Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F010805.526ON37937920090.0
NDAI0H015905.526ON3713794002e-44
SAKL0G04906g5.526ON6084013791e-39
Kwal_47.186465.526ON6354183385e-34
KLTH0G03740g5.526ON6314113281e-32
ZYRO0D12540g5.526ON5483942704e-25
Ecym_40615.526ON6634292299e-20
NDAI0C010705.526ON757802229e-19
NCAS0H025505.526ON743792182e-18
Suva_13.1565.526ON772792093e-17
CAGL0K07271g5.526ON776782085e-17
YML006C (GIS4)5.526ON7741122069e-17
Skud_13.1485.526ON7791122042e-16
KNAG0B037105.526ON7111282032e-16
TDEL0A039005.526ON671892022e-16
Smik_13.1455.526ON7741212014e-16
KAFR0C053905.526ON4551151978e-16
TBLA0D016605.526ON866881891e-14
KLLA0A01782g5.526ON5281181764e-13
Kpol_1023.995.526ON551921721e-12
TPHA0K005405.526ON675671552e-10
ADR198C5.526ON549861392e-08
KNAG0C032405.526ON32466960.002
SAKL0G07458g5.402ON372540731.9
Kwal_27.107097.418ON277972695.3
Kpol_1045.736.16ON96257696.0
NDAI0D009206.42ON65680686.3
Smik_10.761.190ON84554686.9
Ecym_62438.735ON109049687.7
YFR002W (NIC96)8.94ON83971678.1
NOTE: 1 genes in the same pillar as NCAS0F01080 were not hit in these BLAST results
LIST: TBLA0G00940

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F01080
         (379 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...   778   0.0  
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}              158   2e-44
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   150   1e-39
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   134   5e-34
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   130   1e-32
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   108   4e-25
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    93   9e-20
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...    90   9e-19
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...    89   2e-18
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...    85   3e-17
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...    85   5e-17
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...    84   9e-17
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...    83   2e-16
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...    83   2e-16
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...    82   2e-16
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...    82   4e-16
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...    80   8e-16
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...    77   1e-14
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...    72   4e-13
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...    71   1e-12
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    64   2e-10
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    58   2e-08
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      42   0.002
SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa]...    33   1.9  
Kwal_27.10709 s27 complement(458902..467241) [8340 bp, 2779 aa] ...    31   5.3  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...    31   6.0  
NDAI0D00920 Chr4 (211004..212974) [1971 bp, 656 aa] {ON} Anc_1.3...    31   6.3  
Smik_10.76 Chr10 complement(121615..124152) [2538 bp, 845 aa] {O...    31   6.9  
Ecym_6243 Chr6 complement(454101..457373) [3273 bp, 1090 aa] {ON...    31   7.7  
YFR002W Chr6 (150016..152535) [2520 bp, 839 aa] {ON}  NIC96Linke...    30   8.1  

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/379 (100%), Positives = 379/379 (100%)

Query: 1   MIDSHSKNYPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSKKI 60
           MIDSHSKNYPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSKKI
Sbjct: 1   MIDSHSKNYPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSKKI 60

Query: 61  LLSVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEA 120
           LLSVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEA
Sbjct: 61  LLSVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEA 120

Query: 121 AFIESMEFNQTEENEQSVYIEGMEINKSISSICLWPQEETNMDLFYASNSMDHTMENEEE 180
           AFIESMEFNQTEENEQSVYIEGMEINKSISSICLWPQEETNMDLFYASNSMDHTMENEEE
Sbjct: 121 AFIESMEFNQTEENEQSVYIEGMEINKSISSICLWPQEETNMDLFYASNSMDHTMENEEE 180

Query: 181 GAIILAFPSLLNNHSKLHNYVSHRTPATSEDISIDSEKYDDVDSYIHAMSLMRVNANCAN 240
           GAIILAFPSLLNNHSKLHNYVSHRTPATSEDISIDSEKYDDVDSYIHAMSLMRVNANCAN
Sbjct: 181 GAIILAFPSLLNNHSKLHNYVSHRTPATSEDISIDSEKYDDVDSYIHAMSLMRVNANCAN 240

Query: 241 QIQSPSEMMDESIDSLTESIISSDEIKEDDSKLTREENLRSASCNFHSNIPTQTFSYKSG 300
           QIQSPSEMMDESIDSLTESIISSDEIKEDDSKLTREENLRSASCNFHSNIPTQTFSYKSG
Sbjct: 241 QIQSPSEMMDESIDSLTESIISSDEIKEDDSKLTREENLRSASCNFHSNIPTQTFSYKSG 300

