Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F010705.525ON90490446670.0
NDAI0H015805.525ON90991523360.0
KAFR0E033105.525ON93893622190.0
SAKL0G04884g5.525ON93092322010.0
YDR421W (ARO80)5.525ON95091721160.0
Suva_2.5985.525ON96592120970.0
Skud_4.6955.525ON95492420900.0
Smik_4.6965.525ON94992020860.0
TDEL0A038905.525ON83187020120.0
ZYRO0D12518g5.525ON88177320150.0
Kpol_1028.825.525ON92591918870.0
KLLA0A01804g5.525ON94597218680.0
KNAG0C032505.525ON93693118100.0
KLTH0G03718g5.525ON85788817940.0
TPHA0L003505.525ON85989917570.0
CAGL0F03025g5.525ON92893416290.0
TBLA0D016705.525ON101881115510.0
ADR199C5.525ON94496814870.0
CAGL0D03850g5.322ON8341341424e-08
NCAS0A047502.547ON1141621238e-06
Ecym_81598.879ON908781201e-05
TBLA0E047504.344ON1283601165e-05
NDAI0D00900singletonON8651051156e-05
AAL175W8.879ON883671139e-05
Kwal_27.96888.879ON841511121e-04
KLLA0B04620g4.344ON919551112e-04
Kwal_55.20722singletonON827861112e-04
KLTH0E16500g8.879ON833461112e-04
KAFR0A03060singletonON8602871102e-04
SAKL0D00264g8.879ON848391102e-04
NCAS0C002208.879ON839561102e-04
KLTH0D07260g2.547ON979581093e-04
TBLA0F012003.109ON1086711084e-04
CAGL0H06875g8.879ON702491074e-04
TPHA0C049808.879ON852491075e-04
KAFR0L021308.879ON882431075e-04
NCAS0A03070singletonON656471067e-04
KLLA0F04213g3.264ON768701067e-04
KNAG0A044808.423ON1013631067e-04
KAFR0B014502.547ON1088521067e-04
Kpol_538.528.879ON907401067e-04
TBLA0A04280singletonON892501040.001
ZYRO0B14718g4.344ON1035491030.001
KAFR0F014901.128ON6581261030.002
KLLA0C16489gna 1ON728471030.002
TPHA0L010608.423ON973621020.002
KLLA0A06039g1.199ON657451020.002
Kpol_1049.19na 2ON943481020.002
TBLA0C062306.60ON795571020.002
TBLA0C019105.577ON1148551020.002
Skud_13.438.879ON880511010.002
TBLA0G026102.231ON10001171010.002
KLLA0A09119g4.113ON1082771010.003
TBLA0E034803.109ON1046631010.003
ZYRO0E05676g2.547ON1066571010.003
ZYRO0A00440g8.879ON850391000.004
NCAS0A03570na 3ON978631000.004
ZYRO0D08316gna 4ON68068990.004
KLLA0D10197g8.879ON85674990.004
KNAG0A025508.423ON73062990.004
Kwal_56.230583.264ON77569980.005
KLTH0H16170gna 5ON61949980.005
KAFR0J017102.231ON84869980.005
Suva_13.498.879ON88250980.006
TDEL0B004808.879ON83539980.006
TDEL0D036103.264ON72479970.007
SAKL0D03586g3.264ON80167970.007
NCAS0H00780singletonON90937970.007
KLLA0E02663gna 6ON110946970.007
TPHA0G003807.512ON87357970.008
Ecym_33952.651ON1041303970.009
Smik_13.368.879ON88051960.009
Kpol_495.213.109ON1085164960.009
SAKL0H00682gna 7ON92237960.009
Kwal_47.168624.344ON74358960.009
TBLA0I025408.423ON125961960.010
SAKL0B04620gna 8ON36257950.010
TBLA0G00730singletonON801106960.010
SAKL0H25146gna 9ON64578950.011
NDAI0F00110singletonON50839950.012
NDAI0A057503.264ON75968950.012
Kpol_1001.34.344ON85644950.012
TPHA0B004104.344ON94546950.013
NDAI0D031804.344ON989121950.013
NDAI0K001508.879ON95339950.013
KNAG0J002108.879ON86139950.013
KAFR0A002202.651ON918279950.014
YML099C (ARG81)8.879ON88051950.014
KNAG0E041004.344ON90347950.014
KNAG0M00120singletonON88175940.016
KAFR0C03660singletonON84770940.016
Ecym_6141na 10ON11442870.016
Ecym_53972.231ON82673940.017
CAGL0C01199g8.423ON92263940.018
Kwal_56.246707.360ON64354930.019
KAFR0C013203.109ON100646940.019
KNAG0G021308.283ON63238930.021
KNAG0F028306.60ON74665930.022
KLLA0C17050gna 11ON95544930.022
NCAS0A150207.512ON80948930.022
CAGL0L01903g2.547ON128746930.023
ZYRO0G19338gna 9ON65343930.024
KNAG0M006206.154ON45957920.024
KLTH0C00880g2.651ON108572930.025
TBLA0H006808.423ON88065930.025
Kpol_1002.52.547ON95857930.025
TPHA0F025506.61ON799174920.027
Kwal_26.81092.547ON97041920.027
CAGL0H00396g7.512ON94037920.028
Suva_9.592.231ON92667920.028
KNAG0A071002.547ON128644920.031
KLLA0F25630g2.547ON100761920.031
Smik_9.392.231ON101278920.032
KNAG0D035204.113ON103044920.033
TBLA0I018903.264ON82558910.035
KLLA0A02585gna 8ON37048900.035
Kpol_1039.112.231ON99250910.035
TDEL0B063602.547ON98166910.037
KLLA0E18195g2.651ON113381910.037
KNAG0F037207.512ON76648910.038
NDAI0C048408.423ON94862910.039
KLTH0C07480g3.264ON77553910.039
YIL130W (ASG1)2.231ON964123910.039
YLR228C (ECM22)8.423ON81462910.041
SAKL0D14916gna 12ON632126900.044
Smik_12.2898.423ON81262900.045
Kpol_534.286.154ON43544900.047
KLLA0A03421gna 13ON88058900.049
NCAS0H012406.154ON47541900.049
Skud_12.2968.423ON81462900.054
NDAI0C002602.654ON104142900.055
NDAI0K018002.547ON121055900.056
Ecym_51313.264ON77090900.056
Suva_10.3238.423ON81362900.056
NDAI0A087907.17ON105944900.057
SAKL0A09856g2.547ON102056900.058
Ecym_1146na 14ON66547890.059
NCAS0H002707.512ON90657890.062
TBLA0F029207.512ON92337890.062
KAFR0A031807.512ON84657890.066
Suva_15.415na 2ON86749890.067
CAGL0I07755g3.109ON105342890.068
CAGL0H04367g4.344ON94542890.069
ZYRO0G12584gna 15ON68686890.071
TBLA0A007302.654ON103745890.073
KAFR0G025406.60ON85561890.073
SAKL0D02596gna 15ON75061890.074
TBLA0G011308.879ON113239890.074
KNAG0J002508.845ON123750890.075
Smik_4.2693.264ON77867890.075
KLTH0D16852g4.344ON81144890.075
KAFR0B028208.283ON66438880.076
KLTH0B09262gsingletonON82053880.078
KNAG0D052407.512ON86943880.080
YKL038W (RGT1)2.547ON117044880.081
AFR096W1.277ON85240880.085
CAGL0F07865g8.423ON84462880.085
SAKL0D14542gna 13ON94637880.086
Kpol_455.108.879ON83058880.089
Kwal_26.68057.17ON94458880.094
TDEL0F054708.423ON81057880.098
SAKL0G11902g5.235ON90660880.098
KNAG0H012603.264ON74155870.099
KLLA0F00572gna 12ON59773870.100
TDEL0E039105.235ON86257870.10
Skud_15.546na 16ON54298870.10
NDAI0D002207.512ON94442870.11
KAFR0B063408.423ON86457870.11
Smik_12.5497.512ON88673870.11
AFR171Wna 9ON61260870.11
Ecym_4635na 6ON856118870.11
Kwal_56.24566na 1ON75575870.11
CAGL0F09229gna 17ON83561870.11
NCAS0B065502.231ON90646870.12
Smik_11.2102.547ON116944870.12
Skud_4.2873.264ON78467870.12
KLTH0C10098g6.60ON77159870.12
Smik_11.2402.654ON97645870.12
TDEL0D051503.109ON99642870.12
KLTH0H00968g7.360ON62355870.12
KLLA0A04169g8.423ON77562870.12
NCAS0I002707.17ON94465870.12
TPHA0E012905.322ON85250870.13
YML076C (WAR1)4.344ON94444870.13
Ecym_63401.277ON95240870.13
Skud_2.397.389ON115941870.13
NCAS0A061904.344ON89482860.13
TBLA0E007007.17ON127444870.14
Skud_9.372.231ON95451860.14
KLLA0F09559gsingletonON65859860.14
ACL195Cna 10ON10943790.14
ZYRO0E00638g2.651ON110690860.14
ZYRO0B14476gna 14ON707157860.14
AAL057C5.322ON80965860.15
SAKL0D08008gna 18ON1228137860.15
Ecym_72037.512ON88456860.15
Ecym_2672na 15ON73966860.15
ACR241C1.199ON79586860.16
KAFR0C049807.17ON95158860.16
TBLA0B062404.344ON143543860.16
SAKL0D05654g1.277ON91940860.16
Suva_11.1872.547ON117144860.16
KLLA0F04609g2.231ON91645860.17
KLTH0A06644gna 4ON728241850.17
NDAI0B016802.547ON92470860.17
Sklu_YGOB_gneas1na 10ON48040850.18
Suva_2.517.389ON115541860.18
KLLA0D10593g7.512ON92543850.18
CAGL0F02519g1.128ON83299850.18
YKL015W (PUT3)2.654ON97942850.19
Kpol_1042.66.60ON78048850.19
YDR034C (LYS14)3.264ON79055850.19
ZYRO0E06270g2.565ON91244850.19
TBLA0B04800singletonON77745850.19
KLLA0F14322g1.277ON71742850.20
AGL091W8.423ON86662850.20
Suva_2.1214.113ON97137850.20
Kpol_529.158.423ON94862850.20
YBL066C (SEF1)7.389ON114841850.20
SAKL0G02992gna 6ON106157850.21
SAKL0A01386gna 4ON77044850.21
Skud_13.664.344ON93944850.21
TPHA0N004407.56ON757214850.21
Skud_15.643.109ON1032129850.21
ZYRO0D01650g7.512ON86037850.21
Skud_11.1902.547ON117144850.21
CAGL0M12298g7.17ON99457850.21
Smik_2.507.389ON115041850.22
ADR405Cna 19ON80737850.23
ZYRO0A10956g5.235ON85558850.23
YDL170W (UGA3)7.360ON52847840.23
TPHA0M010403.264ON77045840.23
