Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F011005.528ON47547515840.0
NDAI0H016105.528ON5191632362e-20
NDAI0C010605.528ON637671607e-11
TPHA0K005205.528ON560571581e-10
TBLA0G009305.528ON608771581e-10
KNAG0B036805.528ON482591571e-10
NCAS0H025605.528ON587671572e-10
TDEL0A039205.528ON466951562e-10
KLTH0G03784g5.528ON569551553e-10
Kpol_1023.975.528ON591581535e-10
KAFR0C054005.528ON481551517e-10
Skud_13.1475.528ON665551528e-10
YML007W (YAP1)5.528ON650551519e-10
Smik_13.1445.528ON639551501e-09
Suva_13.1555.528ON645551501e-09
SAKL0G04950g5.528ON567581501e-09
CAGL0H04631g5.528ON588551501e-09
ZYRO0D12584g5.528ON579541492e-09
Kpol_1004.225.528ON475551482e-09
Kwal_47.186315.528ON584551455e-09
KLLA0A01760g5.528ON583581438e-09
TPHA0D023405.528ON506931421e-08
TBLA0D016405.528ON599501294e-07
YDR423C (CAD1)5.528ON4091011232e-06
Smik_4.6985.528ON3931001222e-06
KNAG0C032105.528ON384881194e-06
Suva_2.600singletonOFF3821221071e-04
CAGL0F03069g5.528ON48645790.37
Kwal_56.235118.242ON111440697.4
NOTE: 4 genes in the same pillar as NCAS0F01100 were not hit in these BLAST results
LIST: KAFR0E03290 ADR195C Ecym_4064 Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F01100
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...   614   0.0  
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    96   2e-20
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    66   7e-11
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    65   1e-10
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    65   1e-10
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    65   1e-10
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    65   2e-10
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    65   2e-10
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...    64   3e-10
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    64   5e-10
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    63   7e-10
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    63   8e-10
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    63   9e-10
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    62   1e-09
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    62   1e-09
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...    62   1e-09
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    62   1e-09
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    62   2e-09
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    62   2e-09
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    60   5e-09
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...    60   8e-09
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    59   1e-08
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    54   4e-07
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    52   2e-06
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    52   2e-06
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    50   4e-06
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    46   1e-04
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    35   0.37 
Kwal_56.23511 s56 (579642..582986) [3345 bp, 1114 aa] {ON} YER17...    31   7.4  

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 323/475 (68%)

Query: 1   MSTTDEXXXXXXXXXXXXXXXXXXXXXPLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSTTDE                     PLD                              
Sbjct: 1   MSTTDEQQQQQQQPVVVKRRVGRPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELE 60

Query: 61  XXISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDXXXXXXXXXXXXNQPSMKA 120
             ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD            NQPSMKA
Sbjct: 61  DKISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDSKVLKYLSLKKKNQPSMKA 120

Query: 121 TSIDSLIEMENKKTDEISKESPDSTLXXXXXXXXXXXXXDTNQVPSPNESTGSHISSPDS 180
           TSIDSLIEMENKKTDEISKESPDSTL             DTNQVPSPNESTGSHISSPDS
Sbjct: 121 TSIDSLIEMENKKTDEISKESPDSTLNNNANNNNNNNNNDTNQVPSPNESTGSHISSPDS 180

Query: 181 QSLKHDEGLRLPSFSNKYDINSHDGGGITSSNWIDNIFDGDTAEGLXXXXXXXXXXXXXX 240
           QSLKHDEGLRLPSFSNKYDINSHDGGGITSSNWIDNIFDGDTAEGL              
Sbjct: 181 QSLKHDEGLRLPSFSNKYDINSHDGGGITSSNWIDNIFDGDTAEGLPSFPASISSSSETP 240

Query: 241 XVNANDNDHSHVDFTNNLLDHNMIFTNEFSFHNQFDDHPIIDLXXXXXXXXXXXXXAFVI 300
            VNANDNDHSHVDFTNNLLDHNMIFTNEFSFHNQFDDHPIIDL             AFVI
Sbjct: 241 PVNANDNDHSHVDFTNNLLDHNMIFTNEFSFHNQFDDHPIIDLTTQQKPTQQQQQQAFVI 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFPTDINENEVFVKQYQEYVSQQQ 360
                                               AFPTDINENEVFVKQYQEYVSQQQ
Sbjct: 301 SNTWDSNSNGNSTDNDTQSLIGNNINNNNPLIDSNLAFPTDINENEVFVKQYQEYVSQQQ 360