Query: 301 QLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDIL 360
           QLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDIL
Sbjct: 301 QLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDIL 360

Query: 361 LSNKGNSMLLLYKTILISK 379
           LSNKGNSMLLLYKTILISK
Sbjct: 361 LSNKGNSMLLLYKTILISK 379

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 187/379 (49%), Gaps = 20/379 (5%)

Query: 8   NYPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNE--GSKKILLSVP 65
           N   D +++ SWYL NL+ G FE ++    +  HL      Q     +   + KIL+S  
Sbjct: 5   NIKKDDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFDNKQYGATNKILVSTL 64

Query: 66  SMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIES 125
           + + + VSIK +FLG +F+ ERLQYI V E        ++ HY LTD L+ FN+    E 
Sbjct: 65  TSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSFNDLLLEEE 124

Query: 126 MEFNQTEENEQSVYIEGMEINKSISSICLWPQEETNMDLFYASNSMDHTMENEEEGAIIL 185
                +  + Q  +   M   K+        +++T +           TM+ +   ++I 
Sbjct: 125 RLQTYSTNHSQHYFHRAM---KNEKKKKKRKKKKTLVRHLVLMRRNKRTMKKQMPYSLI- 180

Query: 186 AFPSLLNNHSKLHNYVSHRTPATSEDISIDSEKYDDVDSYIHAMSLMRVNANCANQIQSP 245
            F S L   +++       TP  S+ ISI+S    + +S+ HA SL RV   C   I+  
Sbjct: 181 -FESRLRQSNRISKLGHQYTPYHSDSISINSFGSQNDESFSHATSLTRVK--CNEHIEEG 237

Query: 246 SEMMDESIDSLTESIISS------DEIKEDDSKLTREENLRSASCNFHSNIPTQTFSYKS 299
           S    +S++SL+    SS      ++ +E D  L   E   S        +P+ +  +  
Sbjct: 238 SSEFSKSLNSLSTDFPSSIEKSEFEKKEEGDKILMDYEEALSVPV-----VPSISCHHPY 292

Query: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359
           GQ+RFVL S++ ++ ++ E  TAIRQ S+D   A   DEWLLYDS FSL+NLE+ TLQDI
Sbjct: 293 GQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNNLEISTLQDI 352

Query: 360 LLSNKGNSMLLLYKTILIS 378
           L  N  N  +L Y   ++S
Sbjct: 353 LYPNYENPRILFYTMSVVS 371

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  150 bits (379), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 115/401 (28%), Positives = 195/401 (48%), Gaps = 56/401 (13%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG--NEGSKKILLSVPS 66
           + +D + +WSWYLSNL+ G+FE L N  ++   L+ +              K +L+S+P 
Sbjct: 11  FENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVSIPD 70

Query: 67  MLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI--- 123
            + Q+++I   FL S F+ + LQYI + + + S     + HYL++D L+ F++ +F+   
Sbjct: 71  NIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLNNFHDRSFLGFG 130

Query: 124 --------ESMEFN--------------QTEENEQSVYIEGMEINKSISSICLWPQEETN 161
                     + +N              +T E +   +     + +   +    P++ T 
Sbjct: 131 QKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNGNSPATPRDVTA 190

Query: 162 MDLFYASNSMDHTMENEEEGAIILAFPSLLNNHSKLHNYVSHR---TPATSEDISIDSEK 218
           ++   +S       E++E G I+L FP     H    N ++ R      TSED+SI+SE 
Sbjct: 191 VEPVKSSEDE----EDQESGEIVLNFP-----HKPPKNIINQREQEVVTTSEDVSINSED 241

Query: 219 YDDVDSYIHAMSLMR-VNANCANQIQSP-SEMMDESIDSLTESIISSDEIKEDDSKLTRE 276
               D      ++ R  +A+ A++  S  SE+   S+D    S+  + +I  DD  +   
Sbjct: 242 ASSYDGEALIQTITRDEDASSADEDNSNISEL--SSVDHSLNSLSYNSDISSDDYSMA-- 297

Query: 277 ENLRSASCNFHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANIL 336
                      S  P  + S   G  R VL S+LIQN  ++E FTA+RQ ++DPN A+I 
Sbjct: 298 -----------SIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHIN 346

Query: 337 DEWLLYDSKFSLDNLEMGTLQDILLSNKGNSMLLLYKTILI 377
           D+WLLYD KFS+ NL+M +L D+L  N+    +L Y  +++
Sbjct: 347 DDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVML 387