Kwal_23.29055.235ON88163840.23
NDAI0F012206.279ON96043840.24
KLLA0E18129g2.654ON86542840.24
CAGL0K11902g3.264ON83159840.24
KAFR0I002804.344ON93649840.24
KNAG0E041507.17ON113637840.25
Smik_17.27singletonON68847840.26
Kpol_1023.415.322ON81537840.27
TDEL0E030505.322ON82238840.27
TPHA0B015854.344ON81237840.27
TPHA0A045403.109ON117855840.28
KAFR0A014801.277ON72543840.28
ZYRO0A03058g3.264ON73663840.28
Suva_2.1873.264ON78459840.28
TDEL0D007304.344ON80642840.29
Suva_11.2132.654ON98545840.30
Ecym_72354.113ON94355840.30
YHR056C (RSC30)5.322ON88373830.30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F01070
         (904 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...  1802   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   904   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   859   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   852   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   819   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   812   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   809   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   808   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   779   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   780   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   731   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   724   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   701   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   695   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     681   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   632   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   602   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   577   0.0  
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    59   4e-08
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    52   8e-06
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    51   1e-05
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    49   5e-05
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               49   6e-05
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    48   9e-05
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    48   1e-04
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    47   2e-04
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    47   2e-04
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    47   2e-04
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    47   2e-04
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    47   2e-04
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       47   2e-04
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    47   3e-04
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    46   4e-04
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    46   4e-04
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    46   5e-04
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    46   5e-04
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               45   7e-04
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    45   7e-04
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    45   7e-04
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    45   7e-04
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    45   7e-04
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    45   0.001
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    44   0.001
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    44   0.002
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    44   0.002
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    44   0.002
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    44   0.002
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    44   0.002
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.002
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    44   0.002
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    44   0.002
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    44   0.002
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    44   0.003
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    44   0.003
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    44   0.003
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    43   0.004
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    43   0.004
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    43   0.004
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    43   0.004
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    43   0.004
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    42   0.005
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    42   0.005
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    42   0.005
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    42   0.006
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.006
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    42   0.007
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    42   0.007
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    42   0.007
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    42   0.007
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       42   0.008
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    42   0.009
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    42   0.009
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    42   0.009
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    42   0.009
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    42   0.009
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    42   0.010
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    41   0.010
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    42   0.010
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    41   0.011
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 41   0.012
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    41   0.012
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    41   0.012
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    41   0.013
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    41   0.013
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    41   0.013
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    41   0.013
KAFR0A00220 Chr1 complement(42494..45250) [2757 bp, 918 aa] {ON}...    41   0.014
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    41   0.014
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    41   0.014
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      41   0.016
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    41   0.016
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    38   0.016
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    41   0.017
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    41   0.018
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    40   0.019
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    41   0.019
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    40   0.021
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               40   0.022
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    40   0.022
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    40   0.022
