARRKVASEK 448
           +   +   EK
Sbjct: 716 KESIEAQKEK 725

>NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {ON}
           Anc_7.288
          Length = 825

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLADDVDLEYLANETHGYVGADIASLCSEAAMQQIREK 435

 Score =  181 bits (460), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 142/241 (58%), Gaps = 2/241 (0%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT++D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWNDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 528

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGNSMGDGGSD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD E R +I R   +   +E  +  E I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEEARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 706

Query: 439 R 439
           +
Sbjct: 707 K 707

>Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  205 bits (522), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  178 bits (451), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 91/255 (35%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     +   +E  +    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 439 R----ARRKVASEKD 449
           +    A R+  +EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL126C
           (CDC48) - microsomal ATPase [contig 12] FULL
          Length = 831

 Score =  205 bits (521), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  179 bits (453), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     ++  +E  +    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELTSIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 439 R----ARRKVASEKD 449
           +    A+++  +E++
Sbjct: 710 KDSIEAQKRAEAERE 724

>Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii AFR158W
          Length = 836

 Score =  204 bits (520), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I  IH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILHIHTKNMRLADDVNLETLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD  GR +I +   +   +E  +    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEVGRISILKAQLRKAPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 439 R----ARRKVASEK 448
           R    A+++ A+EK
Sbjct: 711 RDSIEAQKRSAAEK 724

>KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7.288
           YDL126C
          Length = 824

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEILRIHTKNMKLADDVDLETLAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 137/241 (56%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  D  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDDIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     ++  +E  +    IS+     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILNAQLRNTPLEPGLDLSAISKATQGFSGADLSYIVQRAAKYAI 709

Query: 439 R 439
           +
Sbjct: 710 K 710

>Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  177 bits (450), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 91/255 (35%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     +   +E  +    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 439 R----ARRKVASEKD 449
           +    A ++  +EK+
Sbjct: 710 KDSIEAHKQHEAEKE 724

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  177 bits (450), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 144/257 (56%), Gaps = 2/257 (0%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I +   +   +E  +    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKYAI 709

Query: 439 RARRKVASEKDFLKAVE 455
             +  + + ++ L A E
Sbjct: 710 --KDSIEAHRESLAAAE 724

>Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON}
           YDL126C (REAL)
          Length = 836

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  179 bits (453), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     +   +E  +    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGMELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 439 R----ARRKVASEKD 449
           +    A R+  +EK+
Sbjct: 710 KDSIEAHRQREAEKE 724

>YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}
           CDC48AAA ATPase involved in multiple processes; subunit
           of a polyubiquitin-selective segregase complex involved
           in ERAD, cell wall integrity during heat stress and
           mitotic spindle disassembly; subunit of a complex
           involved in mitochondria-associated degradation; role in
           mobilizing membrane bound transcription factors by
           regulated ubiquitin/proteasome-dependent processing;
           roles in macroautophagy, PMN, ribophagy, and homotypic
           ER membrane fusion; functional ortholog of p97/VCP
          Length = 835

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  179 bits (454), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R +I     +   +E  +    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 439 R----ARRKVASEKD 449
           +    A R+  +EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL126C (CDC48)
          Length = 832

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I  IH+K+M +  D+  E+++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILNIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 137/241 (56%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ DVGG  D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD  GR +I +   +   +E  +    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 439 R 439
           R
Sbjct: 711 R 711

>ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 830

 Score =  204 bits (518), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  180 bits (457), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/255 (35%), Positives = 146/255 (57%), Gaps = 4/255 (1%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +V+++DVGG ++  E+LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVSWADVGGLEEIKEELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD   R  I +   +   +E  +    ++++    +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEAARLGIMKAQLRKTPLEPGLELSQLAKVTQGFSGADLSYIVQRAAKFAI 709

Query: 439 R----ARRKVASEKD 449
           +    A R+  ++K+
Sbjct: 710 KDSIEAHRQAEAKKE 724

>TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {ON}
           Anc_7.288 YDL126C
          Length = 826

 Score =  203 bits (516), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 272 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 331
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 332 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 391 GRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  + RIH+K+M +  D+  E ++       GA++ S+C+E  M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLSDDVDLETLAAETHGYVGADIASLCSEGAMQQIREK 436

 Score =  177 bits (450), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/260 (36%), Positives = 144/260 (55%), Gaps = 12/260 (4%)

Query: 199 DPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 258
           +PS    TV E  +VT+ D+GG  +   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKRELRETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 259 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 318
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 319 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 378
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 379 DRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           D+ +   LPD  GR +I     +   +E  +    I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEVGRLSILEAQLRKSPLEPGLDLRAIAKASQGFSGADLSYIAQRAAKFAI 706

Query: 439 R---------ARRKVASEKD 449
           +           +KV SE+D
Sbjct: 707 KDSIEAHKLAESKKVKSEED 726

>NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34
          Length = 1329

 Score =  196 bits (499), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 112/281 (39%), Positives = 162/281 (57%), Gaps = 29/281 (10%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 393 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 452

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 453 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 512

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 513 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 569

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAIRARRKV- 444
           PDL+ RA I +IH+K  +   D  + E +++L     GA+LR++CTEA +F+I  +RK  
Sbjct: 570 PDLKARAKILQIHTKKWNPPLDPEFIENLAKLTKGYGGADLRALCTEAALFSI--QRKFP 627

Query: 445 ----ASEK-------------DFLKAVEKVINGYKKFSSTS 468
               +SEK             DF+ A+EK++    + S  S
Sbjct: 628 QIYRSSEKLQVDPKLVRVHTTDFMLALEKIVPSSARSSGNS 668

>Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {OFF}
           YDR394W (RPT3) - ATPase (AAA family) component of the
           26S proteasome complex [contig 189] PARTIAL
          Length = 302

 Score =  180 bits (456), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYRQIGIDPPRGV 206

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 349
           F DE+                EVQR ++EL+TQ+DG
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDG 302

>ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1420

 Score =  191 bits (484), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 158/269 (58%), Gaps = 25/269 (9%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 432 NVKFEDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 491

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+ ++  +IFFDEI        
Sbjct: 492 ASCSSEGRKITFFMRKGADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRS 551

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 552 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 608

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAI------- 438
           PD+ GR  I +IH+K+      +++ + ++ L     GA+LR++CTEA + +I       
Sbjct: 609 PDVRGREKIIKIHTKNWKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQI 668

Query: 439 -RARRKVASE--------KDFLKAVEKVI 458
            R+  K+A +        KDF+ A++K++
Sbjct: 669 YRSNEKLAVDPNKVKVGVKDFMMALKKIV 697

>TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5.34
           YGR270W
          Length = 1400

 Score =  191 bits (484), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 155/270 (57%), Gaps = 27/270 (10%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + DVGG  + I++L+E++ LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 429 NINFDDVGGLDNYIDQLKEMITLPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 488

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 489 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 548

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 549 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 605

Query: 387 PDLEGRANIFRIHSKSMS--VERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR--- 441
           PD++ RA I  IH++  +  +++ +  +L + L     GA+LR++CTEA + +I+ +   
Sbjct: 606 PDIDARAKILEIHTRKWNPPLQKPVILQL-ANLTKGYGGADLRALCTEAALISIQHKYPQ 664

Query: 442 -------------RKVASEKDFLKAVEKVI 458
                        +   S  DF+ A+EK++
Sbjct: 665 IYRSNDKLDVDPSKITVSTSDFMLALEKIV 694

>TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1294

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 142/234 (60%), Gaps = 9/234 (3%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 372 NVKFGDIGGLDNFIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 431

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 432 ASCSSEGHKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS 491

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 492 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 548

Query: 387 PDLEGRANIFRIHSKSMSVE-RDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+LE RA I RIH+KS      D   + ++ L     GA+LR++CTEA + +I+
Sbjct: 549 PNLESRAQILRIHTKSWKTSLSDDFVKHLALLTKGYGGADLRALCTEAALLSIQ 602

>KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1261

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 99/236 (41%), Positives = 142/236 (60%), Gaps = 9/236 (3%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++++ DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 347 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLVARALA 406

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 407 ASCSSDSKKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 466

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ LDPAL RPGR DR+  F L
Sbjct: 467 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDALDPALRRPGRFDREFYFPL 523

Query: 387 PDLEGRANIFRIHSKSMSVE-RDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           PD + RA I +IH+K+      D   E + ++     GA+LR++CTEA +F I+ +
Sbjct: 524 PDSKARAKILKIHTKNWHPSLSDEFIENLVKMTKGYGGADLRALCTEAALFCIQRK 579

>KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1333

 Score =  189 bits (481), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 155/279 (55%), Gaps = 45/279 (16%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + DVGG  + I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 405 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 464

Query: 272 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
                 +   TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 465 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 524

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 525 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 581

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWE------LISRLCPNTT---GAELRSVCTEAGMFA 437
           PDL  R+ I  IH+K        +W+       I RL   T    GA+LR++CTEA + +
Sbjct: 582 PDLSARSKILEIHTK--------KWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALIS 633

Query: 438 IRARRKV------------------ASEKDFLKAVEKVI 458
           I  +RKV                     +DF+ A+EK++
Sbjct: 634 I--QRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIV 670

>NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {ON}
           Anc_5.34
          Length = 1348

 Score =  189 bits (481), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 159/279 (56%), Gaps = 25/279 (8%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++++ DVGG  + I++L+E+V LPLL PE + T  I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPRGVLFHGPPGTGKTLMARALA 470

Query: 272 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
                +    TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 471 ASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 530

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 587

Query: 387 PDLEGRANIFRIHSKSMSVE-RDIRWELISRLCPNTTGAELRSVCTEAGMFAI------- 438
           PD + R+ I +IH+K  +    D   + ++ L     GA+LR++CTEA +F I       
Sbjct: 588 PDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYGGADLRALCTEAALFCIQRKFPQI 647

Query: 439 -RARRKV--------ASEKDFLKAVEKVINGYKKFSSTS 468
            R+  K+         +  DF+ A+EK++    + + +S
Sbjct: 648 YRSNEKLLVDPKDLKVTPTDFMLALEKIVPSSARSTGSS 686

>CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {ON}
           similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270w YTA7
          Length = 1317

 Score =  189 bits (481), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + DVGG  + IE+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 392 NIKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARALA 451

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 452 ASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 511

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 512 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 568

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTT---GAELRSVCTEAGMFAI----- 438
           PD   R  I +IH+K  S    +  ELI RL   T    GA+LR++CTEA + +I     
Sbjct: 569 PDTNARKTILKIHTKKWSPP--LSDELIHRLASLTKGYGGADLRALCTEAALSSIQRTYP 626

Query: 439 ---RARRKV--------ASEKDFLKAVEKVI 458
              R+  K+         +  DF +A+EK++
Sbjct: 627 QIYRSSGKLLIDTDLIRVNSSDFTRALEKIV 657

>Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON}
           (53678..57811) [4134 nt, 1378 aa]
          Length = 1377

 Score =  189 bits (479), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 107/270 (39%), Positives = 160/270 (59%), Gaps = 27/270 (10%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           D+ + +VGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 DINFEEVGGLDNYIDQLKEMVTLPLLYPEVYQNFNITPPRGVLFHGPPGTGKTLMARALA 495

Query: 272 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXX 325
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 496 ASCSTGNRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 554

Query: 326 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 385
                   + +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 555 SSKQEQIHSSIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 611

Query: 386 LPDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAI------ 438
           LPD++ R+ I  IH+K  +   + +  + ++RL     GA+LRS+CTEA + +I      
Sbjct: 612 LPDVKARSIILGIHTKKWNPPPNKKLIDDLARLTKGYGGADLRSLCTEAALISIQRKFPQ 671

Query: 439 --RARRKV--------ASEKDFLKAVEKVI 458
             ++ +K+         S  DF+ A+EK++
Sbjct: 672 IYKSEQKLMVDPTKIRVSYGDFMLALEKIV 701

>KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1319

 Score =  189 bits (479), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 155/271 (57%), Gaps = 29/271 (10%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 400 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 459

Query: 272 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 460 ASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPVRS 519

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  TML L   +DG D RG I ++ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 520 SKQEQIHASIVSTMLAL---MDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL 576

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTT---GAELRSVCTEAGMFAIRAR-- 441
           PDL+ R  I  IH+K  +    I  + IS+L   T    GA+LR++CTEA + +I+ +  
Sbjct: 577 PDLKARDKILHIHTKKWNPP--ISDQFISKLASLTKGYGGADLRALCTEASLISIQRKFP 634

Query: 442 RKVASE--------------KDFLKAVEKVI 458
           +   SE              +DF+ A+EK++
Sbjct: 635 QIYKSEEKLKIDPKSVRVKARDFMLALEKIV 665

>TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1426

 Score =  188 bits (478), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 156/270 (57%), Gaps = 27/270 (10%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 NINFDDVGGLDNYIDQLKEMVSLPLLYPELYQNFNISPPRGVLFHGPPGTGKTLMARALA 495

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 496 ASCSSDDRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKNQPSIIFFDEIDGLAPVRS 555

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 556 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 612

Query: 387 PDLEGRANIFRIHSKSMS--VERDIRWELISRLCPNTTGAELRSVCTEAGMFAI------ 438
           PDLE R  I  IH+K  +  +  + R + ++RL     GA+LR++CT+A + +I      
Sbjct: 613 PDLEAREKIIGIHTKKWNPPLSSEFR-KTLARLTKGFGGADLRALCTDAVLISIQRQYPQ 671

Query: 439 --RARRKVASE--------KDFLKAVEKVI 458
             R+ +K+  +         DF+ A+EK+I
Sbjct: 672 IYRSNKKLKIDPTSVKININDFMIALEKLI 701