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  134 bits (338), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 121/418 (28%), Positives = 197/418 (47%), Gaps = 68/418 (16%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNE--GSKKILLSVPS 66
           + +D + +WSWYL NL+ GNFE L N  ++   L  +   Q  S       K +L+S+P 
Sbjct: 12  FGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNKKLLLVSIPD 71

Query: 67  MLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIE-- 124
            + +  ++   FL   F+ + LQYI + + ++      + HYL+ D LS FN+ +F+E  
Sbjct: 72  AIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSNFNDKSFLEFG 131

Query: 125 --------SMEFNQTEENEQSVYIEG---MEINKSISSICLWP---------QEETNMDL 164
                     E +    N Q   I G    ++ KS   I L P         QE+  +  
Sbjct: 132 IKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIRDSKVTQEDPALQT 191

Query: 165 FYAS------------NSMDHTMENEEEGAIILAF-PSLLNNHSKLHNYVSHRTPATSED 211
              S            NS D + + E E  I+L F P       +L++ V  R+P  ++ 
Sbjct: 192 QSTSSRSLRIENSGSLNSSDESDDTESE--IVLRFKPRGTVGKRQLYSEV-KRSPLANDY 248

Query: 212 ISIDSE----KYDDVDSY-----IHAMSLMRVNANCANQIQSPSEM--MDESIDSLTESI 260
           I   S     + +DV SY      H  S    +A+ +    + SE+  +D S++SL+   
Sbjct: 249 IDTPSTGMSLRSEDVSSYDGEELAHIASRDEDSASLSADEDNISELSSVDHSLNSLSY-- 306

Query: 261 ISSDEIKEDDSKLTREENLRSASCNFHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETF 320
                    DS+ T        S +  S  P+ + S K G+ R VL S+LIQ   +++ +
Sbjct: 307 ---------DSECT------PGSSSMTSIFPSISISEKFGRFRLVLQSILIQQTDTRQLY 351

Query: 321 TAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKGNSMLLLYKTILIS 378
           TA+RQ ++DP  A++ D+WLLYD KFS++NL++  L D+L  NK    +L Y  I+++
Sbjct: 352 TAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVVT 409

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  130 bits (328), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 112/411 (27%), Positives = 196/411 (47%), Gaps = 52/411 (12%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNE--GSKKILLSVPS 66
           + +D + +WSWYL NL+ GNFE L N  ++   L  +   Q  S +     K +L+S+P 
Sbjct: 12  FDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVSIPD 71

Query: 67  MLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIESM 126
            + +  ++   FL   FN + LQ+I + + ++      + HYL++D+LS FN+ +F+E  
Sbjct: 72  AIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSNFNDKSFLEFG 131

Query: 127 EFNQTEENEQSVYIEGMEINKSISSICLWPQEETNMDLFYASNSMDHTMENEEEGAIILA 186
             ++   ++  +   G + N   S I      ET  D      ++   + +E   ++ L+
Sbjct: 132 AKSRRPRDDTEIL--GQDSNNQYSIIS----GETEAD-----PALPAAISSESPASVHLS 180

Query: 187 ------FPSLLNNHSKLHNYVSHRTPATSEDISIDSEKYDDVDSYIHAMSL--------M 232
                  P   +N S     V ++  A+S D S D+   + V  + H   L        +
Sbjct: 181 KVVQEDVPLRTHNSSSRLLIVDNQECASSTDESDDAST-ELVLKFEHRGMLGKQRLHPEV 239

Query: 233 RVNANCANQIQSPSEMMDESIDS--------LTESIISSDE----IKEDDS--------- 271
           R  A+    I +PS  +    D         LT++I   ++    + EDDS         
Sbjct: 240 RKMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDH 299

Query: 272 ---KLTREENLRSASCNFHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSS 328
               L+ +      S +  S  P+ + S K G+ R VL S+L+    +++ FTA+RQ ++
Sbjct: 300 SLKSLSYDSEYSQGSSSLTSIFPSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNN 359

Query: 329 DPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKGNSMLLLYKTILISK 379
           DP  A++ D+WLLYD KFS++NL++  L D+L  NK    +L Y  ++IS+
Sbjct: 360 DPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYSLVMISE 410

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  108 bits (270), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 97/394 (24%), Positives = 185/394 (46%), Gaps = 43/394 (10%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG---NEGSKKILLSVP 65
           + +D + +WSWYL+N+++G+FE L    ++    + + ++         + +K +++S+P
Sbjct: 11  FSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKDTKVLIVSIP 70