Query: 361 PAEQDTITCPCQHADTGAXXXXXXXXXXFISRNLLNNESIPSILRDKTSIDGGMACNKYS 420
           PAEQDTITCPCQHADTGA          FISRNLLNNESIPSILRDKTSIDGGMACNKYS
Sbjct: 361 PAEQDTITCPCQHADTGADDDDEEIECEFISRNLLNNESIPSILRDKTSIDGGMACNKYS 420

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF
Sbjct: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 85/163 (52%), Gaps = 30/163 (18%)

Query: 337 AFPTDINENEVFVKQYQEY--------VSQQQPAEQDTITCPCQHADTGAXXXXXXXXXX 388
           AFP+ + EN++F ++Y            S  Q  +    TC  Q                
Sbjct: 363 AFPSTMTENDLFAQRYGTMQSSSSSLSESAMQLGDDKKCTCNDQ-----CNSDDEEIECE 417

Query: 389 FISRNLLNNESIPSILRDKTS---------IDGGMACNKYSKCSAIWKRFKTQ------- 432
            +SRNLLN+ES+ SI+++K +          +GG   N+++KCS IW+R   +       
Sbjct: 418 LLSRNLLNDESMKSIIKEKQTRPSNVAPSCCNGGYG-NRFAKCSKIWERINNKMNIETNS 476

Query: 433 KPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
            P+F D DID LC EL+TKA+CS  G+IVI++ D+K +L KHF
Sbjct: 477 GPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQSLMKHF 519

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 31/39 (79%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           IS LE+IKD N +E++FLR YM DLI ++ K+RP N+TD
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTD 46

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 7/67 (10%)

Query: 409 SIDGGMACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVK 468
           S DGG+      +CS IW R  T  PK+S+ DID LC EL+TKAKCS+ G +V+ + DV+
Sbjct: 577 SRDGGLL-----RCSEIWDRI-TAHPKYSELDIDGLCSELMTKAKCSERG-VVVNAEDVQ 629

Query: 469 NTLRKHF 475
             L KH 
Sbjct: 630 MALTKHM 636

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 28/36 (77%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNN 98
           +++L +I+  NE+ES FLR  ++ L+ +++KY+PNN
Sbjct: 106 VANLTKIQKQNEIESEFLRSQLITLVNELKKYKPNN 141

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 41/57 (71%), Gaps = 2/57 (3%)

Query: 419 YSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           Y KCS +W R  T+ PK+S+ DID LC EL+ +AKCS++G +V+ SRDV+  L K+ 
Sbjct: 504 YLKCSQVWSRL-TEHPKYSELDIDGLCTELMLQAKCSEKG-VVVESRDVQKALSKYL 558

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 66  LERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           LE++ +  E+E+ FLR  +  +  +++KYRP  S+D
Sbjct: 73  LEQVNEAKELETNFLRSRLKSMADELKKYRPAQSSD 108

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 8/77 (10%)

Query: 399 SIPSILRDKTSIDGGMACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEG 458
           S+ SI+R++   D G     Y +CS +W R  T  PK+SD DID LC EL+ KAKCS++G
Sbjct: 539 SVMSIIREE---DKG---KNYMQCSEVWDRI-TSHPKYSDLDIDGLCTELMHKAKCSEKG 591

Query: 459 TIVIRSRDVKNTLRKHF 475
            +V+++ DV+  L KH 
Sbjct: 592 -VVVKADDVQKALTKHL 607

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           +  LE +   +E+ES FLRD +  L+ ++Q+YRP    D
Sbjct: 79  VKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQND 117

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 2/59 (3%)

Query: 417 NKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
            K  KCS IW R  T  PK+SD DID LC EL+TKAKCS+ G +V+ + DVK+ L +H 
Sbjct: 425 GKLLKCSEIWDRI-TAHPKYSDLDIDGLCGELMTKAKCSERG-VVVNADDVKDALNRHI 481

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           +  L RI+  NEVES FLR  ++ L+ +++KYRP  S D
Sbjct: 79  VDKLTRIQKQNEVESEFLRGQLVTLVHELKKYRPETSND 117

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 7/67 (10%)

Query: 409 SIDGGMACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVK 468
           S DGG+      +CS IW R     PK+SD DID LC EL+TKAKCS+ G +V+ + DV+
Sbjct: 527 SRDGGLL-----RCSEIWDRISAH-PKYSDLDIDGLCSELMTKAKCSERG-VVVNAEDVQ 579