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 144/261 (55%), Gaps = 7/261 (2%)

Query: 183 VDRSKYNIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLS 238
           +DRSK  + L         I PS       E P V +SD+GG  D   K++EV++LPL +
Sbjct: 480 IDRSKLQVTLKDVENAMAEIRPSAMREIFLEMPKVYWSDIGGQDDLKRKMKEVIQLPLEA 539

Query: 239 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 298
            E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +
Sbjct: 540 AETFANLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAI 599

Query: 299 RELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 358
           RE+F  AR     IIFFDEI                     +  L+ ++DG +    + +
Sbjct: 600 REIFRKARAASPSIIFFDEIDAISAARDGGSSTAA--ASHVLTSLLNEIDGVEELNGVVI 657

Query: 359 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE-RDIRWELISRL 417
           + ATNRP+ +DPALLRPGR+DR +  + PD E R  I +  +   ++E  ++  E +++ 
Sbjct: 658 VAATNRPDEIDPALLRPGRLDRHIYVAPPDYEARLQILKKRTGKFNLEGSNVNLEELAKH 717

Query: 418 CPNTTGAELRSVCTEAGMFAI 438
               +GAE+  +C EAG+ AI
Sbjct: 718 TEGCSGAEVVLLCQEAGLAAI 738

 Score =  172 bits (435), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 138/230 (60%), Gaps = 8/230 (3%)

Query: 215 YSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 274
           Y+DVGG K +I+ L + +ELPL  P  F+  GI+PP+G+LL+GPPGTGKT+  R VAN +
Sbjct: 245 YNDVGGLKREIDSLTKTIELPLHQPNLFSDFGINPPRGVLLHGPPGTGKTMLLRCVANSS 304

Query: 275 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN 334
           +A  + + G  +V KY+GE    +RE+F+ A+  +  IIF DEI                
Sbjct: 305 NAHVLTINGPSIVSKYLGETEAKLREIFDEAQKYQPSIIFIDEI---DSLAPNRANDDSG 361

Query: 335 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 393
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ R 
Sbjct: 362 EVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARF 421

Query: 394 NIFRIHSKSMSVERD-IRWELISRLCPNT---TGAELRSVCTEAGMFAIR 439
           +I +     MS ER  +  + I  +   T    GA+L ++C E+ M  I+
Sbjct: 422 DILKKQFSRMSEERHTLNEDDIKNIASKTHGYVGADLSALCRESVMKTIQ 471

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score =  187 bits (474), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 152/268 (56%), Gaps = 25/268 (9%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L YGPPGTGKTL ARA+A
Sbjct: 366 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFYGPPGTGKTLMARALA 425

Query: 272 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 426 ASCSTEKRKITFYMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 485

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 486 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 542

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAIRAR---- 441
           PD+  RA I  IH++         + E ++ L     GA+LR++CTEA + +I+ R    
Sbjct: 543 PDIRARAKILEIHTRKWHPPVSSAFIEKLASLTKGYGGADLRALCTEAALNSIQRRFPQY 602

Query: 442 ---RKVASE---------KDFLKAVEKV 457
               +V ++         KDF+ A+EK+
Sbjct: 603 IKVSQVGNKPKGKCQVKAKDFMIAMEKI 630

>Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}
           similar to Ashbya gossypii ABL041W
          Length = 804

 Score =  185 bits (470), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VKFKDVAGCDEAKEEIMEFVSF-LKQPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 393 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 452

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 453 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALLRPGRFDRHINIDKPELEG 512

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF++H   +++  DI  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RKEIFKVHLSKITLAEDI-VDLENRLAALTPGFSGADIANVCNEAALVAARGDNSSVKLE 571

Query: 449 DFLKAVEKVINGYKKFS 465
            F  A+E+VI G ++ S
Sbjct: 572 HFEHAIERVIGGVERKS 588

>TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.472
           YMR089C
          Length = 816

 Score =  185 bits (469), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 146/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 338 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 396

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     ++F DEI              
Sbjct: 397 EAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQKGNISG 456

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 457 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVNIDKPELSG 516

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H K + +  DI ++L +RL    P  +GA++ +VC EA + A R   K    +
Sbjct: 517 RQAIFEVHMKKIKLASDI-FDLKNRLAALTPGFSGADIANVCNEAALIAARNDAKSVRLE 575

Query: 449 DFLKAVEKVINGYKKFS 465
            F +AVE+VI G ++ S
Sbjct: 576 HFEQAVERVIGGVERKS 592

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score =  185 bits (470), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/265 (38%), Positives = 146/265 (55%), Gaps = 6/265 (2%)

Query: 205 MTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKT 264
              E    + ++DV GC +  E++ E V+  L  P R+  +G   P+G +L GPPGTGKT
Sbjct: 341 FNTETAVQIRFNDVAGCDEAKEEIMEFVDF-LKQPSRYEKMGAKIPRGAILSGPPGTGKT 399

Query: 265 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXX 324
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI      
Sbjct: 400 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTAKENAPSIVFIDEIDAIGKA 459

Query: 325 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 383
                    N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR V 
Sbjct: 460 RQKGNFSGANDERENTLNQLLVEMDGFSSTDHIVVLAGTNRPDILDRALLRPGRFDRHVN 519

Query: 384 FSLPDLEGRANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRA 440
             LP+LEGR  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R 
Sbjct: 520 IDLPELEGRKAIFGVHLKKIKIAGTI-YDLQNRLAALTPGFSGADISNVCNEAALIAARY 578

Query: 441 RRKVASEKDFLKAVEKVINGYKKFS 465
                    F KA+E+VI G ++ S
Sbjct: 579 NSSFVKLSHFEKAIERVIGGVERKS 603

>ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 727

 Score =  184 bits (466), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V++ DV GC +  +++ E V   L  PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 251 VSFQDVAGCNEAKQEIMEFVHF-LKKPEKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 309

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR++FE AR     IIF DEI              
Sbjct: 310 EAGVPFLSVSGSEFVEMFVGVGASRVRDMFEQARQMAPSIIFVDEIDAIGKERGKGGAMG 369

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR V+   PD+E
Sbjct: 370 GANDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDPALMRPGRFDRHVQIDSPDIE 429

Query: 391 GRANIFRIHSKSMSV---------ERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+ +H   +++         +R++    ++ L P   GA++ + C EA + A R +
Sbjct: 430 GRKAIYLVHLHDLNLAPEYTESKEQRELLAGKLAALTPGFAGADISNACNEAALIAARRQ 489

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
               + K F +A+E+VI G +K S
Sbjct: 490 AAHVTLKHFEQAIERVIAGLEKKS 513

>Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON}
           complement(5130..7490) [2361 nt, 787 aa]
          Length = 786

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 151/264 (57%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           +++ DV GC +  +++ E V   L +P+R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 301 ISFKDVAGCAEAKQEIMEFVHF-LKNPQRYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 359

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 360 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSMSPSIIFIDEIDAIGKERGKGGALG 419

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR +E   PD+E
Sbjct: 420 GANDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDPALMRPGRFDRHIEIDPPDVE 479

Query: 391 GRANIFRIHSKSMSVE------RDIRWEL---ISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR +I+ +H   ++++      ++ + EL   ++ L P   GA++ + C EA + A R  
Sbjct: 480 GRKSIYLVHLSKLNLDPIFTETKEAKDELAGKLAALTPGFAGADIANACNEAALIAARYN 539

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
            K    + F +A+E+VI G +K S
Sbjct: 540 DKYVELRHFEQAIERVIAGLEKKS 563

>KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1408

 Score =  186 bits (472), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/270 (39%), Positives = 155/270 (57%), Gaps = 27/270 (10%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ ++DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 445 NINFNDVGGLDSYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 504

Query: 272 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXX 325
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 505 ASCSTENRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 563

Query: 326 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 385
                     +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 564 SSKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 620

Query: 386 LPDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAI------ 438
           LPD + RA I  IH+K         + + ++RL     GA+LRS+CTEA +  I      
Sbjct: 621 LPDEKARARILTIHTKKWDPPLTEEFLQNLARLTKGYGGADLRSLCTEAALLCIQRNFPQ 680

Query: 439 --RARRKV--------ASEKDFLKAVEKVI 458
             R+  K+         + KDF+ A++K++
Sbjct: 681 IYRSDEKLVVDKSKLKVNTKDFILALQKIV 710

>Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {ON}
           YGR270W (YTA7) - 26S proteasome ATPase [contig 1] FULL
          Length = 1329

 Score =  186 bits (472), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 155/279 (55%), Gaps = 45/279 (16%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + DVGG  + I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 470

Query: 272 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
                 +   TF    G++++ K+VGE  R +R LF+ A+ ++  IIFFDEI        
Sbjct: 471 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFDEAKKQQPSIIFFDEIDGLAPVRS 530

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 587

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW------ELISRLCPNTT---GAELRSVCTEAGMFA 437
           P LE R+ I  IH+K        +W        IS+L   T    GA+LR++CTEA + +
Sbjct: 588 PGLEARSKILTIHTK--------KWNPPLPNHFISKLASLTKGYGGADLRALCTEAALIS 639

Query: 438 IRARRKV------------------ASEKDFLKAVEKVI 458
           I  +RK+                     +DF+ A+EK++
Sbjct: 640 I--QRKLPQIYQSDIKLHIDPSTVNVKARDFMLALEKIV 676

>KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON}
           Anc_4.259 YLR397C
          Length = 772

 Score =  184 bits (467), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 150/282 (53%), Gaps = 14/282 (4%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           I PS       E P V +SD+GG  +   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 IRPSAMREIFLEMPKVYWSDIGGQHELKRKMKEMIQLPLEASETFAELGVSAPKGVLLYG 549

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGINFFAVKGPEIFSKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDSGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 666

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSVE-RDIRWELISRLCPNTTGAELRSVCTEAGMF 436
           +DR +    PD E R  I    +K   +E  D+  E ++R     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIFVGPPDYEARLQILHKCTKKFQLEGSDVNLEDLARRTDGCSGAEIVLLCQEAGLA 726

Query: 437 AI--RARRKVASEKDFLKAVEKVING--------YKKFSSTS 468
           AI    + K      F KA+E +  G        Y  F+S S
Sbjct: 727 AIMENLQAKEVRAAHFEKAMEGISRGITEDMLEYYNNFASRS 768

 Score =  164 bits (414), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 136/260 (52%), Gaps = 27/260 (10%)

Query: 185 RSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFAT 244
            SKYN+  PL                    Y  VGG   +I  L+  +ELPL  P  F+ 
Sbjct: 225 NSKYNLPQPL-------------------LYEAVGGLSKEIGLLKSTIELPLHQPTLFSD 265

Query: 245 LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEM 304
            G+ PP+GILL+GPPGTGKT+  R VAN ++A  + + G  +V KY+GE    +R++F  
Sbjct: 266 FGVSPPRGILLHGPPGTGKTMLLRCVANTSNAHVLTINGPSIVSKYLGETEAALRDIFNE 325

Query: 305 ARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTMLELITQLDGFDPRGNIKVMFATN 363
           A+  +  IIF DEI                EV+ R +  L+T +DG    G + V+ ATN
Sbjct: 326 AKKYQPSIIFIDEI---DSLAPNRANDDSGEVESRVVATLLTLMDGMGAAGRLVVVAATN 382

Query: 364 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWE----LISRLCP 419
           RPN++DPAL RPGR D++VE  +PD E R +I      +MS ER    E     I+    
Sbjct: 383 RPNSVDPALRRPGRFDQEVEIGIPDAEARLDILLKQFSNMSSERHSLTEDNIKTIASKTH 442

Query: 420 NTTGAELRSVCTEAGMFAIR 439
              GA+L ++C E+ M  I+
Sbjct: 443 GYVGADLSALCRESVMKTIQ 462

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 739

 Score =  184 bits (466), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/263 (37%), Positives = 147/263 (55%), Gaps = 11/263 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +   ++ E V   L  P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VNFKDVAGCNEAKAEIMEFVHF-LQKPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXX--XXXXXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 383

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 384 GANDEREATLNQLLVEMDGFGTNDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 443

Query: 391 GRANIFRIHSKSMSV--------ERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARR 442
           GR  I+++H K +++        E+++    ++ L P   GA++ + C EA + A R ++
Sbjct: 444 GRKAIYQVHLKKLNLSPRYASPGEKEMLAGKLAALTPGFAGADIANACNEAALIAARYKK 503

Query: 443 KVASEKDFLKAVEKVINGYKKFS 465
                 +F +A+E+VI G +K S
Sbjct: 504 PFVELANFEQAIERVIAGLEKKS 526

>Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii AAR025C
          Length = 747

 Score =  184 bits (466), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/264 (38%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +   ++ E V   L +P+++  LG   P+G +L G PGTGKTL ARA A 
Sbjct: 271 VNFKDVAGCDEAKMEIMEFVHF-LKNPDKYKALGAQIPRGAILSGAPGTGKTLLARATAG 329

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXX--XXXXXXXXXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 330 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 389

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 390 GSNDEREATLNQLLVEMDGFTARDQIVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 449

Query: 391 GRANIFRIH---------SKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+R+H          K+ +++ D     ++ L P  +GA++ + C EA + A R +
Sbjct: 450 GRKAIYRVHLPRLNLQPALKTSTLDLDSFAGRLAALTPGFSGADIANACNEAALIAARHQ 509

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
            +    K F +A+E+VI G +K S
Sbjct: 510 DEYVELKHFEQAIERVIAGLEKKS 533

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1337

 Score =  186 bits (471), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 142/236 (60%), Gaps = 9/236 (3%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++++ +VGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 387 NISFENVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 446

Query: 272 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 447 ASCSTEQRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 506

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 507 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 563