Query: 66  SMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIES 125
             + +++++   FLG   N   L  + + + + S     + HY++ D  + F  + F+  
Sbjct: 71  EDVRRDITLLEYFLGDYLN---LDNMEITKLTTSRIYNHENHYVVMDKENNFKNSNFLHF 127

Query: 126 MEFN-QTEENEQSVYIEGMEI----NKSISSICLWPQEETNMDLFYASNSMDHTMENEEE 180
              N QT +      + G  +     K+IS     P E             D T  +EE 
Sbjct: 128 ASTNIQTGKGFTGGELAGTTVAAQAEKNIS-----PTESAKFRAGQGLEPSDDTEGDEE- 181

Query: 181 GAIILAFPSLLNNHSKLHNYVSHRTPATS----EDISIDS----------EKYDDVDSYI 226
                   SL+ N +   ++++H   A      E + +            ++++  +  +
Sbjct: 182 --------SLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWNPQQQQRLQEHNASNDEM 233

Query: 227 HAMSLMRVNANCANQIQS-PSEMMDESIDSLTESIISSDEIKEDDSKLTREENLRSA--S 283
            ++    + +N +  ++S   E +  ++ + TE   SSDE     S  +  +   S+  S
Sbjct: 234 ASIDSYNLGSNSSRVVESFKGEPLTLTM-TRTEDFSSSDEYDSLASSPSSSDTDLSSFES 292

Query: 284 CNFHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYD 343
           C+  S +P+ + +   G  R VL S+L  N  S E FTAIRQ ++ P  A++ D+WLLYD
Sbjct: 293 CSLMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYD 352

Query: 344 SKFSLDNLEMGTLQDILLSNKGNSMLLLYKTILI 377
           S+FS+ NL+M TLQD+   NKG   +L Y  + +
Sbjct: 353 SQFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEV 386

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 92.8 bits (229), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 111/429 (25%), Positives = 187/429 (43%), Gaps = 84/429 (19%)

Query: 11  DDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG--NEGSKKILLSVPSML 68
           DD + +WSWYL NL+ G FE L +  V+ + ++   K +++ G  +  ++ +L+SVP  +
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVK-EYSGGTMSASNRVLLVSVPDDI 68

Query: 69  CQEVSIKRLFLGSIFNEER-LQYINVMEFS-KSPKQTEKKHYLLTDALSGFNEAAF---- 122
            Q  SI   FL S     R ++  N+ + + +      + HYL+ D   G          
Sbjct: 69  RQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVAGVGLTANR 128

Query: 123 -IESM------------EFNQTEEN---EQSVYIE-----GME----INKSISSICLWPQ 157
            +ES             EF+    N   E+++ +      G+E    I+  +  I   P 
Sbjct: 129 PVESFGSHFQRQDQCDNEFSFGHSNASLEETLNVSLCANTGLENVAGISTQLKGIGFDP- 187

Query: 158 EETNMDLFYASNSMD-----HTMENEEEGAIILAFPSLLN----------------NHSK 196
              + D+ Y   ++D     HT++    G   +A     N                ++SK
Sbjct: 188 --VSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRNGERFTTSFKANSLTAVDNSK 245

Query: 197 LHNY----VSHRTPATSEDISI-DSEKYDDVDSYIHAMSLMR---VNANCANQIQSPSEM 248
           L  +     +  T   SE++SI  SE Y   D  + A +L R   +  +C      P+E 
Sbjct: 246 LFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCC-----PTEH 300

Query: 249 MDESIDSLTESIISSDEIKEDDSKLTREENLRSASCNFHSNIPTQTFSYKSGQLRFVLHS 308
             E + +  +S           S+L+   N  S+ C+     P+ + S   G  R VL S
Sbjct: 301 RHEELYNEGDST----------SELSSACNSVSSDCSI---FPSISISGDEGDFRIVLQS 347

Query: 309 LLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKGNSM 368
           +LI N    +  TA+RQ ++D   A+I D+WLLYD +FS++N++M +L DI   N     
Sbjct: 348 ILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPK 407

Query: 369 LLLYKTILI 377
           +L Y  + I
Sbjct: 408 ILFYSVVAI 416

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score = 90.1 bits (222), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (73%)

Query: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359
           G  R VL S LIQN  +KE FTAIRQ +++P  A+I D+WLLYDSKF++DNL++ TLQD+
Sbjct: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532