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    40   0.023
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    40   0.024
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    40   0.024
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    40   0.025
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    40   0.025
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    40   0.025
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    40   0.027
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    40   0.027
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    40   0.028
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    40   0.028
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    40   0.031
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    40   0.031
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    40   0.032
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    40   0.033
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    40   0.035
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    39   0.035
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    40   0.035
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    40   0.037
KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa...    40   0.037
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    40   0.038
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    40   0.039
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    40   0.039
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    40   0.039
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    40   0.041
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    39   0.044
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    39   0.045
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    39   0.047
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    39   0.049
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     39   0.049
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    39   0.054
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    39   0.055
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    39   0.056
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    39   0.056
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    39   0.056
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    39   0.057
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    39   0.058
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    39   0.059
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    39   0.062
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    39   0.062
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    39   0.066
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    39   0.067
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    39   0.068
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    39   0.069
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    39   0.071
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    39   0.073
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.073
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    39   0.074
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    39   0.074
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    39   0.075
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    39   0.075
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    39   0.075
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    39   0.076
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    39   0.078
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    39   0.080
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    39   0.081
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    39   0.085
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    39   0.085
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    39   0.086
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    39   0.089
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    39   0.094
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    39   0.098
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    39   0.098
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    38   0.099
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    38   0.100
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    38   0.10 
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    38   0.10 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    38   0.11 
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    38   0.11 
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    38   0.11 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    38   0.11 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    38   0.11 
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    38   0.11 
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    38   0.11 
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    38   0.12 
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    38   0.12 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    38   0.12 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.12 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    38   0.12 
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    38   0.12 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    38   0.12 
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    38   0.12 
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    38   0.12 
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    38   0.13 
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    38   0.13 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    38   0.13 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    38   0.13 
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    38   0.13 
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    38   0.14 
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    38   0.14 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    38   0.14 
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    35   0.14 
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    38   0.14 
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    38   0.14 
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    38   0.15 
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    38   0.15 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    38   0.15 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    38   0.15 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    38   0.16 
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    38   0.16 
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    38   0.16 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    38   0.16 
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    38   0.16 
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    38   0.17 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    37   0.17 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     38   0.17 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    37   0.18 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    38   0.18 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    37   0.18 