Query: 387 PDLEGRANIFRIHSKSMSVE-RDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           PDL+ R+ I +IH+K        +  E ++ L     GA+LR++CTEA + +I+ +
Sbjct: 564 PDLKARSKILQIHTKEWKPPLSQVFVEKLASLTKGYGGADLRALCTEAALISIQRK 619

>Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {ON}
           similar to Ashbya gossypii ABR139W
          Length = 1339

 Score =  186 bits (471), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 140/236 (59%), Gaps = 9/236 (3%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 419 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 478

Query: 272 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
                ++   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 479 VSCSTDKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 538

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 539 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 595

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           PD   RA I  IH+K  +      + E ++ L     GA+LR++CTEA + +I+ +
Sbjct: 596 PDTSARAKILEIHTKKWNPPLPKEFIEKLASLTKGYGGADLRALCTEAALVSIQRK 651

>Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON}
           YGR270W (REAL)
          Length = 1389

 Score =  184 bits (468), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 141/234 (60%), Gaps = 9/234 (3%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 415 NIDFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 474

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 475 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 534

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 535 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 591

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAIR 439
           PD++ R+ I +I ++  S    I + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 592 PDVKARSKILQIQTRKWSAPLSINFIDKLAFLTKGYGGADLRSLCTEAALISIQ 645

>KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {ON}
           Anc_7.168 YER017C
          Length = 713

 Score =  182 bits (461), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 148/261 (56%), Gaps = 9/261 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V++ DV GC +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 237 VSFKDVAGCNEAKQEIMEFVHF-LKNPKKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 295

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXX--XX 330
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 296 EAAVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSLAPSIIFVDEIDAIGKERGKGGPLG 355

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 356 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDSPDIT 415

Query: 391 GRANIFRIH------SKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKV 444
           GR  I+ +H       + ++++R+     ++ L P  TGA++ + C EA + A R +   
Sbjct: 416 GRKQIYLVHLERLNLQEKLALDRENLAGKLATLTPGFTGADIANACNEAALIAARHKDAT 475

Query: 445 ASEKDFLKAVEKVINGYKKFS 465
            +   F +A+E+VI G +K S
Sbjct: 476 ITLDHFEQAIERVIAGLEKKS 496

>Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR270W
           (REAL)
          Length = 1386

 Score =  184 bits (467), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 141/234 (60%), Gaps = 9/234 (3%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 413 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 472

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+  +  +IFFDEI        
Sbjct: 473 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSVIFFDEIDGLAPVRS 532

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 533 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 589

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAIR 439
           PD++ R+ I +I +K  S    + + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 590 PDVKARSKILQIQTKKWSSPLSVNFVDKLAILTKGYGGADLRSLCTEAALISIQ 643

>Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C
           (YTA12) - mitochondrial membrane ATPase of the
           CDC48/PAS1/SEC18 (AAA) family [contig 55] FULL
          Length = 814

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           VT+ DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 341 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 399

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 400 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 459

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 460 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 519

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF++H   + +   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 520 RKQIFQVHLSKIKLAGSID-DLKNRLAALTPGFSGADISNVCNEAALTAARCECTSVKLE 578

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 579 HFEQAIERVIGGVERKS 595

>Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {ON}
           YMR089C (REAL)
          Length = 823

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 146/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 343 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 401

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 402 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 461

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 462 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 521

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H   + +  +I ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 522 RKAIFAVHLHHIKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 580

Query: 449 DFLKAVEKVINGYKKFS 465
           +F +A+E+VI G ++ S
Sbjct: 581 NFEQAIERVIGGVERKS 597

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           VT+ DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 340 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 398

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 399 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG 458

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 459 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 518

Query: 392 RANIFRIHSKSMSVE---RDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF++H   + +     D++  L + L P  +GA++ +VC EA + A R        +
Sbjct: 519 RKQIFQVHLAKVKLAGSMEDLKNRLAA-LTPGFSGADISNVCNEAALTAARNECTSVKLE 577

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 578 HFEQAIERVIGGVERKS 594

>AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER017C
           (AFG3)
          Length = 726

 Score =  181 bits (458), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC +   ++ E V+  L +PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 248 IKFKDVAGCDEAKMEIMEFVDF-LKTPEKYRALGAQIPRGAILSGPPGTGKTLLAKATAG 306

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXX--XXXXXXXXXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 307 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKARGKGGEMG 366

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 367 GSNDEREATLNQLLVEMDGFTSRDQIVVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVE 426

Query: 391 GRANIFRIHSKSMSVERDIRWE---------LISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+++H   ++++  ++            ++ L P   GA++ + C EA + A R  
Sbjct: 427 GRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGKLAALTPGFAGADISNACNEAALIAARHN 486

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
                 + F +A+E+VI G +K S
Sbjct: 487 DAFVEFRHFDQAIERVIAGLEKKS 510

>NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {ON}
           Anc_4.259
          Length = 772

 Score =  181 bits (459), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 155/284 (54%), Gaps = 17/284 (5%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           I PS       E P V +SD+GG ++   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 489 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEASETFARLGVTAPKGVLLYG 548

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 549 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 608

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 609 I--DALSPDRDGGSSSSAASHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSV-ERDIRWELISRLCPNTTGAELRSVCTEAGMF 436
           +DR +  + PD E R  I R  +K   + E  I  E +SR     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVAPPDYEARLQILRKCTKKFQIDESTINLEDLSRRTDGCSGAEVVLLCQEAGLA 726

Query: 437 AIR----ARRKVASEKDFLKAVEKVING--------YKKFSSTS 468
           AI     A +  AS   F +A++ +  G        Y+ F+S S
Sbjct: 727 AIMEDLDASKVEASH--FERALQGISRGITPEMLAYYQDFASRS 768

 Score =  169 bits (427), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 102/277 (36%), Positives = 144/277 (51%), Gaps = 29/277 (10%)

Query: 186 SKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATL 245
           SKYN+  PL                   TY  VGG   +++ L+  + LPL  P  F+  
Sbjct: 225 SKYNLPQPL-------------------TYDSVGGLHKEVDLLKTTISLPLHQPTLFSDF 265

Query: 246 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 305
           G+ PP+GILL+GPPGTGKT+  R VAN  +A  + + G  +V KY+GE    +R++F  A
Sbjct: 266 GVSPPRGILLHGPPGTGKTMLLRCVANTANAHVLTINGPSIVSKYLGETESALRDIFNEA 325

Query: 306 RTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTMLELITQLDGFDPRGNIKVMFATNR 364
           +  +  IIF DEI                EV+ R +  L+T +DG    G + V+ ATNR
Sbjct: 326 KKYQPSIIFIDEI---DSIAPNRANDDSGEVESRVVATLLTLMDGMGSAGRLVVIAATNR 382

Query: 365 PNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWE----LISRLCPN 420
           PN++DPAL RPGR D++VE  +PD++ R +I       MS ER    E     IS     
Sbjct: 383 PNSVDPALRRPGRFDQEVEIGIPDVDARLDILMKQFSQMSSERHTLTEEDIKTISSKTHG 442

Query: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKV 457
             GA+L S+C E+ M  I  +R + S K    +V +V
Sbjct: 443 YVGADLSSLCRESVMKTI--QRGLNSSKTIDSSVLQV 477

>Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W
           (REAL)
          Length = 1398

 Score =  182 bits (463), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 142/236 (60%), Gaps = 13/236 (5%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 421 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 480

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 481 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 540

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 541 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 597

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTT---GAELRSVCTEAGMFAIR 439
           PD++ R  I +I +K  +    +  E I++L   T    GA+LRS+CTEA + +I+
Sbjct: 598 PDVKARYKILQIQTKKWTSP--LSTEFINKLAILTKGYGGADLRSLCTEAALISIQ 651

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score =  181 bits (458), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 152/272 (55%), Gaps = 16/272 (5%)

Query: 171 SPTDIEEGMRVGV-DRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLR 229
           S TD+ E ++VG+ D     +E      I PS       E P V +SD+GG +D   K++
Sbjct: 468 STTDMTE-LKVGITDVESAMLE------IRPSAMREIFLEMPKVYWSDIGGQEDLKRKMK 520

Query: 230 EVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 289
           E+++LPL + + FA LGI  PKGILLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 521 EMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNK 580

Query: 290 YVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 349
           YVGE  R +RE+F  AR     IIFFDEI               N V   +  L+ ++DG
Sbjct: 581 YVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEIDG 637

Query: 350 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDI 409
            +    + ++ ATNRP+ +D ALLRPGR+DR V  S PD   R  I +  +K+  +  D 
Sbjct: 638 VEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQILKKCTKNFDL--DN 695

Query: 410 RWELISRLCPNT---TGAELRSVCTEAGMFAI 438
             EL++ L   T   +GAE+  +C EAG+ AI
Sbjct: 696 TDELLNDLATRTEGCSGAEVVLLCQEAGLAAI 727

 Score =  168 bits (426), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           ++Y  VGG K +I+ L++ ++LPL  PE FA  GI PPKGIL++GPPGTGKT+  R VAN
Sbjct: 233 LSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMHGPPGTGKTMLLRCVAN 292

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            ++A  + + G  +V KY+GE    +RE+F  A+  +  IIF DEI              
Sbjct: 293 ASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIFIDEI---DSIAPNRANDD 349

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G I V+ ATNRPN +DPAL RPGR D+++E  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRRPGRFDQEIEIGIPDVDA 409

Query: 392 RANIFRIHSKSMSVERDIRWE----LISRLCPNTTGAELRSVCTEAGMFAIR 439
           R +I +   + +S ++    E     I+       GA+L ++C E+ M  I+
Sbjct: 410 RFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTALCRESVMKTIQ 461

>YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON}
           YTA12Component, with Afg3p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 825

 Score =  181 bits (459), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 345 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 403

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 404 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 463

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 464 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 523

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H   + +  +I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 524 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLN 582

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 583 HFEQAIERVIGGVERKS 599

>Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {ON}
           YMR089C (REAL)
          Length = 827

 Score =  181 bits (459), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 346 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 404

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 405 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 464

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 465 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 524

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H   + +  +I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 525 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDENSVKLN 583

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 584 HFEQAIERVIGGVERKS 600

>Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {ON}
           YMR089C (REAL)
          Length = 824

 Score =  181 bits (459), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 344 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 402

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 403 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 462

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 463 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 522

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 523 RKAIFAVHLHHLKLAGGI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 581

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 582 HFEQAIERVIGGVERKS 598

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score =  181 bits (459), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 379 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 437

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI              
Sbjct: 438 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFIDEIDAIGKARQKGNFSG 497

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 498 ANDERENTLNQLLVEMDGFTTSDHIVVLAGTNRPDILDKALLRPGRFDRHINIDKPELSG 557

Query: 392 RANIFRIHSKSMSVERDIRWEL---ISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H K + +  DI ++L   +S L P  +GA++ +VC EA + A R   +    +
Sbjct: 558 RKAIFEVHLKKIKIAGDI-FDLKNRLSALTPGFSGADIANVCNEAALIAARNEARFVKLE 616

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 617 HFEQAIERVIGGVERKS 633

>YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}
           YTA7Protein that localizes to chromatin and has a role
           in regulation of histone gene expression; has a
           bromodomain-like region that interacts with the
           N-terminal tail of histone H3, and an ATPase domain;
           potentially phosphorylated by Cdc28p
          Length = 1379

 Score =  182 bits (461), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 139/234 (59%), Gaps = 9/234 (3%)

Query: 212 DVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 271
           +V + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 468

Query: 272 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 326
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 469 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 528

Query: 327 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 529 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 585

Query: 387 PDLEGRANIFRIHSKSMSVERDIRW-ELISRLCPNTTGAELRSVCTEAGMFAIR 439
           PD++ R  I +I ++  S      + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 586 PDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQ 639

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score =  180 bits (456), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 99/263 (37%), Positives = 146/263 (55%), Gaps = 11/263 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +   ++ E V   L  P+++  LG   PKG +L GPPGTGKTL A+A A 
Sbjct: 297 VKFKDVAGCDEAKGEIMEFVHF-LQKPDKYRKLGAQIPKGAILSGPPGTGKTLLAKATAG 355

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 356 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 415

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 416 GANDEREATLNQLLVEMDGFTSTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQLDAPDVE 475

Query: 391 GRANIFRIHSKSMSVE----RDIRWEL----ISRLCPNTTGAELRSVCTEAGMFAIRARR 442
           GR  I+++H ++++++    R   +E     ++ L P   GA++ + C EA + A R   
Sbjct: 476 GRKAIYQVHLRNLNLDPKYIRTSEFEALAGKLAALTPGFAGADIANACNEAALIAARHSD 535

Query: 443 KVASEKDFLKAVEKVINGYKKFS 465
                + F +A+E+VI G +K S
Sbjct: 536 AFVEFRHFEQAIERVIAGLEKKS 558

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score =  180 bits (456), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 148/267 (55%), Gaps = 8/267 (2%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           + PS       E P V +SD+GG  +   KL+E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 VRPSAMREIFLEMPKVYWSDIGGQDELKRKLKEMIQLPLDASETFARLGVSAPKGVLLYG 549

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDGESTSAANHV---LTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSVERD-IRWELISRLCPNTTGAELRSVCTEAGMF 436
           +DR +    PD + R  I R  +   ++E   +  E +++     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVGPPDYDARLQILRKCTSKFNIESSGVDLEALAQKTDGCSGAEVVLLCQEAGLA 726

Query: 437 AIRAR---RKVASEKDFLKAVEKVING 460
           +I       KV++E  F KA+  +  G
Sbjct: 727 SIMENVETEKVSTEH-FEKALRDLSRG 752