Query: 360 LLSNKGNSMLLLYKTILISK 379
           L SN+    +L Y  +++++
Sbjct: 533 LDSNRTFPKILFYSMVIVNE 552

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 21/137 (15%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG------------NEG 56
           Y +D + +WSWYL N++ G+FE L    ++   L+ +  S F S             N  
Sbjct: 11  YNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTDTAIDDNNNTN 70

Query: 57  S--------KKILL-SVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKH 107
           S        KKILL S+P  +  ++S+  LFL   F+ E L+ I + + ++S     + H
Sbjct: 71  SVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLTQSECYNHENH 130

Query: 108 YLLTDALSGFNEAAFIE 124
           YLLTD ++ F++  F+E
Sbjct: 131 YLLTDKVNNFDDPMFLE 147

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 60/79 (75%)

Query: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359
           G  R VL S+LIQ+  +KE +TAIRQ +++P  A+I+D+WLLYDS+FS+DNL++ TLQD+
Sbjct: 434 GHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDL 493

Query: 360 LLSNKGNSMLLLYKTILIS 378
           L +N+    +L Y  ++++
Sbjct: 494 LDTNRSFPKILFYSMVIVT 512

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 71/143 (49%), Gaps = 27/143 (18%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGS----------- 57
           + +D + +WSWYL+N++ G+FE +    ++   L+ +  S F S ++ +           
Sbjct: 11  FDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTATESPQQHNNN 70

Query: 58  ---------------KKILL-SVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPK 101
                          +KILL S+P  + +++SI   FL   F+ E L+ I +   ++S  
Sbjct: 71  NNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGIQIQRLTQSKC 130

Query: 102 QTEKKHYLLTDALSGFNEAAFIE 124
              + HYLLTD ++ F++  F+E
Sbjct: 131 YNHENHYLLTDTINNFDDPVFLE 153

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%)

Query: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359
           G  R VL S+LIQN  +KE FTAIRQ +++P  A++ D+WLLYDS FS++NL++ TLQD+
Sbjct: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDL 505

Query: 360 LLSNKGNSMLLLYKTILIS 378
           L   +    +LLY  ++++
Sbjct: 506 LDIKRSFPKILLYTMVIVT 524

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 73/121 (60%), Gaps = 5/121 (4%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGS----KKILL-S 63
           + +D + +WSWYL+NL+ G+FE L+   ++   L+ +  S F   N  S    KKILL S
Sbjct: 11  FDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVS 70

Query: 64  VPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123
           +P  + +++SI  +FL   F+ E+L++I + + + S     + HYLLTD L+ F + +F+
Sbjct: 71  IPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDYLNNFQDPSFL 130

Query: 124 E 124
           E
Sbjct: 131 E 131

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 55/78 (70%)

Query: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359
           G  R VL S+LIQ+ Q+KE FTA+RQ ++ P  A+I D+WLLYD++FS+ NL++ TLQDI
Sbjct: 465 GYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQDI 524

Query: 360 LLSNKGNSMLLLYKTILI 377
           +   K    +L Y  ++I
Sbjct: 525 MTIKKDYPKILFYTMVVI 542

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGN---------EGSKK 59
           Y +D + +WSWYLSNL+SG+FE ++   ++   L+ +  S    GN            K 
Sbjct: 11  YGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLL-GNFSPESPTRFINKKL 69

Query: 60  ILLSVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNE 119
           I +S+P  + Q++SI  LFL   F+ + L    + + ++      + HY L D L+ F +
Sbjct: 70  IFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFLMDELNNFED 129

Query: 120 AAFIE 124
             F+E
Sbjct: 130 PTFLE 134

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score = 84.0 bits (206), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 72/112 (64%)

Query: 267 KEDDSKLTREENLRSASCNFHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQR 326
           ++D  ++  +E+L S+  +  S +P+ +     G  R VL S+LIQ+  +KE FTAIRQ 
Sbjct: 414 EDDGEEVYDDEDLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 473

Query: 327 SSDPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKGNSMLLLYKTILIS 378
           ++ P  A++ D+WLLYDS FS++NL++ TLQD+L   +    +L Y  ++++
Sbjct: 474 NNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVT 525

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 72/121 (59%), Gaps = 5/121 (4%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGN----EGSKKILL-S 63
           + +D + +WSWYL+NL+ G+FE L+   ++   L+ +  S F   N      +KKILL S
Sbjct: 11  FDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISARPNKKILLVS 70

Query: 64  VPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123
           +P  + +++SI  +FL   F+ E+L++I + + + S     + HYLLTD L+ F +  F+
Sbjct: 71  IPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPTFL 130