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    37   0.18 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    37   0.19 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    37   0.19 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    37   0.19 
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    37   0.19 
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    37   0.19 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    37   0.20 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    37   0.20 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.20 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    37   0.20 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    37   0.20 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.21 
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    37   0.21 
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    37   0.21 
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    37   0.21 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    37   0.21 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    37   0.21 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    37   0.21 
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    37   0.21 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    37   0.22 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.23 
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    37   0.23 
YDL170W Chr4 (156318..157904) [1587 bp, 528 aa] {ON}  UGA3Transc...    37   0.23 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    37   0.23 
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    37   0.23 
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    37   0.24 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    37   0.24 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    37   0.24 
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    37   0.24 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    37   0.25 
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    37   0.26 
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    37   0.27 
TDEL0E03050 Chr5 (575425..577893) [2469 bp, 822 aa] {ON} Anc_5.3...    37   0.27 
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     37   0.27 
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    37   0.28 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    37   0.28 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    37   0.28 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    37   0.28 
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    37   0.29 
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    37   0.30 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    37   0.30 
YHR056C Chr8 complement(215183..217834) [2652 bp, 883 aa] {ON}  ...    37   0.30 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    37   0.30 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    37   0.31 
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    37   0.31 
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    37   0.32 
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    37   0.32 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    37   0.32 
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    37   0.32 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    37   0.32 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    37   0.33 
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    37   0.33 
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               37   0.33 
KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON} conser...    37   0.34 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    37   0.34 
TBLA0E03050 Chr5 complement(764239..766578) [2340 bp, 779 aa] {O...    37   0.34 
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    37   0.34 
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    37   0.34 
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    37   0.34 
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    37   0.35 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    37   0.35 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    37   0.35 
Kpol_1005.2 s1005 complement(1473..3992) [2520 bp, 839 aa] {ON} ...    37   0.35 
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    37   0.35 
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    37   0.35 
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    37   0.35 
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    37   0.36 
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    37   0.36 
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    37   0.36 
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    37   0.36 
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    37   0.36 
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    37   0.37 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    37   0.37 
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    37   0.37 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    37   0.37 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                37   0.38 
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    36   0.38 
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    37   0.39 
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    37   0.39 
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    37   0.39 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.40 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    36   0.40 
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     36   0.41 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    36   0.41 
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    36   0.41 
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               36   0.42 
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    36   0.42 
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    36   0.43 
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    36   0.43 
TBLA0A02950 Chr1 complement(709449..712349) [2901 bp, 966 aa] {O...    36   0.44 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    36   0.44 
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    36   0.44 
Suva_4.76 Chr4 (144078..145667) [1590 bp, 529 aa] {ON} YDL170W (...    36   0.45 
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    36   0.45 
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    36   0.45 
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    36   0.45 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    36   0.45 
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     36   0.46 
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...    36   0.47 
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    36   0.47 
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    36   0.48 
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    36   0.48 
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    36   0.49 
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    36   0.50 
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    36   0.50 
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    36   0.50 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     36   0.51 