 Score =  168 bits (426), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 132/231 (57%), Gaps = 6/231 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           VTY+ VGG   +IE L+  +ELPL  P+ F   G+ PP+GI+L+GPPGTGKT+  R VA+
Sbjct: 236 VTYNSVGGLFSEIEILKNTIELPLRQPQLFTDFGVTPPRGIMLHGPPGTGKTMILRCVAH 295

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            T+A  + + G  +V KY+GE    +R++F  A   +  I+F DEI              
Sbjct: 296 STNAHVLTIDGPSIVSKYLGETEATLRDIFNEAVKYQPSIVFIDEIDSIAPNRANDDSGE 355

Query: 333 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 392
                R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R
Sbjct: 356 AE--SRVVATLLTLMDGMGASGKVVVIGATNRPNSVDPALRRPGRFDQEVEIGIPDAEAR 413

Query: 393 ANIFRIHSKSMSVER-DIRWELISRLCPNT---TGAELRSVCTEAGMFAIR 439
            +I     + MS +R ++  E I  +   T    GA+L ++C EA M  I+
Sbjct: 414 LDILHKQFQRMSSDRQELTEEDIKTIASKTHGYVGADLSALCREAVMKTIQ 464

>KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} similar
           to uniprot|P32794 Saccharomyces cerevisiae YLR397C AFG2
           ATPase of the CDC48/PAS1/SEC18 (AAA) family forms a
           hexameric complex may be involved in degradation of
           aberrant mRNAs
          Length = 804

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 142/245 (57%), Gaps = 8/245 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V Y+ VGG K +   L+  VE PL  P+ F   GI+PP+GILL+GPPGTGKT+  R VAN
Sbjct: 267 VLYNAVGGLKKETSILKSTVEFPLHQPQLFTDFGINPPRGILLHGPPGTGKTMLLRCVAN 326

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            TDA  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 327 ETDAHILTISGPSIVSKYLGETEAALRDIFNEAKRYQPSIIFIDEI---DSLAPNRANDD 383

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG D  G + V+ ATNRPN++DPAL RPGR D+++E S+PD+E 
Sbjct: 384 SGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPNSIDPALRRPGRFDQEIEISIPDVEA 443

Query: 392 RANIFRIHSKSMSVERDIRW-ELISRLCPNT---TGAELRSVCTEAGMFAIRARRKVASE 447
           R +I R     MS +R +   E IS +   T    GA+L ++C E+ M  I+       E
Sbjct: 444 RHDILRKQFSRMSKQRQLLSPEDISNIASKTHGYVGADLIALCRESVMKTIQRGLNENIE 503

Query: 448 KDFLK 452
           +D LK
Sbjct: 504 RDDLK 508

 Score =  172 bits (435), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 101/299 (33%), Positives = 155/299 (51%), Gaps = 14/299 (4%)

Query: 165 GLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQ 224
           GL E +   D++ G+         N  L     I PS       E P V + D+GG ++ 
Sbjct: 497 GLNENIERDDLKVGI---------NDVLEAMADIRPSAMREIFLETPKVYWDDIGGQEEL 547

Query: 225 IEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGS 284
            +K++E+++LPL + E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G 
Sbjct: 548 KQKMKEMIQLPLEAAETFAKLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGP 607

Query: 285 ELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELI 344
           E+  KYVGE  R +RE+F  AR     IIFFDEI               +     +  L+
Sbjct: 608 EIFNKYVGESERAIREIFRKARAASPSIIFFDEI--DALSPDRDSGSGTSAANHVLTSLL 665

Query: 345 TQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS 404
            ++DG +    + ++ ATNRP+ +DPALLRPGR+DR +    P  + R  I +  +K  +
Sbjct: 666 NEIDGVEELKGVIIVAATNRPDEIDPALLRPGRLDRHIYVGPPSYDARLQILQKCTKKFN 725

Query: 405 VERDI-RWELISRLCPNTTGAELRSVCTEAGMFAIRARRKV--ASEKDFLKAVEKVING 460
           ++  I   + ++      +GAE+  +C EAG+ AI          ++ F KA+  +  G
Sbjct: 726 IDTAIVDLKALAECTDGCSGAEVVLLCQEAGLAAIMEDTTTDKVEQRHFTKALAGISRG 784

>KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.472
           YMR089C
          Length = 784

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + ++DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 308 IKFNDVAGCDEAKEEIMEFVSF-LKDPVRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 366

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 367 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 426

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 427 ANDERESTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDRALLRPGRFDRHINIDKPELEG 486

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 487 RKEIFAVHLKGLKLANTI-FDLKNRLAALTPGFSGADIANVCNEAALIAARTDSHAVVLT 545

Query: 449 DFLKAVEKVINGYKKFS 465
            F  A+E+VI G ++ S
Sbjct: 546 HFEHAIERVIGGVERKS 562

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 331 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAG 389

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 390 EAGVPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSG 449

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF P  +I V+  TNR + LD AL+RPGR DR +    P+L G
Sbjct: 450 ANDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSG 509

Query: 392 RANIFRIHSKSMSVERDIR--WELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
           R  IF++H   + +  DI    + ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 510 RQEIFKVHLSKIKLAGDIGDLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEH 569

Query: 450 FLKAVEKVINGYKKFS 465
           F +A+E+VI G ++ S
Sbjct: 570 FEQAIERVIGGVERKS 585

>SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 776

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/309 (34%), Positives = 162/309 (52%), Gaps = 17/309 (5%)

Query: 175 IEEGMRVGVDRSKYNIELPLPPR----IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLRE 230
           I+ G+   +DR K  + L         I PS       E P V +SD+GG ++  +K+RE
Sbjct: 466 IQRGLTESIDREKLKVILKDVEEAMMDIRPSAMREIFLEMPKVYWSDIGGQEELKQKMRE 525

Query: 231 VVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKY 290
           +++LPL + E F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KY
Sbjct: 526 MIQLPLEAAETFQRLGVSAPKGVLLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNKY 585

Query: 291 VGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGF 350
           VGE  R +RE+F  AR     IIFFDEI               +     +  L+ ++DG 
Sbjct: 586 VGESERAIREIFRKARAAAPSIIFFDEI--DALSPDRNSGSGTSAANHVLTSLLNEIDGV 643

Query: 351 DPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSV-ERDI 409
           +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD   R  IF+  +K   +   ++
Sbjct: 644 EELNGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDHAARLQIFKKCTKKFQLGGSNV 703

Query: 410 RWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVA--SEKDFLKAVEKVING------- 460
             E ++      +GAE+  +C EAG+ AI    + +    + F KA+  +  G       
Sbjct: 704 DLEELASKTEGCSGAEVVLLCQEAGLAAIMEDLETSKVEARHFEKALSGISKGITQEMLA 763

Query: 461 -YKKFSSTS 468
            Y+ FSS S
Sbjct: 764 YYEDFSSRS 772

 Score =  162 bits (409), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 141/249 (56%), Gaps = 8/249 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + Y+ VGG   +I  L+  +ELPL  P  F    + PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 IGYNAVGGLAKEISLLKGTIELPLHQPTLFTDFSVTPPRGILLHGPPGTGKTMLLRCVAN 298

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            T+A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 299 ETNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRAGDD 355

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             E++ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEIESRVVATLLTLMDGMGGAGRLVVVAATNRPNKIDPALRRPGRFDQEVEIGIPDVDA 415

Query: 392 RANIFRIHSKSMSVER-DIRWELISRLCPNT---TGAELRSVCTEAGMFAIRARRKVASE 447
           R +I       +S +R ++  E IS +   T    GA+L ++C EA M AI+     + +
Sbjct: 416 RLDILTKQFSKISHQRHELIAEDISTIASKTHGYVGADLIALCREAVMKAIQRGLTESID 475

Query: 448 KDFLKAVEK 456
           ++ LK + K
Sbjct: 476 REKLKVILK 484

>KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40341 Saccharomyces cerevisiae
           YMR089C YTA12 Component with Afg3p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 842

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VNFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 393 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 452

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD AL+RPGR DR +    P+L+G
Sbjct: 453 ANDERENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELQG 512

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF++H K +++  D+  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RQEIFKVHLKKITLAGDMT-DLQNRLAVMTPGFSGADIANVCNEAALIAARNDCDAVRLE 571

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 572 HFEQAIERVIGGVERKS 588

>CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089c YTA12
           or uniprot|P39925 Saccharomyces cerevisiae YER017c AFG3
          Length = 827

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L +P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 349 VKFKDVAGCDEAKEEIMEFVSF-LRNPQRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 407

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 408 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 467

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR++    P+LEG
Sbjct: 468 ANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRRIHIDRPELEG 527

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 528 RKAIFEVHLQKLKLAGSI-FDLKNRLAALTPGFSGADIANVCNEAALIAARHDENAVKLS 586

Query: 449 DFLKAVEKVINGYKK 463
            F +A+E+VI G ++
Sbjct: 587 HFEQAIERVIGGVER 601

>TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.259
           YLR397C
          Length = 776

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/311 (33%), Positives = 168/311 (54%), Gaps = 19/311 (6%)

Query: 175 IEEGMRVGVDRSKYNIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKL 228
           I+ G++   D S  ++++ +         I PS       E P V +SD+GG ++   K+
Sbjct: 464 IQRGLKTASDMSSDSLKITVNDVEDAMLEIRPSAMREIFLEMPKVYWSDIGGQEELKRKM 523

Query: 229 REVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 288
           +E+++LPL + + F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 524 KEMIQLPLEAADTFDRLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 583

Query: 289 KYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 348
           KYVGE  R +RE+F  AR+    IIFFDEI                     +  L+ ++D
Sbjct: 584 KYVGESERAIREIFRKARSASPSIIFFDEIDALSPDRDGGSSSS--AASHVLTSLLNEID 641

Query: 349 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER- 407
           G +    + ++ ATNRP+ +DPALLRPGR+DR +  + P  + R  I + ++K+  VE+ 
Sbjct: 642 GVEDLKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPTYDARLQILKNNTKNFQVEKA 701

Query: 408 DIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR--RKVASEKDFLKAVEKVING----- 460
           +I  E ++R     +GAE+  +C EAG+ AI         + + F KA++ +  G     
Sbjct: 702 NIDLEELARRTDGCSGAEVVLLCQEAGLAAIMENIDTDFVTPEHFEKALQGIARGITPEM 761

Query: 461 ---YKKFSSTS 468
              Y++F+S S
Sbjct: 762 LEYYQEFASRS 772

 Score =  172 bits (437), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 137/239 (57%), Gaps = 6/239 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V+Y+ VG    +IE LR  VELPL   + FA  GI PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 VSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            +DA  + + G  +V KY+G+    +R++F  A+  +  IIF DEI              
Sbjct: 297 SSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQPSIIFIDEIDSIAPNRTNDDSGE 356

Query: 333 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 392
                R +  L+T +DG +  G + V+ ATNRPN++DPAL RPGR D++VE  +PD+EGR
Sbjct: 357 AE--SRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVEGR 414

Query: 393 ANIFRIHSKSMSVER----DIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASE 447
            +I       MS +R    D   ++I+       GA+L ++C E+ M  I+   K AS+
Sbjct: 415 LDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGADLTALCRESVMKTIQRGLKTASD 473

>TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa]
           {ON} Anc_7.168 YER017C
          Length = 782

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 148/263 (56%), Gaps = 11/263 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           VT+ DV GC++  +++ E V+  L +P ++  LG   P+G +L GPPGTGKTL A+AVA 
Sbjct: 310 VTFKDVAGCQEAKQEIMEFVDF-LKNPHKYTELGAKIPRGAILSGPPGTGKTLLAKAVAG 368

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX- 331
                F+ V GSE V+ +VG GA  VR+LFE A      IIF DEI              
Sbjct: 369 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQASKMAPSIIFVDEIDAIGKARGKNGSLG 428

Query: 332 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD ALLRPGR DR V+   PD+E
Sbjct: 429 GSNDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDKALLRPGRFDRHVQIDAPDVE 488

Query: 391 GRANIFRIHSKSMSVE----RDIRWEL----ISRLCPNTTGAELRSVCTEAGMFAIRARR 442
           GR  I+ +H K ++++     D + +L    ++ L P  TGA++ + C E+ + A R   
Sbjct: 489 GRKLIYLVHLKKLNLDPLYSEDKQKQLLAGKLAALTPGFTGADIANACNESALIAARKMD 548

Query: 443 KVASEKDFLKAVEKVINGYKKFS 465
                  F +A+E+VI G +K S
Sbjct: 549 PYVQFTHFEEAIERVIAGLEKKS 571

>CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly
           similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017c AFG3 or uniprot|P40341 Saccharomyces cerevisiae
           YMR089c YTA12
          Length = 750

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           +++ DV GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 275 ISFKDVAGCDEAKQEIMEFVHF-LKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAG 333

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 334 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALG 393

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNR + LDPAL+RPGR DR +E   PD+ 
Sbjct: 394 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMS 453

Query: 391 GRANIFRIHSKSMSVE---------RDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+ +H + ++++         RD     ++ L P  TGA++ + C EA + A R +
Sbjct: 454 GRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQ 513

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
            K      F +A+E+VI G +K S
Sbjct: 514 DKYVELLHFEQAIERVIAGLEKKS 537

>TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.168
           YER017C
          Length = 784

 Score =  179 bits (453), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 294 VAFKDVAGCNEAKQEIMEFVHF-LKNPKKYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 352

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE ART    IIF DEI              
Sbjct: 353 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSIIFIDEIDAIGKERGKGGALG 412

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR +E   PD+E
Sbjct: 413 GANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVLDKALMRPGRFDRHIEIDPPDVE 472

Query: 391 GRANIFRIHSKSMSV---------ERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR +I+ +H   +++         ++++    ++ L P   GA++ + C EA + A R  
Sbjct: 473 GRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAALTPGFAGADIANACNEAALIAARYN 532