Query: 469 NTLRKHF 475
             L KH 
Sbjct: 580 LALTKHM 586

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 3/40 (7%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYR---PNNS 99
           +++L +I+  NE+ES FLR  ++ L+ +++KYR   PN S
Sbjct: 97  VNNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNPNES 136

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 10/95 (10%)

Query: 389 FISRNLLNNE-----SIPSILRDKTSIDGGMACN---KYSKCSAIWKRFKTQKPKFSDDD 440
           F++ NL+N E     ++    R K   +  +  +   K  KCS +W R  T  PK+S  D
Sbjct: 372 FVNENLINEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTH-PKYSAID 430

Query: 441 IDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           ID LC EL+TKAKCS++G +V+++ DV+  L KH 
Sbjct: 431 IDGLCGELMTKAKCSEKG-VVVQAEDVQRVLDKHM 464

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           +  LE+   +  VES FLR  ++ L+ +++KYRP  + D
Sbjct: 88  VQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKAND 126

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           KCS IW R  T  PK+SD DID LC EL TKAKCS++G +V+ S DV++ L KH 
Sbjct: 516 KCSEIWDRI-TAHPKYSDIDIDGLCMELRTKAKCSEKG-VVVNSDDVQSALAKHM 568

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 28/39 (71%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           +  LE++++ +E+ES FLR  +  LI ++QKYRP  S+D
Sbjct: 64  VERLEKVREQSEMESEFLRSQLQMLIAEIQKYRPQQSSD 102

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 418 KYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           K  KCS +W R  T  P++SD DID LCQEL+  AKCSD+G +V+ S+DV+  L  H 
Sbjct: 535 KLLKCSEVWDRI-TAHPRYSDIDIDGLCQELMHNAKCSDKG-VVVDSKDVQKALSNHM 590

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 29/39 (74%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           + +LE++K  N+VES FLR+ +  +I +++KYRP  S+D
Sbjct: 86  VHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSD 124

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +CS +W R  T  PK+SD DID LC EL+ KAKCS++G +V+ + DV++ L KH 
Sbjct: 428 RCSEVWDRI-TAHPKYSDIDIDGLCGELMAKAKCSEKG-VVVNAEDVQSALSKHL 480

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 66  LERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           L  I+  NE+ES FLR  ++ L+ +++KYRP  + D
Sbjct: 79  LSNIQKQNEIESEFLRSQLITLVKELKKYRPETAND 114

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +CS IW R  T  PK+SD D+D LC EL+ KAKCS+ G +VI + DV+  L KH 
Sbjct: 612 RCSEIWDRITTH-PKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 664

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 91/223 (40%), Gaps = 32/223 (14%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDXXXXXXXXXXXXNQPSMKATS 122
           +  LE I+  NEVE+TFLRD ++ L+ +++KYRP    D            N P+   ++
Sbjct: 96  VQGLENIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASRDPNLPTSNNST 155

Query: 123 IDSLIEMENKKTDEISKESPDSTLXXXXXXXXXXXXXDTNQVPSPNESTGSHISSPDSQS 182
             S        ++EI +                       Q+PSPN+ + S    P +Q+
Sbjct: 156 NSSSNRPIITPSEEIQENVRQKMNFTFQYALDNDSKNLEKQLPSPNDPSHS-APIPTTQA 214

Query: 183 LKHDE------GLRLPSFSNKYDINSHDGGGITSSNWIDN-IFDGDTAEGLXXXXXXXXX 235
            K            L S SN +D+ ++     +S +W+DN I+      G          
Sbjct: 215 QKKSSDATDSSTATLDSLSNSHDVLNNTPNSSSSMDWLDNVIYTNRFVAG---------- 264

Query: 236 XXXXXXVNANDNDHSHVDFTNNLLDHNMIFTNEFSFHNQFDDH 278
                       D S ++  N  +D NM F+N F+F NQFD+ 
Sbjct: 265 -----------GDGSKLEVKN--VDSNM-FSNNFNFENQFDEQ 293

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +CS IW R  T  PK+SD D+D LC EL+ KAKCS+ G +VI + DV+  L KH 
Sbjct: 597 RCSEIWDRITTH-PKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 649

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 92/227 (40%), Gaps = 35/227 (15%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDXXXXXXXXXXXXNQPSMKAT- 121
           +  LE I+  NEVE+TFLRD ++ L+ +++KYRP    D            N    K   
Sbjct: 96  VQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNV 155