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    36   0.52 
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    36   0.52 
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    36   0.52 
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    36   0.53 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    36   0.54 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    36   0.54 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    36   0.54 
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    36   0.55 
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    36   0.55 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    36   0.55 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    36   0.55 
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    36   0.56 
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    36   0.56 
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    36   0.57 
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    36   0.59 
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    36   0.59 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    36   0.60 
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    36   0.61 
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    36   0.61 
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            36   0.62 
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    36   0.62 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    36   0.62 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    35   0.63 
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    36   0.66 
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    36   0.67 
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    36   0.68 
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    36   0.68 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    35   0.69 
KNAG0K02060 Chr11 (416607..419351) [2745 bp, 914 aa] {ON}              35   0.69 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    35   0.69 
KLLA0D00396g Chr4 complement(36277..37362) [1086 bp, 361 aa] {ON...    35   0.69 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    35   0.73 
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 35   0.75 
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     35   0.76 
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    35   0.77 
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    35   0.78 
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    35   0.78 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    35   0.78 
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    34   0.79 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    35   0.79 
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    35   0.79 
KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON} Anc_5....    35   0.79 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    35   0.80 
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    35   0.80 
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    35   0.80 
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    35   0.82 
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    35   0.82 
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    35   0.82 
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    35   0.83 
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    35   0.84 
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    35   0.86 
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    35   0.87 
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    35   0.87 
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    35   0.88 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    35   0.88 
Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}...    35   0.88 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    35   0.88 
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    35   0.89 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    35   0.90 
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    35   0.90 
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    35   0.90 
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    35   0.91 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    35   0.92 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    35   0.93 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    35   0.94 
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    35   0.94 
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    35   0.94 
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    35   0.97 
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    35   0.98 
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    35   0.98 
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    35   1.00 
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    35   1.00 
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    35   1.0  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    35   1.1  
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    35   1.1  
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    35   1.1  
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    35   1.1  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    35   1.1  
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    35   1.1  
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    35   1.2  
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    35   1.2  
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    35   1.2  
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    35   1.3  
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    35   1.3  
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     35   1.3  
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    35   1.3  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    34   1.3  
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    35   1.3  
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    35   1.4  
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    35   1.4  
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    35   1.4  
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    35   1.4  
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    35   1.4  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    34   1.4  
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               35   1.4  
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    34   1.5  
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               35   1.5  
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    35   1.5  
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    34   1.5  
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    35   1.5  
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    35   1.5  
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    34   1.5  
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    35   1.5  
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    35   1.6  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    34   1.6  
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    34   1.6  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    34   1.6  
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    34   1.6  