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
            +    + F +A+E+VI G +K S
Sbjct: 533 DEYVEMRHFEQAIERVIAGLEKKS 556

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score =  179 bits (453), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 145/266 (54%), Gaps = 6/266 (2%)

Query: 204 MMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGK 263
           M   +    V ++ V GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGK
Sbjct: 317 MFNSDTNVKVKFNAVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGK 375

Query: 264 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXX 323
           TL A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI     
Sbjct: 376 TLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFVDEIDAIGK 435

Query: 324 XXXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKV 382
                     N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +
Sbjct: 436 ARQKGNFSGANDERENTLNQLLVEMDGFTSSDHVVVLAGTNRPDILDKALLRPGRFDRHI 495

Query: 383 EFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIR 439
               P+L GR  IF +H K + +  DI ++L +RL    P  +GA++ +VC EA + A R
Sbjct: 496 NIDKPELSGRKAIFDVHLKKIKISDDI-YDLKNRLAVLTPGFSGADIANVCNEAALIAAR 554

Query: 440 ARRKVASEKDFLKAVEKVINGYKKFS 465
                 +   F +AVE+VI G ++ S
Sbjct: 555 DDSHFVALNHFEQAVERVIGGVERKS 580

>NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168
          Length = 773

 Score =  178 bits (451), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V++ +V GC +   ++ E V   L +P+++ TLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 295 VSFKNVAGCDEAKVEIMEFVHF-LKNPKKYTTLGAKIPRGAILSGPPGTGKTLLAKATAG 353

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 354 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKMAPSIIFIDEIDAIGKERGKGGALG 413

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR ++   PD+ 
Sbjct: 414 GSNDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALMRPGRFDRHIQIDAPDIN 473

Query: 391 GRANIFRIHSKSMSVE---------RDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+ +H K +++E         R+     ++ L P  TGA++ + C EA + A R +
Sbjct: 474 GRKEIYLVHLKKLNLETRLVETDSDRENLAGKLATLTPGFTGADIANACNEAALIAARNK 533

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
                   F +A+E+VI G +K S
Sbjct: 534 DPYILLSHFEQAIERVIAGLEKKS 557

>NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa]
           {ON} Anc_2.472
          Length = 791

 Score =  178 bits (452), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 311 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 369

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 370 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 429

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 430 ANDERENTLNQMLVEMDGFTTEDHVVVLAGTNRPDILDQALLRPGRFDRHINLDKPELEG 489

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H   + +   I ++L +RL    P   GA++ +VC EA + A R  +K    +
Sbjct: 490 RKAIFAVHLGKLKLSSSI-FDLKNRLAALTPGFAGADIANVCNEAALIAARNDQKSVKLE 548

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 549 HFEQAIERVIGGVERKS 565

>NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168
          Length = 782

 Score =  178 bits (451), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V++ +V GC +   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 304 VSFKNVAGCDEAKVEIMEFVHF-LKNPNKYTVLGAKIPRGAILSGPPGTGKTLLAKATAG 362

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 363 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKLAPSIIFIDEIDAIGKERGKGGALG 422

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 423 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALLRPGRFDRHIQIDAPDIN 482

Query: 391 GRANIFRIHSKSMSVERDI---RWEL------ISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+ +H K +++E  +   + ++      ++ L P  TGA++ + C EA + A R +
Sbjct: 483 GRKQIYLVHLKRLNLEEKLVETKEDVENLAGKLATLTPGFTGADIANACNEAALIAARHK 542

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
               + + F +A+E+VI G +K S
Sbjct: 543 DPFVTIQHFEQAIERVIAGLEKKS 566

>KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]
           {ON} similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 774

 Score =  177 bits (450), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 143/269 (53%), Gaps = 5/269 (1%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           I PS       E P V +SD+GG +D   K++E+++LPL +PE F+ L +  PKG+LLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQEDLKLKMKEMIQLPLEAPESFSRLSVSAPKGVLLYG 550

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREVFRKARAAAPSIIFFDE 610

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMS-VERDIRWELISRLCPNTTGAELRSVCTEAGMF 436
           +DR +    PD E R  I R  +K    ++ D   +  ++     +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFEARLQILRKSTKDFHLIDSDALLQEFAQKTEGCSGAEVVLLCQEAGLA 728

Query: 437 AIRARRKV--ASEKDFLKAVEKVINGYKK 463
           AI           K F KA+  +  G  K
Sbjct: 729 AIMENLDAEKVDRKHFDKAIAGISRGIDK 757

 Score =  164 bits (415), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 141/245 (57%), Gaps = 8/245 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           ++Y+ VGG + +IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 MSYNSVGGLQKEIELLKRTIELPLHQPTLFADFGVTPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
             +A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARIYQPSIIFIDEI---DSLAPSRTSDD 353

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G + V+ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSTGRVVVVAATNRPNAVDMALRRPGRLDQEVEIGIPDVES 413

Query: 392 RANIFRIHSKSMSVER-DIRWELISRLCPNT---TGAELRSVCTEAGMFAIRARRKVASE 447
           R +I     + +S +R ++  E I  +   T    GA+L ++C EA M  ++     +  
Sbjct: 414 RHDILLKQFRKVSEKRHELTLEDIQAIASKTHGYVGADLVALCREAVMKTLQRGVSHSLT 473

Query: 448 KDFLK 452
           KD +K
Sbjct: 474 KDEMK 478

>SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} similar
           to uniprot|P39925 Saccharomyces cerevisiae YER017C AFG3
           Component with Yta12p of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 742

 Score =  177 bits (449), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 97/263 (36%), Positives = 144/263 (54%), Gaps = 11/263 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 267 VNFKDVAGCDEAKGEIMEFVHF-LKNPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 325

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 326 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 385

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 386 GANDEREATLNQLLVEMDGFSTTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVE 445

Query: 391 GRANIFRIHSKSMSVERDIRWE--------LISRLCPNTTGAELRSVCTEAGMFAIRARR 442
           GR  I+++H   ++++  +            ++ L P   GA++ + C EA + A R + 
Sbjct: 446 GRKAIYKVHLTRLTLDPKLSKSENIQSLAGKLAALTPGFAGADIANACNEAALIAARRKE 505

Query: 443 KVASEKDFLKAVEKVINGYKKFS 465
                K F +A+E+VI G +K S
Sbjct: 506 PYVEFKHFDQAIERVIAGLEKKS 528

>KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {ON}
           Anc_7.430 YPR024W
          Length = 766

 Score =  177 bits (449), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 143/254 (56%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 293 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 351

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 352 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 411

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 412 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 468

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I R+H K +++  D+   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 469 RGRADILRLHMKKITMATDVEPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMSH 528

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 529 FEWAKDKILMGAER 542

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score =  178 bits (451), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV G  +  E++ E V   L  P R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 352 VKFKDVAGMDEAKEEVMEFVSF-LKEPSRYEKLGAKIPRGAILSGPPGTGKTLLAKATAG 410

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 411 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 470

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF P  +I V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 471 ANDERENTLNQLLVEMDGFTPADHIVVLAGTNRPDILDQALMRPGRFDRHINIDKPELEG 530

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF++H   + +  ++ ++L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 531 RKEIFQVHLAKIKLAGEM-YDLKNRLATLTPGFSGADIANVCNEAALIAARNDCTAVKLE 589

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 590 HFEQAIERVIGGVERKS 606

>NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {ON}
           Anc_2.472
          Length = 803

 Score =  177 bits (449), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 319 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 377

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 378 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 437

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 438 ANDERENTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 497

Query: 392 RANIFRIHSKSMSVER---DIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H + + +     D++  L + L P   GA++ +VC EA + A R  +     +
Sbjct: 498 RKAIFEVHLQKLKLAGTVLDLKNRLAA-LTPGFAGADIANVCNEAALIAARNDQPSVRLE 556

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 557 HFEQAIERVIGGVERKS 573

>KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7.430
           YPR024W
          Length = 726

 Score =  176 bits (446), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K DV + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 254 KTDVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 312

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF+ AR +   IIF DE+           
Sbjct: 313 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFQQARNRSPAIIFIDELDAIGGKRNPKD 372

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 373 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 429

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H + +++  D+   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 430 RGRADILKHHMQKITLAPDVDPTIIARGTPGLSGAELSNLVNQAAVYACQKNAIAVDMSH 489

Query: 450 FLKAVEKVINGYKK 463
           F  A +K + G +K
Sbjct: 490 FEWAKDKTLMGAEK 503

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score =  176 bits (447), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 278 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 336

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 337 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 396

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 397 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 453

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I ++H K +++  D+   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 454 RGRADILKLHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQQNAIAVDMSH 513

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 514 FEWAKDKILMGAER 527

>KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {ON}
           Anc_7.168 YER017C
          Length = 783

 Score =  176 bits (447), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 143/264 (54%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + + DV GC++  +++ E V   L SP+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 303 IQFKDVAGCQEAKQEIMEFVHF-LKSPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 361

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX- 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 362 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKNGALG 421

Query: 332 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 422 GANDEREATLNQLLVEMDGFTTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDIT 481

Query: 391 GRANIFRIHSKSMSV---------ERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+ +H   + +         + D+    ++ L P  TGA++ + C EA + A R +
Sbjct: 482 GRKEIYLVHLAKLHLDPVFTKTKKDGDMLAGKLATLTPGFTGADIANACNEAALIAARYK 541

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
                   F +A+E+VI G +K S
Sbjct: 542 DPYVGLSHFEQAIERVIAGLEKKS 565

>TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.168
           YER017C
          Length = 744

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 144/264 (54%), Gaps = 12/264 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VQFKDVAGCNEAKQEIMEFVHF-LKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
                F+ V GSE V+ +VG GA  VR+LFE  R     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMG 383

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+E
Sbjct: 384 GSNDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVE 443

Query: 391 GRANIFRIHSKSMSVERDI------RWEL---ISRLCPNTTGAELRSVCTEAGMFAIRAR 441
           GR  I+ +H + +++++        R EL   ++ L P   GA++ + C EA + A R  
Sbjct: 444 GRKAIYLVHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHN 503

Query: 442 RKVASEKDFLKAVEKVINGYKKFS 465
                   F +A+E+VI G +K S
Sbjct: 504 DPCIELHHFEQAIERVIAGLEKKS 527

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score =  176 bits (447), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 366 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 424

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 425 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNISG 484

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 485 ANDERENTLNQMLVEMDGFTAADHVVVLAGTNRPDILDKALLRPGRFDRHINLDNPELSG 544

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R +IF +H + + +  DI ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 545 RKDIFAVHLQKLKLAGDI-YDLKNRLAALTPGFSGADIANVCNEAALIAARNDCDSVKLV 603

Query: 449 DFLKAVEKVINGYKKFS 465
            F +A+E+VI G ++ S
Sbjct: 604 HFEQAIERVIGGVERKS 620

>ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 830

 Score =  176 bits (447), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 140/255 (54%), Gaps = 6/255 (2%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L G PGTGKTL A+A A 
Sbjct: 351 VKFKDVAGCDEAKEEIEEFVSF-LKEPSRYEKMGAKIPRGAILSGAPGTGKTLLAKATAG 409

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
                F  V GSE V+ +VG GA  VR+LF+ AR     +IF DEI              
Sbjct: 410 EAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAIGKARQKGNFSG 469

Query: 333 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 470 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFDRHVNIDKPELSG 529

Query: 392 RANIFRIHSKSMSVERDIRWELISRLC---PNTTGAELRSVCTEAGMFAIRARRKVASEK 448
           R  IF +H K + +  DI ++L +RL    P  +GA++ + C EA + A R         
Sbjct: 530 RQAIFEVHLKKIKLAGDI-FDLKNRLAALTPGFSGADIANACNEAALIAARNESDSVKLV 588

Query: 449 DFLKAVEKVINGYKK 463
            F +A+E+VI G ++
Sbjct: 589 HFEQAIERVIGGVER 603

>NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {ON}
           Anc_4.259
          Length = 778

 Score =  176 bits (446), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           I PS       E P V +SD+GG ++   K++E+++LPL +   FA LGI  PKG+LLYG
Sbjct: 495 IRPSAMREIFLEMPKVFWSDIGGQEELKRKMKEMIQLPLEASATFARLGISAPKGVLLYG 554

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARAASPSIIFFDE 614

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 I--DALSPDRDGGSSTSAASHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 672

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSVER-DIRWELISRLCPNTTGAELRSVCTEAGMF 436
           +DR +  + PD + R  I +  +K   +E  +I+ E ++      +GAE+  +C EAG+ 
Sbjct: 673 LDRHIYVAPPDYDARLQILQKCTKKFQIENTNIKLEDLAERTAGCSGAEVVLLCQEAGLA 732

Query: 437 AI 438
           AI
Sbjct: 733 AI 734

 Score =  161 bits (408), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 139/250 (55%), Gaps = 10/250 (4%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           +TY  +GG + ++E L+  + LPL  P  F   G+ PP+GILL+GPPGTGKT+  + VAN
Sbjct: 239 ITYDAIGGLRKEVELLQSTISLPLHQPTLFTDFGVTPPRGILLHGPPGTGKTMLLQCVAN 298

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DE+              
Sbjct: 299 TANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEV---DSLAPNRANDD 355

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T + G    G + V+ ATNRPN++DPAL RPGR D++VE  +PD + 
Sbjct: 356 AGEVESRVVATLLTLMSGMSAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDADA 415

Query: 392 RANIFRIHSKSMSVERD-IRWELISRLCPNT---TGAELRSVCTEAGMFAIRARRKVASE 447
           R +I   +   MS ER  +  E I  +   T    GA+L ++C E+ M  I  +R +   
Sbjct: 416 RLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI--QRGMHLY 473