Query: 122 --SIDSLIEMENKKTDEISKESPDSTLXXXXXXXXXXXXXDT--NQVPSPNESTGSHISS 177
             S    I+  N    E  K+  + T                   Q+PSPN+ + S    
Sbjct: 156 NHSNSEPIDTPNDDIQENVKQKMNFTFQYPLDNDNDNDNSKNVGKQLPSPNDPSHS-APM 214

Query: 178 PDSQSLKH------DEGLRLPSFSNKYDINSHDGGGITSSNWIDNIFDGDTAEGLXXXXX 231
           P +Q+ K            L S SN  D+ ++     TS +W+DN+              
Sbjct: 215 PINQTQKKLSDATDSSSATLDSLSNSNDVLNNTPNSSTSMDWLDNVI------------- 261

Query: 232 XXXXXXXXXXVNANDNDHSHVDFTNNLLDHNMIFTNEFSFHNQFDDH 278
                     V+ +D  +S    T N LD NM F+N+F+F NQFD+ 
Sbjct: 262 -----YTNRFVSGDDGSNSK---TKN-LDSNM-FSNDFNFENQFDEQ 298

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +CS IW R  T  PK+SD D+D LC EL+ KAKCS+ G +VI + DV+  L KH 
Sbjct: 586 RCSEIWDRITTH-PKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 638

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 94/226 (41%), Gaps = 35/226 (15%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDXXXXXXXXXXXXN--QPSMKA 120
           +  LE I+  NEVE+TFLRD ++ L+ +++KYRP    D            N    S+KA
Sbjct: 96  VQSLESIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKA 155

Query: 121 TSIDSL-IEMENKKTDEISKESPDSTLXXXXXXXXXXXXXDTNQVPSPNESTGSHISSPD 179
              +S  I   N +  E  K+  + T                 Q+PSPN+   S +S P 
Sbjct: 156 NHNNSRPIITPNDEIQENVKQKMNFTFQYPLDNDSDENKNKERQLPSPNDPNHS-VSIPI 214

Query: 180 SQSLKH------DEGLRLPSFSNKYDINSHDGGGITSSNWIDN-IFDGDTAEGLXXXXXX 232
           +Q  K            L S SN  D+ ++     +S +W+DN I+      G       
Sbjct: 215 AQKQKKSSNTTDSSSATLDSLSNSNDVLNNTPNSSSSMDWLDNVIYTNKFVSG------- 267

Query: 233 XXXXXXXXXVNANDNDHSHVDFTNNLLDHNMIFTNEFSFHNQFDDH 278
                         +D    +  N  +D N+ F+N+F+F NQFD+ 
Sbjct: 268 --------------DDGCKRETKN--VDSNL-FSNDFNFENQFDEQ 296

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +CS IW R  T  PK+SD D+D LC EL+ KAKCS+ G +VI + DV+  L KH 
Sbjct: 592 RCSEIWDRITTH-PKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 644

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 86/224 (38%), Gaps = 26/224 (11%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDXXXXXXXXXXXXN--QPSMKA 120
           +  LE I+  NEVE+TFLRD ++ L+ +++KYRP    D            N   P+   
Sbjct: 96  VHSLESIQQENEVEATFLRDQLVTLVSELKKYRPETRNDSKVLEYLARRDPNLHPPNSNT 155

Query: 121 TSIDSLIEMENKKTDEISKESPDSTLXXXXXXXXXXXXXDTNQVPSPNESTGS-HISSPD 179
            +    I   N    +  K+  + T                 Q+PSPN+   S H+    
Sbjct: 156 NNNSEPIVTPNDDIQKNVKQKMNFTFQYPLDNDDNDGKNMEKQLPSPNDPNHSAHVPIAP 215

Query: 180 SQSLKHD----EGLRLPSFSNKYDINSHDGGGITSSNWIDNI-FDGDTAEGLXXXXXXXX 234
           +Q    D        L SFSN  D+ +      +S +W+DN+ +      G         
Sbjct: 216 TQKKLSDATDSSTATLDSFSNNNDVLNITPNSSSSMDWLDNVMYTNKFVAGGDQKNASNE 275

Query: 235 XXXXXXXVNANDNDHSHVDFTNNLLDHNMIFTNEFSFHNQFDDH 278
                  V++N                  +F+N+F+F NQFD+ 
Sbjct: 276 SKSKPKGVDSN------------------MFSNDFNFENQFDEQ 301