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    34   1.7  
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    34   1.8  
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    34   1.8  
KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON} Anc_5.3...    34   1.8  
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    34   1.8  
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    34   1.8  
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    34   1.9  
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    34   2.0  
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    34   2.0  
Skud_8.113 Chr8 complement(188347..190992) [2646 bp, 881 aa] {ON...    34   2.0  
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    34   2.1  
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    34   2.1  
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    34   2.1  
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    34   2.1  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    34   2.2  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    34   2.2  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    33   2.2  
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    34   2.2  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    34   2.2  
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    34   2.2  
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 34   2.2  
YDR303C Chr4 complement(1068729..1071386) [2658 bp, 885 aa] {ON}...    34   2.2  
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    34   2.3  
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    34   2.3  
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    34   2.4  
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    34   2.4  
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    33   2.4  
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    33   2.4  
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      34   2.5  
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    34   2.5  
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    34   2.5  
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    34   2.6  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    34   2.7  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    33   2.7  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    33   2.8  
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    33   2.8  
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    33   2.9  
TBLA0A00280 Chr1 (45618..47912) [2295 bp, 764 aa] {ON}                 33   2.9  
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    33   3.0  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    33   3.0  
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    33   3.1  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    33   3.2  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    33   3.2  
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    33   3.3  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    33   3.3  
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    33   3.3  
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    33   3.4  
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    33   3.4  
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    33   3.4  
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    33   3.5  
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    33   3.5  
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    33   3.5  
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    33   3.6  
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    33   3.7  
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    33   3.7  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    33   3.7  
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    33   3.8  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    33   3.8  
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    33   4.0  
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    33   4.0  
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    33   4.0  
Suva_2.469 Chr2 complement(833514..836180) [2667 bp, 888 aa] {ON...    33   4.1  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    33   4.1  
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    33   4.1  
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     33   4.3  
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    33   4.3  
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    33   4.4  
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    33   4.5  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    33   4.6  
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    33   4.6  
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    33   4.6  
Smik_9.227 Chr9 (373211..376084) [2874 bp, 957 aa] {ON} YIR023W ...    33   4.6  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    33   4.7  
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    33   4.7  
SAKL0F11198g Chr6 complement(873587..875866) [2280 bp, 759 aa] {...    33   4.8  
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    33   4.8  
Smik_4.552 Chr4 complement(1000275..1002938) [2664 bp, 887 aa] {...    33   4.9  
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    33   5.0  
Skud_4.565 Chr4 complement(1011134..1013803) [2670 bp, 889 aa] {...    33   5.1  
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    33   5.2  
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    33   5.3  
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    33   5.3  
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    33   5.5  
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               33   5.5  
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    33   5.6  
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    33   5.7  
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    33   5.9  
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    33   5.9  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    32   6.2  
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    32   6.4  
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    32   6.4  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    32   6.5  
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    32   7.1  
Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W ...    32   7.6  
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    32   7.6  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    32   7.8  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    32   7.9  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    32   7.9  
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    32   7.9  
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    32   8.1  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             32   8.2  
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    32   8.2  
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    32   8.5  
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    32   9.0  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    32   9.2  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    32   9.5  