Query: 448 KDFLKAVEKV 457
           KD   ++ KV
Sbjct: 474 KDIDSSLLKV 483

>KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 769

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 143/254 (56%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 297 KTNVRFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 355

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 356 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 415

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 416 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 472

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I R H K ++V  D+   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 473 RGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAELMNLVNQAAVYACQKNAIAVDMQH 532

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 533 FEWAKDKILMGAER 546

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 146/259 (56%), Gaps = 9/259 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 286 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 344

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
             +  F  V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 345 EANVPFFSVSGSEFVEMFVGVGASRVRDLFTQARSMSPSIIFIDEIDAIGKERGKGGALG 404

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 405 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 464

Query: 391 GRANIFRIHSKSMSVERDIRWEL------ISRLCPNTTGAELRSVCTEAGMFAIRARRKV 444
           GR  I+ +H K ++++  +R ++      ++ L P  TGA++ + C EA + A R   + 
Sbjct: 465 GRQQIYLVHLKRLNLDPLLRDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDQY 524

Query: 445 ASEKDFLKAVEKVINGYKK 463
            +   F +A+E+VI G +K
Sbjct: 525 ITIHHFEQAIERVIAGLEK 543

>Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C
           (AFG2) - homology to the CDC48 gene product [contig 1]
           FULL
          Length = 774

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 149/282 (52%), Gaps = 13/282 (4%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           I PS       E P V +SD+GG  D   K++E+++LPL + E F  LG++ PKGILLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQHDLKLKMKEMIQLPLEASESFKRLGVNAPKGILLYG 550

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 610

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSVE-RDIRWELISRLCPNTTGAELRSVCTEAGMF 436
           +DR +    PD + R  I    +K+  +E +D   E ++      +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFDARLQILNKCTKNFHMENQDQMLEDLAHKTEGCSGAEVVLLCQEAGLA 728

Query: 437 AIRARRKVAS--EKDFLKAVEKVING--------YKKFSSTS 468
           AI    +  +  ++ F KA+  +  G        Y  F S S
Sbjct: 729 AIMENLETENVEQRHFEKALSGISRGINAEMLQYYSDFQSRS 770

 Score =  164 bits (415), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 145/275 (52%), Gaps = 27/275 (9%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KYN+ LP+                   +Y+ VGG   +IE L+  +ELPL  P  FA  G
Sbjct: 230 KYNLPLPM-------------------SYNSVGGLNKEIELLKRTIELPLHQPTLFAEFG 270

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           + PP+GILL+GPPGTGKT+  R VA   +A  + + G  +V KY+GE    +R++F  AR
Sbjct: 271 VTPPRGILLHGPPGTGKTMLLRCVAGEANAHVLTINGPSIVSKYLGETEAALRDIFNEAR 330

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRP 365
             +  I+F DEI                EV+ R +  L+T +DG    G + ++ ATNRP
Sbjct: 331 LYQPSIVFIDEI---DSLAPSRASDDSGEVESRVVATLLTLMDGMGSSGRVVIVAATNRP 387

Query: 366 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER-DIRWELISRLCPNT--- 421
           N +D AL RPGR+D++VE  +PD+E R +I     + +S +R ++  E I  +   T   
Sbjct: 388 NAIDTALRRPGRLDQEVEIGIPDVESRHDILTKQFRKVSEKRHELTLEDIESIASKTHGY 447

Query: 422 TGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEK 456
            GA+L ++C EA M  ++        KD LK   K
Sbjct: 448 VGADLVALCREAVMKTLQRGVVHNLSKDELKVTMK 482

>ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} similar
           to uniprot|P32795 Saccharomyces cerevisiae YPR024W YME1
           Mitochondrial inner membrane protease of the AAA family
           responsible for degradation of unfolded or misfolded
           mitochondrial gene products mutation causes an elevated
           rate of mitochondrial turnover
          Length = 740

 Score =  175 bits (444), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 143/254 (56%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 268 KTNVKFDDVHGCDEARAELEEIVDF-LKDPAKYESLGGTLPKGVLLTGPPGTGKTLLARA 326

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ VRELF  AR++   I+F DE+           
Sbjct: 327 TAGEAGVDFFFMSGSEFDEVYVGVGAKRVRELFSQARSRAPAIVFIDELDAIGGKRNPKD 386

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 387 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKLVNVDLPDV 443

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  D+   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 444 RGRADILKHHMKKITLANDVDPTLIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 503

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 504 FEWAKDKILLGAER 517

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score =  176 bits (445), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 157/296 (53%), Gaps = 12/296 (4%)

Query: 175 IEEGMRVGVDRSKYNIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKL 228
           I+ G+    +  K+++++ L         I PS       E P V +SD+GG ++   K+
Sbjct: 469 IQRGLGTDANIDKFSLKVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQEELKTKM 528

Query: 229 REVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 288
           +E+++LPL + E FA LGI  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 529 KEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 588

Query: 289 KYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 348
           KYVGE  R +RE+F  AR+    IIFFDEI               N V   +  L+ ++D
Sbjct: 589 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEID 645

Query: 349 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERD 408
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD+  R  I +  +K  + E  
Sbjct: 646 GVEELKGVVIVAATNRPDEIDAALLRPGRLDRHIYVGPPDVNARLEILKKCTKKFNTEES 705

Query: 409 -IRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKK 463
            +    ++      +GAE+  +C EAG+ AI     VA  K  L+  EK   G  +
Sbjct: 706 GVDLHELADRTEGYSGAEVVLLCQEAGLAAIMEDLDVA--KVELRHFEKAFKGIAR 759

 Score =  169 bits (429), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           ++Y+ VGG   +IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 392 RANIFRIHSKSMSVERDI-RWELISRLCPNT---TGAELRSVCTEAGMFAIR 439
           R +I       MS +R +   E I  +   T    GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTIQ 470

>YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}
           RIX7Putative ATPase of the AAA family, required for
           export of pre-ribosomal large subunits from the nucleus;
           distributed between the nucleolus, nucleoplasm, and
           nuclear periphery depending on growth conditions
          Length = 837

 Score =  175 bits (443), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVG 563

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERDIRWELISR--LCPNTT 422
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +  D+ +E I R   C N +
Sbjct: 681 MIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRNEKCNNFS 740

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  148 bits (374), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P+ +   +GG  D + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 331 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|Q07844 Saccharomyces cerevisiae
           YLL034C RIX7 Putative ATPase of the AAA family required
           for export of pre-ribosomal large subunits from the
           nucleus distributed between the nucleolus nucleoplasm
           and nuclear periphery depending on growth conditions
          Length = 830

 Score =  174 bits (442), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 148/258 (57%), Gaps = 9/258 (3%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC-KDQIEKLREVVELPLLSPERFATL 245
           KY   L   P I P+         PDVT+S+VG   K +IE    +V+ P+  PE +  +
Sbjct: 498 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALGKTRIELNMAIVQ-PIKRPELYEKV 556

Query: 246 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 305
           GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  A
Sbjct: 557 GISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRA 616

Query: 306 RTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 365
           R    CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP
Sbjct: 617 RASVPCIIFFDELDALVPRRDTALSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRP 673

Query: 366 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERDIRWELISRLCPNT 421
           + +DPA+LRPGR+D+ +   LP+ + + +I +   KS    +S + DI+  +    C N 
Sbjct: 674 DMIDPAMLRPGRLDKTLFIELPNYDEKLDIVKTLIKSNGTPLSSDVDIQCIVADERCRNF 733

Query: 422 TGAELRSVCTEAGMFAIR 439
           +GA+L ++  E+ + A++
Sbjct: 734 SGADLAALVRESSVLALK 751

 Score =  155 bits (391), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 134/233 (57%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P    + +GG  D I +L E++ LP+L PE +A+ G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PTTNLATLGGMDDVIAQLMELIGLPILHPEIYASTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 263 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKNLAPCLVFFDEIDAITPKRDGGAQ 322

Query: 331 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D   F+  G   + V+ ATNRP++LDPAL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSFEKTGGKPVIVIGATNRPDSLDPALRRAGRFDREICLNV 380

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEISRLHILKKMSSALKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 433

>Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  174 bits (441), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 147/257 (57%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERDIRWELI--SRLCPNTT 422
            +DPA+LRPGR+D+ +   LP++E + +I +  +KS    +  D+ +E I  +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNMEEKLDIIKTLTKSHGTPLSGDVDFEKIIKNEKCNNFS 740

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  149 bits (375), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P+ +   +GG  D + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKTLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 331 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I R  S  + ++  I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILRKMSDDLKIDGAIDFAKLSKLTPGFVGADLKALVTAAGTCAIK 430

>TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.259
           YLR397C
          Length = 778

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 144/267 (53%), Gaps = 7/267 (2%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           + PS       E P V +SD+GG ++   K+ E+++LPL + E F+ LG+  PKG+LLYG
Sbjct: 495 VRPSAMREIFLEMPKVYWSDIGGQEELKRKMVEMIQLPLEASETFSRLGVSAPKGVLLYG 554

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 614

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I                 V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 IDALSPDRDGPSSSAAGHV---LTSLLNEIDGVEELNGVVIVGATNRPDEIDPALLRPGR 671

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWEL--ISRLCPNTTGAELRSVCTEAGM 435
           +DR +  + PD   R  I    S   S E +  ++L  ++R     +GAE+  +C EAG+
Sbjct: 672 LDRHIYVAPPDYAARLQILTKCSSKFSTEEEPDYDLENLARRTEGCSGAEVVLLCQEAGL 731

Query: 436 FAIRAR--RKVASEKDFLKAVEKVING 460
            AI      K    + F KA+  +  G
Sbjct: 732 AAIMENLDTKRVEARHFEKALSGISRG 758

 Score =  155 bits (392), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 128/231 (55%), Gaps = 10/231 (4%)

Query: 215 YSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 274
           YS VGG   +I+ L++ +ELPL  P  F    + PP+G+LL+GPPGTGKT+  R  AN  
Sbjct: 243 YSLVGGLAKEIDSLKKTIELPLHQPTLFTRFAVSPPRGVLLHGPPGTGKTMLLRCFANTC 302

Query: 275 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN 334
           +A  + + G  +V K++GE    +RE+F+ A+  +  IIF DEI                
Sbjct: 303 NAHVLTINGPSIVSKFLGETEATLREIFDEAKKYQPSIIFIDEIDSIAPNRAHDDSGEAE 362

Query: 335 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 394
              R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD++ R  
Sbjct: 363 --SRVVATLLTLMDGMGGAGRVVVVAATNRPNAVDPALRRPGRFDQEVEIAVPDVDARLE 420

Query: 395 IFRIHSKSMS------VERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           I +     M+       + DIR   I+       GA+L ++C E+ M AI+
Sbjct: 421 ILKKQFDKMNSDLHTLSDDDIRN--IASRTHGYVGADLIALCRESVMKAIQ 469

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 158/296 (53%), Gaps = 12/296 (4%)

Query: 175 IEEGMRVGVDRSKYNIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKL 228
           I+ G+    +  K+++++ L         I PS       E P V +SD+GG +D   K+
Sbjct: 469 IQRGLGTDANIDKFSLKVTLKDVECAMVDIRPSAMREIFLEMPKVYWSDIGGQEDLKTKM 528

Query: 229 REVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 288
           +E+++LPL + E F  LGI  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 529 KEMIQLPLEASETFTRLGITAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEVFN 588

Query: 289 KYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 348
           KYVGE  R +RE+F  AR+    IIFFDEI               + V   +  L+ ++D
Sbjct: 589 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPDRDGGSTSAASHV---LTSLLNEID 645

Query: 349 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERD 408
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD+  R  I +  +K  ++E  
Sbjct: 646 GVEELKGVVIVAATNRPDEIDSALLRPGRLDRHIYVGPPDVNARLEILKKCTKKFNIEES 705

Query: 409 -IRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKK 463
            I  + ++R     +GAE+  +C E+G+ AI     V   K  L+  EK   G  +
Sbjct: 706 GIDLQELARRTEGYSGAEVVLLCQESGLSAIMEDLDVT--KVELRHFEKAFKGISR 759

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           ++Y+ VGG + +IE L+  +++PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLRKEIELLKSAIDIPLHQPALFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD+E 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVEA 418

Query: 392 RANIFRIHSKSMSVER-DIRWELISRLCPNT---TGAELRSVCTEAGMFAIR 439
           R +I       MS +R  +  E I  +   T    GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQVSRMSPDRHSLDSEAIKLIASKTHGYVGADLTALCRESVMKTIQ 470

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  174 bits (441), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 145/257 (56%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERDIRWELISRLCPNTT 422
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +S + D    + +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEKIITNEKCNNFS 740

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P+ +   +GG  D + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 331 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--KRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSNNLKIDGIIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.430
           YPR024W
          Length = 740

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 143/254 (56%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 267 KTNVKFDDVCGCDEARAELEEIVDF-LKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARA 325

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 326 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 385

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 386 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 442

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GR++I + H K +++  D+   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 443 RGRSDILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQH 502

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 503 FEWAKDKILMGAER 516

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 505 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRVELNMAIVQPIKRPELYEKVG 564

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 565 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 624

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 625 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 681

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS--VERDIRWELI--SRLCPNTT 422
            +DPA+LRPGR+D+ +   LP+ E + +I +  +KS    +  D+ +E I  +  C N +
Sbjct: 682 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSDDVDFEKIITNEKCNNYS 741

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L ++  E+ + A++
Sbjct: 742 GADLAALVRESSVLALK 758