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 418 KYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           K  KC  IW R  T  PK+SD DID LC EL TKAKCS++G +V+ + DV+  L KH 
Sbjct: 511 KLLKCGEIWDRI-TSHPKYSDLDIDGLCMELRTKAKCSEKG-VVVNADDVQKALAKHM 566

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (71%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           ++ LE +++ NEVE+ FLR  +M LI +++KYRP  S D
Sbjct: 88  VTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMD 126

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +CS IW R  T  PK+SD DID LC EL+ KAKCS+ G +VI + DV+  L KH 
Sbjct: 535 RCSEIWDRI-TAHPKYSDIDIDGLCSELMAKAKCSERG-VVINADDVQVALNKHM 587

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           + DLE +   NEVE+ FLRD +  L+ +++KYRP    D
Sbjct: 57  VVDLENLTKLNEVETNFLRDQLSILVKELRKYRPETKQD 95

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 2/54 (3%)

Query: 418 KYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTL 471
           K  KCS +W R  T  PK+SD DID LCQEL+ KAKCS+ G +V+++ DV+  L
Sbjct: 523 KLLKCSEVWDRI-TSHPKYSDMDIDGLCQELMAKAKCSERG-VVVQAEDVQYAL 574

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 96/271 (35%), Gaps = 86/271 (31%)

Query: 66  LERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDXXXXXXXXXXXXNQPSMKATSIDS 125
           LE +   + VE+ FLR  ++ L+ ++++YRP N  D                  +  +  
Sbjct: 81  LEELNQQSLVETEFLRSQLVTLVTELKRYRPENPND------------------SQVLQY 122

Query: 126 LIEMENKKTDEISKESPDSTLXXXXXXXXXXXXXDTNQVPSPNESTGSHISSPDSQSL-- 183
           L + EN K+D+ S+   DS                T   P  NE    H +S D  +L  
Sbjct: 123 LAKTENSKSDDSSQNKKDSESKEIEESVRRKMSF-TFAFPWKNEFNNDHRNSEDKGNLSS 181

Query: 184 ---------KHD-------------------------------------EGLRLPSFSNK 197
                    +HD                                     +G+R  S  N 
Sbjct: 182 HGEQQRSKQQHDNNNILMQFPSPGSSSKSSSQSSSSLKPKNGLSTPSNGDGIRKGSTGNN 241

Query: 198 YDINSHDGG---------GITSSNWIDNIFDGDTAEGLXXXXXXXXXXXXXXXVNANDND 248
             IN  +G          G TS+ W+DN+F  D A  L                N N+N 
Sbjct: 242 SSINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDARQLPQFYQSN---------NNNENS 292

Query: 249 HSHVDFTNNLLDHNMI-FTNEFSFHNQFDDH 278
               D T    D++ + F+N+F+F+++FD+ 
Sbjct: 293 RLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQ 323

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +CS IW R  T  P+++D DID LC+EL+  AKCSD+G +V+ S+DV   L KH 
Sbjct: 422 RCSEIWDRITTN-PRYTDLDIDGLCEELMFSAKCSDKG-VVVASKDVHKVLAKHM 474

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDXXXXXXXXXXXXNQPSMKATS 122
           ++ LE I   NEVE+ FLR  ++ L+ +++KYR   ++D            N   ++  S
Sbjct: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRDLRHDS 132

Query: 123 IDSL 126
           I SL
Sbjct: 133 ITSL 136

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           KCS +W R  T  PK+SD DID LC EL TKAKCS++G +V+   DV+  L KH 
Sbjct: 531 KCSEVWDRI-TSHPKYSDIDIDGLCLELRTKAKCSEKG-VVVNIDDVQRALTKHM 583

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 28/39 (71%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTD 101
           +  LER+++ +E+ES FLR  +  L+ ++QKYRP  S+D
Sbjct: 64  VERLERVREQSELESEFLRSQLQKLLAEIQKYRPRQSSD 102

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 418 KYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           K  KCS +W R  T  P++SD DID LC EL TKAKCS++G +V+ + DV+  L  H 
Sbjct: 527 KLLKCSEVWDRI-TAHPRYSDLDIDGLCLELRTKAKCSEKG-VVVNAEDVQKALISHM 582

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 24/34 (70%)

Query: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRP 96
           +S LE +   +E+E+ FLR+ + +L+ ++++Y P
Sbjct: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNP 116

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 11/93 (11%)