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score = 1802 bits (4667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 869/904 (96%), Positives = 869/904 (96%)

Query: 1   MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
           MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC
Sbjct: 1   MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60

Query: 61  RREGKTCIFSSGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKT 120
           RREGKTCIFSSGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKT
Sbjct: 61  RREGKTCIFSSGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKT 120

Query: 121 ENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSEN 180
           ENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSEN
Sbjct: 121 ENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSEN 180

Query: 181 DTPVQQQDSPNENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSE 240
           DTPVQQQDSPNENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSE
Sbjct: 181 DTPVQQQDSPNENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSE 240

Query: 241 EEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGT 300
           EEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGT
Sbjct: 241 EEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGT 300

Query: 301 PGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYA 360
           PGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYA
Sbjct: 301 PGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYA 360

Query: 361 NNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAK 420
           NNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAK
Sbjct: 361 NNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAK 420

Query: 421 VFVATHISESYTAINMNQGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARW 480
           VFVATHISESYTAINMNQGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARW
Sbjct: 421 VFVATHISESYTAINMNQGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARW 480

Query: 481 NGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXIIPLKFTSTQKAK 540
           NGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYA            IIPLKFTSTQKAK
Sbjct: 481 NGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYADHDEDTQQHTQQIIPLKFTSTQKAK 540

Query: 541 LELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEV 600
           LELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEV
Sbjct: 541 LELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEV 600

Query: 601 LSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASF 660
           LSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASF
Sbjct: 601 LSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASF 660

Query: 661 VEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEA 720
           VEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEA
Sbjct: 661 VEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEA 720

Query: 721 NTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXXXXX 780
           NTILRLSAISVDE           LKEAAPDELHLCTRYSAILMYLCREMKLRDK     
Sbjct: 721 NTILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCREMKLRDKTNNNN 780

Query: 781 XXXXXXXQKILIENSNPDGVEGVASNFGNVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMD 840
                  QKILIENSNPDGVEGVASNFGNVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMD
Sbjct: 781 NTGENEEQKILIENSNPDGVEGVASNFGNVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMD 840

Query: 841 EGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDVNTSFEELYRQLCEPFNEHS 900
           EGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDVNTSFEELYRQLCEPFNEHS
Sbjct: 841 EGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDVNTSFEELYRQLCEPFNEHS 900

Query: 901 TDGS 904
           TDGS
Sbjct: 901 TDGS 904

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/915 (53%), Positives = 604/915 (66%), Gaps = 59/915 (6%)

Query: 19  KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF-SSGGN--- 74
           ++ + + KW+R ++AC +C++RKVKCD+GPLENPH PPC RCRREGKTC+F ++ G    
Sbjct: 12  QKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKAD 71

Query: 75  -GMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWK 133
            G S    +T   K N       KR   +D+++ L ++    KI KT  +    P  KWK
Sbjct: 72  LGTSKIPSTTPTLKPNSGNSVSKKR---LDSSTDLVNEV-PVKIPKTSPSNPISP-TKWK 126

Query: 134 LELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQQDSPNEN 193
           + L SMQNSLEFLAKAA +V   S P +     +L        TS           P E 
Sbjct: 127 IGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATS----------LPQEE 176

Query: 194 YLTPLTTPHNS-----------RRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEE 242
            L  +T+  +S           +  +LP ++K   +RP   + L+D+++IGP++LLSE +
Sbjct: 177 SLMNMTSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESD 236

Query: 243 ARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEF-DGYNGTP 301
           A ELIDLFFLTM PFFP+IPLQLQ+  EL +YPILLCAILTISSRYH FD F D  N   
Sbjct: 237 AIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQ 296

Query: 302 GRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYAN 361
             ++R+I VHEKLWIYCQRLISQT+WAEASTRSIGTI AFIIFTEWNPRAIHW WSDYA+
Sbjct: 297 NNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYAS 356

Query: 362 NPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKV 421
           +P   D++KR    Q   ++E+GLTGI AIRRSDRMAWML+GTAVRLAQD G I T+ KV
Sbjct: 357 DPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKV 416

Query: 422 FVATHISESYTAINMNQGLILSQSFNERNLD--------GIDNLNGVDNERLYLEQILQN 473
            +ATHIS+++TA+NMNQ   LS SFN    D        G D+   V NE  YL QILQN
Sbjct: 417 AIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVV-NENFYLTQILQN 475