 Score =  146 bits (369), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 131/232 (56%), Gaps = 6/232 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P+ +   +GG  D I +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVIAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 331 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIVGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
           P+   R +I +  S  + ++  I +  +++L P   GA+L+++ T AG  AI
Sbjct: 378 PNEVSRLHILKKMSDKLKIDGTIDFAKLAKLTPGFVGADLKALVTAAGTCAI 429

>NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {ON}
           Anc_7.430
          Length = 712

 Score =  172 bits (437), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 146/255 (57%), Gaps = 6/255 (2%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 305 KTNVKFDDVQGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 363

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 364 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 423

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 424 QAY---AKQTLNQLLVELDGFSQSTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 480

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  D+   LI+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 481 RGRADILKHHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQ-QNAIAVDMS 539

Query: 450 FLK-AVEKVINGYKK 463
            L+ A +K++ G ++
Sbjct: 540 HLEWAKDKILMGAER 554

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 284 ISFRNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 342

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 343 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 402

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 403 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 462

Query: 391 GRANIFRIHSKSMSVERDIRWEL------ISRLCPNTTGAELRSVCTEAGMFAIRARRKV 444
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 463 GRQQIYLVHLKKLNLDPLLTDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDSY 522

Query: 445 ASEKDFLKAVEKVINGYKK 463
            +   F +A+E+VI G +K
Sbjct: 523 ITIHHFEQAIERVIAGLEK 541

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           ++Y+ VGG   +IE L+  +E+PL  PE F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLNKEIESLKSAIEIPLHQPELFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETESALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 392 RANIFRIHSKSMSVERD-IRWELISRLCPNT---TGAELRSVCTEAGMFAIR 439
           R +I       MS ER  +  E I  +   T    GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSPERHLLNSEGIKHIASKTHGYVGADLTALCRESVMKTIQ 470

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/297 (35%), Positives = 160/297 (53%), Gaps = 16/297 (5%)

Query: 175 IEEGMRVGVDRSKYNIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKL 228
           I+ G+    +  K+++++ L         I PS       E P V +SD+GG ++  +K+
Sbjct: 469 IQRGLGTDANIDKFSLKVTLEDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQEELKKKM 528

Query: 229 REVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 288
           +E+++LPL + E F+ LGI  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 529 KEMIQLPLEASETFSRLGISAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 588

Query: 289 KYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 348
           KYVGE  R +RE+F  AR+    IIFFDEI               N V   +  L+ ++D
Sbjct: 589 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEID 645

Query: 349 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER- 407
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD+  R  I +  +K  + +  
Sbjct: 646 GVEELKGVVIVAATNRPDEIDAALLRPGRLDRHIYVGPPDVNARLEILKKCTKKFNTKES 705

Query: 408 --DIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVA--SEKDFLKAVEKVING 460
             D+ +EL  R     +GAE+  +C EAG+ AI     V     + F KA E +  G
Sbjct: 706 GVDL-YELADR-TEGYSGAEVVLLCQEAGLAAIMDNLDVTMVELRHFEKAFEGIARG 760

>TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.430
           YPR024W
          Length = 802

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 143/254 (56%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K DV + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 332 KTDVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 390

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F+ + GSE  + YVG GA+ +R+LF  AR K   IIF DE+           
Sbjct: 391 TAGEAGVDFLFMSGSEFDEVYVGVGAKRIRDLFAQARAKAPAIIFIDELDAIGGKRNPKD 450

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P+ LD AL RPGR D+ V   LPD+
Sbjct: 451 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPDALDKALTRPGRFDKIVNVDLPDV 507

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GR++I R H K +++  D+   +I+R  P  +GAEL ++  +A ++A +      +   
Sbjct: 508 RGRSDILRHHMKKITLAPDVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 567

Query: 450 FLKAVEKVINGYKK 463
              A +K++ G +K
Sbjct: 568 LEWAKDKILMGAEK 581

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 287 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 345

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 346 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 405

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 406 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 465

Query: 391 GRANIFRIHSKSMSVERDIRWEL------ISRLCPNTTGAELRSVCTEAGMFAIRARRKV 444
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 466 GRQQIYLVHLKRLNLDPLLTDDMGNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 525

Query: 445 ASEKDFLKAVEKVINGYKK 463
            +   F +A+E+VI G +K
Sbjct: 526 ITIHHFEQAIERVIAGLEK 544

>ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 826

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 138/248 (55%), Gaps = 7/248 (2%)

Query: 196 PRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILL 255
           P I P+         PDVT++ VG       +L   +  P+  PE +  +GI  P G+LL
Sbjct: 496 PTIQPTAKREGFATVPDVTWASVGALTKVRVELNMAIVQPIKKPELYEKVGISAPAGVLL 555

Query: 256 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 315
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+IFF
Sbjct: 556 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFF 615

Query: 316 DEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 375
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 616 DELDALVPRRDSTLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAMLRP 672

Query: 376 GRIDRKVEFSLPDLEGRANIF----RIHSKSMSVERDIRWELISRLCPNTTGAELRSVCT 431
           GR+D+ +   LP+ E + +I     R +   MS + D+   +    C N +GA++ S+  
Sbjct: 673 GRLDKTLFIELPNAEEKLDILKTLVRTNGTPMSSDVDLETVIADDRCKNFSGADIASLVR 732

Query: 432 EAGMFAIR 439
           E+ + A++
Sbjct: 733 ESSVLALK 740

 Score =  146 bits (368), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P      +GG +D + +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      F+ +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 247 AGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEARSLAPCLMFFDEIDAITPKRDGGAQ 306

Query: 331 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D  +        + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDELNMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 364

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  ++++ ++ +I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 365 PNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 417

>SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024W YME1 Mitochondrial inner membrane protease of
           the AAA family responsible for degradation of unfolded
           or misfolded mitochondrial gene products mutation causes
           an elevated rate of mitochondrial turnover
          Length = 741

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 269 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 327

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 328 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 387

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 388 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 444

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  ++   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 445 RGRADILKHHMKKVTLASEVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMSH 504

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 505 FEWAKDKILMGAER 518

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score =  173 bits (438), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 156/288 (54%), Gaps = 13/288 (4%)

Query: 156 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTY 215
           L  I KF+    E   P + E+  ++ +   KY   L   P I P+         PDVT+
Sbjct: 496 LSIIQKFIQNFPE---PLNDEQLAQLSI---KYEDFLKALPTIQPTAKREGFATVPDVTW 549

Query: 216 SDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTD 275
           ++VG       +L   +  P+  PE +  +GI+ P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 550 ANVGALGKVRVELNMAIVQPIKRPELYEKVGINAPAGVLLWGPPGCGKTLLAKAVANESR 609

Query: 276 ATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNE 335
           A FI + G EL+ KYVGE  R +R++F  AR    C+IFFDE+               + 
Sbjct: 610 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSR 669

Query: 336 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI 395
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I
Sbjct: 670 VVNTLL---TELDGLNDRRGIFVVAATNRPDMIDPAMLRPGRLDKTIFIELPNYEEKVDI 726

Query: 396 FRIHSKS----MSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
               S+S    ++   D R  +    C N +GA+L ++  E+ + A++
Sbjct: 727 ITTVSRSSGTPLAEGVDFRKIIQDERCRNFSGADLAALVRESSVLALK 774

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P    + +GG  D I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PSSDLNSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +RELFE A++   C++FFDEI            
Sbjct: 263 AGELKVPFISISAPSVVSGMSGESEKKLRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 322

Query: 331 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSMEQTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 380

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  S ++ ++ +I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEVSRLHILKKMSNNLKIDGEIDFLKLAKLTPGFVGADLKALTTAAGTCAIK 433

>AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR024W (YME1)
          Length = 732

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 143/254 (56%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 260 KTNVKFEDVRGCDEARAELEEIVDF-LKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARA 318

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 319 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 378

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 379 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 435

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H + +++  D+   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 436 RGRADILQHHMRKVTLAPDVDPSIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTH 495

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 496 FEWAKDKILMGAER 509

>KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {ON}
           Anc_4.23 YLL034C
          Length = 785

 Score =  172 bits (437), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT++++G   +   +L   +  P+  PE +  +G
Sbjct: 454 KYEDFLKALPTIQPTAKREGFATVPDVTWNNIGALSNVRLELNMAIVQPIKRPELYEKVG 513

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 514 INAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 573

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 574 ASIPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 630

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERDIRW-ELISRL-CPNTT 422
            +DPA+LRPGR+D+ +   LP  E + +I +  + S    V  DI + E+I+   C N +
Sbjct: 631 MIDPAMLRPGRLDKTIFIELPTKEEKLDILQTLLRSNGTPVAHDIDFAEIINDFRCQNFS 690

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L ++  E+ + A++
Sbjct: 691 GADLAALVRESSVSALK 707

 Score =  152 bits (385), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 130/234 (55%), Gaps = 8/234 (3%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P+     +GG  D + +L E++ LP+L PE F T GIDPP+G+LL+GPPG GKT  A A+
Sbjct: 167 PETNLQSLGGMDDVVAQLMELIGLPILHPEIFETTGIDPPRGVLLHGPPGCGKTSIANAL 226

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXX-----XXX 325
           A      FI V    +V    GE  + +R+LFE A+    C+IFFDEI            
Sbjct: 227 AGELKVPFISVSAPSVVSGMSGESEKKIRDLFEEAQQIAPCLIFFDEIDAITPKRDGGAQ 286

Query: 326 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 385
                    ++  +M EL  Q  G  P   + V+ ATNRP++LD AL R GR DR++  +
Sbjct: 287 REMEKRIVAQLLTSMDELTLQKTGGKP---VIVIGATNRPDSLDAALRRAGRFDREICLN 343

Query: 386 LPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           +P+   R +I +  S ++ ++ +I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 344 VPNEVSRLHILKKLSSTLKLDGEIDFLQLAKLTPGFVGADLKALITAAGTCAIK 397

>KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 814

 Score =  172 bits (437), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 140/257 (54%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+S VG       +L   +  P+  PE +  +G
Sbjct: 485 KYEDFLKALPTIQPTAKREGFATVPDVTWSSVGALDKIRIELNMAIVQPIKRPELYEKVG 544

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 545 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFNRAR 604

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 605 ASVPCIIFFDELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 661

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERDIRWELI--SRLCPNTT 422
            +DPA+LRPGR+D+ +   LP+ E + +I R  I S    +  D+    I     C N +
Sbjct: 662 MIDPAMLRPGRLDKTLFIELPNFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNFS 721

Query: 423 GAELRSVCTEAGMFAIR 439
           GA++ ++  E+ + A++
Sbjct: 722 GADIAALVRESSVLALK 738

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P    S +GG  D I +L E++ LP+L PE ++  G++PP+G+LL+GPPG GKT  A A+
Sbjct: 194 PSSNLSTLGGMDDVIAQLMELIGLPILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANAL 253

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 254 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 313

Query: 331 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D   F+      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 314 REME--RRIVAQLLTSMDELSFEKMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 371

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R  I +  + S+ ++ +I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 372 PNETSRYFILKKMASSLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 424

>Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}
           similar to Ashbya gossypii AFR188W
          Length = 838

 Score =  172 bits (437), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+++VG       +L   +  P+  PE +  +G
Sbjct: 502 KYEDFLKALPTIQPTAKREGFATVPDVTWTNVGALTKIRMELNMAIVQPIKRPELYEKVG 561

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 562 ISAPAGVLLWGPPGCGKTLIAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 621

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 622 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIAATNRPD 678

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERDIRWELI--SRLCPNTT 422
            +DPA+LRPGR+D+ +   LPDL  + +I +  I S    +  +I   +I     C N +
Sbjct: 679 IIDPAMLRPGRLDKTLFIELPDLTEKHDILKTLIRSNGTPLAPNIDLSVIVSDERCRNFS 738

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L S+  E+ + A++
Sbjct: 739 GADLASLVRESSVLALK 755

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P    S +GG  D + +L E++ LP+L PE +A+ GI+PP+G+L +GPPG GKT  A A+
Sbjct: 206 PQTDLSSLGGMDDVVAQLMELIGLPILHPEIYASTGIEPPRGVLFHGPPGCGKTSIANAL 265

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 266 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAIAPKRDGGAQ 325

Query: 331 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D   FD      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 326 REME--RRIVAQLLTSMDELSFDKTDGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 383

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  + ++ +   I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 384 PNEASRMHILKKMTSNLKINGQIDFVKLSKLTPGFVGADLKALVTAAGTCAIK 436

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score =  172 bits (437), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 145/257 (56%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+S+VG  +    +L   +  P+  PE +  +G
Sbjct: 503 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKVG 562

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 563 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 622

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 623 ASVPCVIFFDELDALVPRRDTSMSESSSRVVNTLL---TELDGLNDRHGIFVVGATNRPD 679

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKS----MSVERDIRWELISRLCPNTT 422
            +DPA+LRPGR+D+ +   LP+ + + +I R  + S    +S + D++  +    C N +
Sbjct: 680 MIDPAMLRPGRLDKTLFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNFS 739

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L ++  E+ + A++
Sbjct: 740 GADLAALVRESSVLALK 756

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P  + S +GG  D I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 193 PTSSLSALGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 252

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 253 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 312

Query: 331 XXXNEVQRTMLELITQLDGF---DPRGN-IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D     +  G  + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 313 REME--RRIVAQLLTSMDELTLSNTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 370

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  +  + ++ +I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 371 PNEISRLHILKKMAGKLKIDGEIDFHKLAKLTPGFVGADLKALTTAAGTCAIK 423

>KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 744

 Score =  172 bits (435), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 273 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 331

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 332 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 391

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 392 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 448

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GR +I + H K +++  D+   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 449 RGRTDILKHHMKKVTLASDVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMNH 508

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 509 FEWAKDKILMGAER 522

>YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}
           AFG3Component, with Yta12p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 761