Query: 124 E 124
           E
Sbjct: 131 E 131

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 70/112 (62%)

Query: 267 KEDDSKLTREENLRSASCNFHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQR 326
           +ED      +E++ S+  +  S +P+ +     G  R VL S+LIQ+  +KE FTAIRQ 
Sbjct: 421 EEDGEGADEDEDISSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 480

Query: 327 SSDPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKGNSMLLLYKTILIS 378
           ++ P  A++ D+WLLYDS FS++NL++ TLQD+L   +    +L Y  ++++
Sbjct: 481 NNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVT 532

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 71/121 (58%), Gaps = 5/121 (4%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQF-----TSGNEGSKKILLS 63
           + +D + +WSWYL+NL+ G+FE L+   ++   L+ +  S F     TS     K +L+S
Sbjct: 11  FDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVS 70

Query: 64  VPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123
           +P  + +++SI  +FL   F+ E+L++I + + + S     + HYLLTD L+ F +  F+
Sbjct: 71  IPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPTFL 130

Query: 124 E 124
           E
Sbjct: 131 E 131

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (57%), Gaps = 3/128 (2%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEG--SKKILLSVPS 66
           Y +D + +WSWYL N++SG+FE L +  ++   L+ + K+ FTS  EG  SK + +S+P 
Sbjct: 11  YDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTSL-EGINSKILFISIPD 69

Query: 67  MLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIESM 126
            +  ++S+   FL   F+ E LQ I + + + S     + HYLLTD L+ FN+  F+  +
Sbjct: 70  KVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTDTLNNFNDRKFLRYL 129

Query: 127 EFNQTEEN 134
              +  EN
Sbjct: 130 NPGRKFEN 137

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (61%), Gaps = 1/91 (1%)

Query: 287 HSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKF 346
           +S +P+ T     G  R VL S+L+Q  + K  FTAIRQ ++  + A + D+W+LYDS F
Sbjct: 459 YSILPSITIKDTEGHFRLVLQSVLLQR-EDKAIFTAIRQSNNKVDRATVQDDWILYDSDF 517

Query: 347 SLDNLEMGTLQDILLSNKGNSMLLLYKTILI 377
           S++NL M TL+ +   ++  S +L Y  I++
Sbjct: 518 SMNNLMMMTLRGLFNFSENMSKILFYSMIIV 548

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 62/89 (69%)

Query: 290 IPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLD 349
           +P+ + S   G  R V+ S L+Q+ ++KE +TAIRQ ++ P  A++ D+WLLYDS+FS++
Sbjct: 387 LPSISISDARGHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMN 446

Query: 350 NLEMGTLQDILLSNKGNSMLLLYKTILIS 378
           NL+M TLQ++L  N+    ++ Y  I++S
Sbjct: 447 NLQMLTLQELLDMNRSFPKIIFYSMIVVS 475

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 69/120 (57%), Gaps = 4/120 (3%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG----NEGSKKILLSV 64
           + +D + +WSWYLS+++SG+FE      ++   L  +  S F S      + +K + +S+
Sbjct: 11  FDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYGQNTKILFVSI 70

Query: 65  PSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIE 124
           P  + +++S+   FL   F+ E L++I + + ++SP    + HY+L D L+ F++  F++
Sbjct: 71  PDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILIDKLNNFDDPTFLQ 130

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 72/121 (59%), Gaps = 5/121 (4%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGN----EGSKKILL-S 63
           + +D + +WSWYL+NL+ G+FE L+   ++   L+ +  S F   N      +KKILL S
Sbjct: 11  FDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVS 70

Query: 64  VPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123
           +P  + +++SI  +FL   F+ E+L++I + + + S     + HYLLTD L+ F +  F+
Sbjct: 71  IPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPTFL 130

Query: 124 E 124
           E
Sbjct: 131 E 131

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359
           G  R VL S+LIQ+  +KE FTAIRQ ++ P  A++ D+WLLYDS FS++NL++ TLQD+
Sbjct: 450 GYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTLQDL 509

Query: 360 LLSNKGNSMLLLYKTILISK 379
           L   +    +L Y  +++++
Sbjct: 510 LDIKRSFPKILFYTMVIVTE 529

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 69/115 (60%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSKKILLSVPSML 68
           + +D + +WSWYL+NL+SGNFE L+N  ++   L+ + ++Q    ++  K +L+S+P  +
Sbjct: 11  FDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQVDINDQIKKILLISIPDHI 70

Query: 69  CQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123
             ++++  +FL   F+   L  I +++ +K      + HYLL D+++ F +  F+
Sbjct: 71  FSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDSVNNFKDETFL 125

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 51/77 (66%)

Query: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359
           G  R VL S+LI N ++ +  T +RQ ++  N ANI D+W+LYD KFS+ NL + +L+D+
Sbjct: 264 GHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMRNLNILSLKDL 323

Query: 360 LLSNKGNSMLLLYKTIL 376
            +    +S+ +L+ +++
Sbjct: 324 SIIGNVDSIKILFYSMI 340

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (65%)

Query: 290 IPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLD 349
           +P+ + S   G  R VL  +LI +  +++T+TAIRQ  S+ + A+I D+WLLYD KFS+D
Sbjct: 500 LPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMD 559

Query: 350 NLEMGTLQDILLSNKGNSMLLLYKTILI 377
           NLE+ TLQ++L  N+    +L Y  + I
Sbjct: 560 NLEILTLQELLDFNRDYPKILFYTLVAI 587

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTS--------GNEGSKKI 60
           Y +D + +WSWYLSN+++G FE L    ++   L+ + K  F              +K +
Sbjct: 15  YDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKIL 74

Query: 61  LLSVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEA 120
             S+P  + Q++ I    L   F+ + L  I +++ +++     + HY+L D L  F   
Sbjct: 75  FTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKDILDNFGNT 134

Query: 121 AF 122
           +F
Sbjct: 135 SF 136

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 67/118 (56%), Gaps = 2/118 (1%)

Query: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSKKILL-SVPSM 67
           Y +D + +WSWYLSNL++G FE L    ++   L+ + + QF +    +KK+LL S+P  
Sbjct: 11  YENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQATGPLNKKLLLVSIPDE 70

Query: 68  LCQEVSIKRLFLGSIFN-EERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFIE 124
           + Q++ +   FL   F+ ++    I + + ++      + HYL+ D L+ FN+  F+E
Sbjct: 71  IHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTVYKHENHYLIQDKLTNFNDEWFLE 128

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 58/92 (63%)

Query: 286 FHSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSK 345
           F++ +PT          + VL S+LI N+ S E  TAIRQ +++ ++A+I D+WLLYDSK
Sbjct: 244 FNTVLPTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSK 303

Query: 346 FSLDNLEMGTLQDILLSNKGNSMLLLYKTILI 377
           FS+ NL++ +L ++L  NK    +L Y  + I
Sbjct: 304 FSMTNLQILSLNELLHINKDYPKILFYSLVSI 335

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%)

Query: 290 IPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLD 349
           +P+       G+ + VL S+++ N +S E+FTA+RQ +S  + A   DEWLLYDSKFS+D
Sbjct: 327 LPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMD 386

Query: 350 NLEMGTL 356
           NLE+ TL
Sbjct: 387 NLEIVTL 393

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 50/86 (58%)

Query: 287 HSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKF 346
           HS  P+ + +    + R VL S+L+ + +     TA+RQ +++PN AN  D+ LLYD+K 
Sbjct: 234 HSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKI 293

Query: 347 SLDNLEMGTLQDILLSNKGNSMLLLY 372
           SL    + +L D++  N+ +  +L Y
Sbjct: 294 SLITFRILSLVDLMELNRAHPKMLFY 319

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 61/146 (41%), Gaps = 24/146 (16%)

Query: 12  DIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSKKI-LLSVPSMLCQ 70
           D   +WSWYL NL+ G FE LV    R   L+A+ +  F       +++ LLS P+ +  
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPASVPC 63

Query: 71  EVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYL-----LTDALSGF------NE 119
           +  I   F+       R Q    +   +      +KHYL     +  AL G       NE
Sbjct: 64  DYKILEEFI-------RQQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLALTENE 116

Query: 120 AAFIESMEFNQTEENEQSVYIEGMEI 145
             + +SM        E+S  + GM +
Sbjct: 117 PFYTDSMSI-----EERSEIVSGMSL 137

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON} 
          Length = 324

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 10/66 (15%)

Query: 308 SLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKG-- 365
           SLL ++  S + + A+RQ   D        +W++YD+ FSL+NLE   L+DILL++ G  
Sbjct: 263 SLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDILLNSDGAC 314

Query: 366 NSMLLL 371
            +M++L
Sbjct: 315 QTMVIL 320

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 6  SKNYPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSK--KILLS 63
           KN   + ++ W WY+ NL +GNFE L +  +++  L   F + +  G + +K  + LL 
Sbjct: 10 GKNQCRESNNFWFWYIDNLVAGNFEELNDNLIKRNQL-CSFLAHYFGGKQTTKLQRRLLL 68