Query: 392 RNLLNNESIPSILRDKTSIDGG---------MACNKYSKCSAIWKRFKTQKPKFSDDDID 442
           RN+      P+I     S DGG         +   +  +C  IW R  T  P++SD DID
Sbjct: 415 RNIQTANEYPNIYETDDSSDGGDEVVGQIVPLTDGRLLECGEIWDRITTY-PRYSDIDID 473

Query: 443 SLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
            LC+EL+  AKCSD+G +++ S DV+  L +  
Sbjct: 474 GLCEELMASAKCSDKG-VLVSSDDVQKVLSRRL 505

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 63 ISDLERIKDNNEVESTFLRDYMMDLICDMQKYR 95
          +  LE I + NE+E+ FLR  ++ L+ +++KYR
Sbjct: 48 VRKLENINEKNEIETVFLRTQLLSLVNELKKYR 80

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 422 CSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTL 471
           C+ IW R  T  PK++  DI++LC EL++KAKCSD+G +V+ S DV   L
Sbjct: 539 CTKIWDRI-TALPKYTSADIENLCNELMSKAKCSDKG-VVVSSLDVDKVL 586

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 16/101 (15%)

Query: 389 FISRNLLNNESIPSILRDKTS--------------IDGGMACNKYSKCSAIWKRFKTQKP 434
            I+ +LLN +S+ S+L    S              I   ++  K S C  I +   +  P
Sbjct: 310 LITSHLLNQKSLASVLPVAASHTKTIRTQSEAIEHISSAISNGKAS-CYHILEEISSL-P 367

Query: 435 KFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           K+S  DID LC ELI KAKC+D+  IV+++RD+++ L +  
Sbjct: 368 KYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 14/100 (14%)

Query: 389 FISRNLLNNESIPSIL------RDKTSIDG-------GMACNKYSKCSAIWKRFKTQKPK 435
            I++ LLN ES+ SI+      R+   I             N+ + C  I K   +  PK
Sbjct: 294 LITKRLLNQESLDSIVPASAPYRENIGIRSEAIRRISSAISNQNTSCCHILKEISSL-PK 352

Query: 436 FSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475
           +S  DID+LC EL+TKA+ +D+  IV+R+ D++ TL K  
Sbjct: 353 YSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 9/88 (10%)

Query: 389 FISRNLLNNESIPSILRDKTSIDGGMACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQEL 448
            ++R ++NNES+ SI+ +K        C     C+ + +   TQ P + ++D++ LCQEL
Sbjct: 303 LLTRRVMNNESLRSIIAEKR-------CGSNDTCAHVIRTL-TQSPHYQENDLEDLCQEL 354

Query: 449 ITKAKC-SDEGTIVIRSRDVKNTLRKHF 475
           + K K  + + +I +   DV++ L +H 
Sbjct: 355 MVKCKFDTHDASITVGREDVRSALERHI 382

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 57/122 (46%), Gaps = 21/122 (17%)

Query: 366 TITCPCQHADTGAXXXXXXXXXXFISRNLLNNESIPSILRDKTSIDGG------------ 413
            I CP +  D              I+R+L+N E + SIL   ++  GG            
Sbjct: 269 AIPCPIKRLD-------KKIKYGLITRHLINQEPLDSIL-PASAPRGGVLKLHPEPFTSK 320

Query: 414 MACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRK 473
           M  N+   CS I +   +  PK S  DID+LC EL+ KAKCS +  I++++  +++ L +
Sbjct: 321 MPYNETFFCSHILRHI-SSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLAR 379

Query: 474 HF 475
             
Sbjct: 380 QL 381

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 9/45 (20%)

Query: 440 DIDSLCQELITKAKCSDEGT---------IVIRSRDVKNTLRKHF 475
           D ++LC EL+ KAK SD+G          +VI++ D++ TL KH 
Sbjct: 440 DFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHI 484

>Kwal_56.23511 s56 (579642..582986) [3345 bp, 1114 aa] {ON} YER176W
           (ECM32) - 1:1 [contig 176] FULL
          Length = 1114

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 165 PSPNESTGSHISSPDSQSLKHDEGLRLPSFSNKYDINSHD 204
           P P     S +S P S S++H EG + P  +++ +IN  D
Sbjct: 298 PVPKSDKESPVSRPKSSSMRHPEGKKKPKQASQKEINQKD 337

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,552,083
Number of extensions: 1524389
Number of successful extensions: 3370
Number of sequences better than 10.0: 34
Number of HSP's gapped: 3411
Number of HSP's successfully gapped: 57
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)