 Score =  172 bits (435), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 285 ISFKNVAGCDEAKQEIMEFVHF-LKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 343

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 330
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 344 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 403

Query: 331 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 390
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 404 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 463

Query: 391 GRANIFRIHSKSMSVERDIRWEL------ISRLCPNTTGAELRSVCTEAGMFAIRARRKV 444
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 464 GRQQIYLVHLKRLNLDPLLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 523

Query: 445 ASEKDFLKAVEKVINGYKK 463
            +   F +A+E+VI G +K
Sbjct: 524 ITIHHFEQAIERVIAGLEK 542

>Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 143/254 (56%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  ++   +I+R  P  +GAEL ++  +A ++A +      +   
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 510

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON}
           Anc_4.259 YLR397C
          Length = 808

 Score =  171 bits (434), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 148/284 (52%), Gaps = 15/284 (5%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           + PS       E P V +SD+GG ++  +K++E+++LPL + E F  LG+  PKG+LLYG
Sbjct: 523 VRPSAMREIFLEMPKVYWSDIGGQEELKQKMKEMIQLPLEASETFNKLGVTAPKGVLLYG 582

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 583 PPGCSKTLTAKALATESGINFFAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 642

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 643 IDAISSSREGGSGSDVS--NHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 700

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNT---TGAELRSVCTEAG 434
           +DR +    PD   R  I +  +     E       +  L   T   +GAE+  +C EAG
Sbjct: 701 LDRHLYVGPPDFNARLQIIKKCTIKFGSEIQNDEPFLRELSAKTGGCSGAEVVLLCQEAG 760

Query: 435 MFAIRARRKV--ASEKDFLKAVEKVING--------YKKFSSTS 468
           + AI A  +V    +  F  A+E +  G        Y++F+S S
Sbjct: 761 LSAIMADYQVDKVGKHHFQNALEGLSRGITEDMLGYYQQFASRS 804

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 8/232 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           ++Y+ VGG   +IE L+  +ELPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 269 LSYNLVGGLNKEIEILKNAIELPLHKPKLFSRFGVSPPRGILLHGPPGTGKTMLLRCVAN 328

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            ++A  + + G  +V KY+GE    +R+ F  A+  +  IIF DEI              
Sbjct: 329 NSNAHVLTINGPSIVSKYLGETESSLRDFFNEAKKYQPSIIFIDEI---DSIAPNRSSDD 385

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G + V+ ATNRPN++D AL RPGR D+++E  +PD++G
Sbjct: 386 SGEVESRVVATLLTLMDGMGNSGRVVVVGATNRPNSIDSALRRPGRFDQEIEIGIPDVDG 445

Query: 392 RANIFRIHSKSMSVER----DIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           R +I       MS ER    D   + I+       GA+L ++C E+ M AI+
Sbjct: 446 RKDILLKQFHKMSSERHSLSDEDIQSIASKTHGYVGADLSALCRESVMKAIQ 497

>CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024w protease
          Length = 745

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 272 KTNVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 330

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 331 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 390

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 391 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 447

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  ++   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 448 RGRADILKHHMKKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTH 507

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 508 FEWAKDKILMGAER 521

>YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}
           YME1Catalytic subunit of the mitochondrial inner
           membrane i-AAA protease complex, which is responsible
           for degradation of unfolded or misfolded mitochondrial
           gene products; mutation causes an elevated rate of
           mitochondrial turnover
          Length = 747

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  ++   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  171 bits (432), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  ++   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 99/271 (36%), Positives = 146/271 (53%), Gaps = 10/271 (3%)

Query: 175 IEEGMRVGVDRSKYNIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKL 228
           I+ G+ +  D  K+++ + L         I PS       E P V +SD+GG  +   K+
Sbjct: 466 IQRGLGLDADIDKFSLIVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQDELKTKM 525

Query: 229 REVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 288
           +E+++LPL + E FA LGI  PKG+LLYGPPG  KTL A+A+A  +   F  V G E+  
Sbjct: 526 KEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFFAVKGPEVFN 585

Query: 289 KYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 348
           KYVGE  R +RE+F  AR+    IIFFDEI               N V   +  L+ ++D
Sbjct: 586 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPVRDGGSTSAANHV---LTSLLNEID 642

Query: 349 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVE-R 407
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD   R  I +  +K  + E  
Sbjct: 643 GVEELKGVVIVAATNRPDEIDGALLRPGRLDRHIYVGPPDANARLEILKKCTKKFNTEGS 702

Query: 408 DIRWELISRLCPNTTGAELRSVCTEAGMFAI 438
            +  + ++      +GAE+  +C EAG+ AI
Sbjct: 703 GVDLQELAARTKGYSGAEVVLLCQEAGLAAI 733

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 135/232 (58%), Gaps = 8/232 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           ++Y+ VGG   +IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 ISYAAVGGLNKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 298

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            ++A  + + G  +V KY+GE    +RE+F  AR  +  IIF DEI              
Sbjct: 299 TSNAHVLTINGPSIVSKYLGETESALREIFNEARKYQPSIIFIDEI---DSIAPNRANDD 355

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEVESRVVATLLTLMDGMGAAGRLIVIAATNRPNCVDPALRRPGRFDQEVEIGIPDVDA 415

Query: 392 RANIFRIHSKSMSVERD-IRWELISRLCPNT---TGAELRSVCTEAGMFAIR 439
           R +I       MS +R  +  E I  +   T    GA+L ++C E+ M  I+
Sbjct: 416 RFDILTRQFSKMSPDRHALNLEEIKHIASKTHGYVGADLTALCRESVMKTIQ 467

>KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23
           YLL034C
          Length = 794

 Score =  171 bits (432), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 143/257 (55%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY+  L   P I P+         PDV++S VG  +    +L   +  P+  PE +  +G
Sbjct: 463 KYDDFLKALPTIQPTAKREGFATVPDVSWSSVGALQKIRLELNMAIVQPIKRPELYEKVG 522

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 523 INAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFARAR 582

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 583 ASIPCIIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 639

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHSKSMSVERDIRWELI--SRLCPNTT 422
            +DPA+LRPGR+D+ +   LP+ E + +IF+  I S    +  D+    I       N +
Sbjct: 640 MIDPAMLRPGRLDKTLFIELPNAEEKLDIFKTLIRSNGTPIANDVDLAKIIEDDRSKNYS 699

Query: 423 GAELRSVCTEAGMFAIR 439
           GA+L ++  E+ + A++
Sbjct: 700 GADLAALVRESSILALK 716

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P +T   +GG  D + +L E++ LP+L PE +A  GI+PP+G+LL+GPPG GKT  A A+
Sbjct: 178 PSITLKSLGGMDDVVAQLMELIGLPILHPEIYAATGIEPPRGVLLHGPPGCGKTTIANAL 237

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A   +  FI +    +V    GE  + +R++F+ A++   C+IFFDEI            
Sbjct: 238 AGELNVPFINISAPSIVSGMSGESEKKLRDVFQEAKSIAPCLIFFDEIDAITPKRDGGAQ 297

Query: 331 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 298 REME--KRIVAQLLTSMDELTMEHTDGKPVIVIGATNRPDALDSALRRAGRFDREICLNV 355

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 356 PNEISRLHILKKMASNLKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 408

>ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]
           {ON} highly similar to uniprot|P32794 Saccharomyces
           cerevisiae YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18
           (AAA) family forms a hexameric complex may be involved
           in degradation of aberrant mRNAs
          Length = 777

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/269 (35%), Positives = 142/269 (52%), Gaps = 5/269 (1%)

Query: 198 IDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 257
           I PS       E P V ++D+GG      K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 492 IRPSAMREIFLEMPKVYWTDIGGQDVLKRKMKEMIQLPLEASETFARLGVSAPKGVLLYG 551

Query: 258 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 317
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 552 PPGCSKTLTAKALATESGVNFLAVKGPEIFSKYVGESERAIREIFHKARSAAPSIIFFDE 611

Query: 318 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 377
           I                     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 612 I-DAISSSRDDGGSSTTAASNVLTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 670

Query: 378 IDRKVEFSLPDLEGRANIFRIHSKSMSVER--DIRWELISRLCPNTTGAELRSVCTEAGM 435
           +DR +    PD   R  I +  +   S++   D   E ++      +GAE+  +C EAG+
Sbjct: 671 LDRHIYVGPPDYSARLQILKKCTSKFSIDSQPDYNLEKLAEHTDGCSGAEIVLLCQEAGL 730

Query: 436 FAIRARRKVASEKDFLKAVEKVINGYKKF 464
            AI     V + K   +  EK ++G  + 
Sbjct: 731 AAI--MEDVEANKVESRHFEKALSGISRI 757

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/232 (40%), Positives = 135/232 (58%), Gaps = 8/232 (3%)

Query: 213 VTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 272
           + Y  VGG   +IE L+  + LPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 236 IGYDSVGGLAKEIEVLKNAIHLPLHKPKLFSEFGVAPPRGILLHGPPGTGKTMLLRCVAN 295

Query: 273 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 332
            TDA  + + G  +V KY+GE    +RE+F+ A+  +  IIF DEI              
Sbjct: 296 TTDAHILTINGPSIVSKYLGETEATLREIFDEAKLYQPSIIFIDEI---DSIAPNRASDD 352

Query: 333 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 391
             EV+ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD+E 
Sbjct: 353 SGEVESRVVATLLTLMDGMGAAGRLVVVAATNRPNNIDPALRRPGRFDQEVEIAIPDVEE 412

Query: 392 RANIFRIHSKSMSVER-DIRWELISRLCPNT---TGAELRSVCTEAGMFAIR 439
           R +I     + MS E+  +  E I  +   T    GA+L ++C E+ M  I+
Sbjct: 413 RIDILMKQFERMSSEKHSLSAEDIKEVAAKTHGYVGADLTALCRESVMKTIQ 464

>Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 210 KPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 269
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 270 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 329
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 330 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 389
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 390 EGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKD 449
            GRA+I + H K +++  ++   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 510

Query: 450 FLKAVEKVINGYKK 463
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {ON}
           Anc_7.430
          Length = 777

 Score =  169 bits (429), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 101/275 (36%), Positives = 155/275 (56%), Gaps = 9/275 (3%)

Query: 194 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 253
           L    D S  + + + + +VT++DV GC +   +L E+V+  L +P+++  LG    KG+
Sbjct: 280 LINNTDASKIIDSTDVENNVTFNDVKGCDEARFELEEIVDF-LKNPDKYKHLGGVMTKGV 338

Query: 254 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 313
           LL GPPGTGKTL A+A A+ ++  F  + GSE  + YVG GA+ +RELF  AR     II
Sbjct: 339 LLTGPPGTGKTLLAKATASESNVKFFTMSGSEFDEVYVGVGAKRIRELFNQARQNSPAII 398

Query: 314 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 373
           F DEI                  ++T+ +L+ +LDGF     I ++ ATN P +LD ALL
Sbjct: 399 FIDEIDAIGGKRSGKDDQGF--ARQTLNQLLVELDGFKKDEGIIIIGATNFPESLDKALL 456

Query: 374 RPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEA 433
           RPGR D+ V   LPD+ GR  I + H   +++  D+   LI+R  P  +GAEL ++  +A
Sbjct: 457 RPGRFDKIVNIDLPDVRGRTEILKHHMGKITLGDDVDCTLIARGTPGLSGAELFNLVNQA 516

Query: 434 GMFAIRARRKVASEKDFLK---AVEKVINGYKKFS 465
            ++A +     ASE + L    A +K++ G ++ S
Sbjct: 517 AVYACQQN---ASEVNMLHLEWAKDKILMGAERKS 548

>TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {ON}
           Anc_4.23 YLL034C
          Length = 861

 Score =  170 bits (430), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/257 (35%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 187 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 246
           KY   L   P I P+         PDVT+  +G       +L   +  P+  PE +  +G
Sbjct: 506 KYEDFLKALPTIQPTAKREGFATVPDVTWESIGALDKIRAELNLAIVQPVKRPELYEKVG 565

Query: 247 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 306
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 566 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFSRAR 625

Query: 307 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 366
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 626 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 682

Query: 367 TLDPALLRPGRIDRKVEFSLPDLEGRANIF----RIHSKSMSVERDIRWELISRLCPNTT 422
            +DPA+LRPGR+D+ +   LP+ E + +I     +++   ++ + D+   +    C N +
Sbjct: 683 MIDPAMLRPGRLDKTLFIELPNFEEKLDILKTITKVNGTPLASDVDLSIIINDERCRNYS 742

Query: 423 GAELRSVCTEAGMFAIR 439
           GA++ S+  E+ + A++
Sbjct: 743 GADIASLVRESSVLALK 759

 Score =  150 bits (379), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 211 PDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 270
           P  + S +GG  D I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 202 PTSSLSSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 261

Query: 271 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 330
           A      FI V    +V    GE  + VRELFE A++   C++FFDEI            
Sbjct: 262 AGELQVPFISVSAPSVVSGMSGESEKKVRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 321

Query: 331 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 386
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 322 REME--RRIVAQLLTSMDELSMEKTDGKPVIVIGATNRPDALDAALRRAGRFDREICLNV 379

Query: 387 PDLEGRANIFRIHSKSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIR 439
           P    R +I +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 380 PSEVSRLHILKKMSNNLRIDGHIDFSKLAKLTPGFVGADLKALVTAAGTCAIK 432

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,340,103
Number of extensions: 1500705
Number of successful extensions: 6079
Number of sequences better than 10.0: 534
Number of HSP's gapped: 5503
Number of HSP's successfully gapped: 658
Length of query: 474
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 361
Effective length of database: 40,524,141
Effective search space: 14629214901
Effective search space used: 14629214901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)