Query: 64 VPS 66
          V S
Sbjct: 69 VTS 71

>SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa] {ON}
            highly similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3725

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 109  LLTDALSGFNEAAF-IESMEFNQTEENEQSVYIEGMEINK 147
            +L+  L   NE AF I+S++ +QT E  QS Y+  ME+NK
Sbjct: 1686 MLSFVLRTINENAFYIDSLQLHQTIEKFQSFYLRYMELNK 1725

>Kwal_27.10709 s27 complement(458902..467241) [8340 bp, 2779 aa]
           {ON} YBL088C (TEL1) - putative phosphatidylinositol
           kinase [contig 33] FULL
          Length = 2779

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 245 PSEMMDESIDSLTESI---------ISSDEIKEDDSKLTREEN-LRSASCNFHSNIPTQT 294
           PS+ +  +I++L E I         + S  +   +SKLT  EN L SAS      + T+ 
Sbjct: 40  PSKYLYPTIETLVEIIEGERIKYEGLCSGSLPSSESKLTAVENRLSSASYVLRVVVETKC 99

Query: 295 FSYKSGQLRFVL 306
            S+KS  L+F+L
Sbjct: 100 TSFKSKHLKFLL 111

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 100 PKQTEKKHYLLTDALSGFNEAAFIESMEFNQTEENEQSVYIEGMEINKSISSICLWP 156
           P +  K  YL+ D L G +++ FI ++ FN+   +E    IE +E    + S+  +P
Sbjct: 369 PFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDE---MIETLEFGNKVRSLKCYP 422

>NDAI0D00920 Chr4 (211004..212974) [1971 bp, 656 aa] {ON} Anc_1.392
           YNL012W
          Length = 656

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 7/80 (8%)

Query: 117 FNEAAFIESMEFNQTEENEQSVYIEGMEINKSISSICLWPQEETNMDLFYASNSMDHTME 176
           F +A FI S       E++    ++G E N++I  + L  QEE N+D+ +A ++   T E
Sbjct: 379 FKDAEFIGSNHSKSIVESKDLFLVDGGEDNQNIPLVPLL-QEERNLDVIFALDNSADTNE 437

Query: 177 NEEEGAIILAFPSLLNNHSK 196
           +  +GA      SL+N + +
Sbjct: 438 SWPDGA------SLVNTYQR 451

>Smik_10.76 Chr10 complement(121615..124152) [2538 bp, 845 aa] {ON}
           YJL157C (REAL)
          Length = 845

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 210 EDISIDSEKYDDVDSYIHAMSLMRVNANCANQIQSPSEMMDESIDSLTESIISS 263
           ED  ID + YD+ DS I  +SL R    C +Q   P   + E      ESI S+
Sbjct: 160 EDCCIDGDSYDEEDSPIFMVSLARNIKKCNSQ-SGPKRYIGEKCLICEESISST 212

>Ecym_6243 Chr6 complement(454101..457373) [3273 bp, 1090 aa] {ON}
           similar to Ashbya gossypii AER352C
          Length = 1090

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 29  FEALVNGSVRQQHLEAYFKSQFTSGNEGSKKILLSVPSMLCQEVSIKRL 77
           FE  VN S  ++H++     +F S NEG+ K L    S+  + V + +L
Sbjct: 853 FELFVNYSTMKEHIDDLVTKKFLSINEGNGKYLFEKWSIFWRHVILPKL 901

>YFR002W Chr6 (150016..152535) [2520 bp, 839 aa] {ON}  NIC96Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC nuclear basket; contributes to
           nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup57p, and Nup49p)
          Length = 839

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 79  LGSI---FNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEA-AFIESMEFNQTEEN 134
           LGSI    NE R +   +   +K+ K   K HYLL ++   F +  AFI+ ++ NQ  E 
Sbjct: 39  LGSIQVSINELRRRVFQLRSKNKASKDYTKAHYLLANSGLSFEDVDAFIKDLQTNQFLEP 98

Query: 135 EQSVYIEGMEI 145
                IE  E+
Sbjct: 99  NPPKIIESEEL 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.127    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,404,887
Number of extensions: 1912517
Number of successful extensions: 6350
Number of sequences better than 10.0: 141
Number of HSP's gapped: 6597
Number of HSP's successfully gapped: 157
Length of query: 379
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 268
Effective length of database: 40,753,473
Effective search space: 10921930764
Effective search space used: 10921930764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)