Query: 474 DESKARWNGILKLL--DNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXIIPL 531
            ESK RW  I      DNE  + +  L D+E EFLNDEY LY++             +PL
Sbjct: 476 KESKERWKKISATFQKDNEETVGQ--LSDMEYEFLNDEYALYFSKEDNDSSQRPP--LPL 531

Query: 532 KFTSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRS 591
           KFT  Q+AKLELLRI+ LGYETIYYE G+QRLVS DQR NLAVLNIL+PLI+SWY+NY S
Sbjct: 532 KFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNS 591

Query: 592 LLEIREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKL 651
           LL+      +S    + K++AF+MS+ I+ ETMISDYYYCQLYI+SLALQVDV +NKLKL
Sbjct: 592 LLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKL 651

Query: 652 NEIRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTC 711
           NEI RCA +VEKAY+AAKEILESAGRVHKL MLKYMPV+WV+RIVRSVAFIVKCYLTLT 
Sbjct: 652 NEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTS 711

Query: 712 SDLSTNPEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMK 771
              S+NPEA TIL LSAISVDE           LKEAAPDELHL TRYSAIL+YLCREMK
Sbjct: 712 GSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMK 771

Query: 772 LR------DKXXXXXXXXXXXXQKILIENSNPDGV--EGVASNFGNVPSTLPPSYAQK-- 821
            +       K               +I N + D +  + +  +   V +  P +  +   
Sbjct: 772 SKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIE 831

Query: 822 -STTKEQLSDDGAHSMSF-MDEGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSG 879
               K  L    A  M F  D    L  +V +WF   G+IGL+FVEPWTEMIEQ YLQSG
Sbjct: 832 LQMNKPNLDGKFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSG 891

Query: 880 DVNTSFEELYRQLCE 894
           D NT+F++LY+++C+
Sbjct: 892 DANTTFDDLYKEICQ 906

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/936 (48%), Positives = 600/936 (64%), Gaps = 74/936 (7%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85
           KW+RS++AC++CR RKVKCDLGP +NPH PPCVRC+RE + C+F+S           T++
Sbjct: 15  KWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSRRKKKDDVISGTVS 74

Query: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145
             N  +  T       +  NS  +     +   K  NT  +    KWK  L SMQN+LEF
Sbjct: 75  LTNVPSAITQEDDNDRIQLNSGSSKGALFSNSPKNPNTQDQ---SKWKYGLGSMQNTLEF 131

Query: 146 LAKAADSVAHQSNPE--SFKETAKLAKNGASNDTSENDTPVQQQ----DSPNENYLTPLT 199
           LA AA SV+ +SN    + + + + AK  + +   ++ +P  ++    D+  ++ + PL 
Sbjct: 132 LATAAGSVSKESNRRLTTARHSHQYAKETSEDFRVDDSSPSSERKDITDTSEQSVIAPLL 191

Query: 200 TPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTMNPFFP 259
               ++R+ +  +E+   +RPK ++ L+D+++IGPS LLSE+EARELID +FLTM+PFFP
Sbjct: 192 KECGTQRATVSLIEELSRVRPKPNKKLADIDYIGPSNLLSEQEARELIDAYFLTMHPFFP 251

Query: 260 HIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKLWIYCQ 319
           +IPLQLQD DELV YPILLCAILT+SSRYHPF EF  YNG     KRNI VHE LW YCQ
Sbjct: 252 NIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFGFYNGE--NNKRNIEVHETLWDYCQ 309

Query: 320 RLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESFSQEPN 379
           RLISQTVWAEASTRSIGT+ AFIIFTEWNPR IHW+ +DYAN+ E      +++      
Sbjct: 310 RLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRTDYANSAE------KDTDVPHSQ 363

Query: 380 KDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAINMNQG 439
           KD+DGLTGI AIRRSDRM+WMLTG+AVRLAQD+G IETS K+FVA+HIS+++ ++NMNQ 
Sbjct: 364 KDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIETSTKIFVASHISDTFASMNMNQR 423

Query: 440 LILSQSFN-------ERNLDGID----NLNGVDNERLYLEQILQNDESKARWNGILKLLD 488
             LS++F+             ID    +++ V NE+ YLEQ+LQN+ES+ RW  +L+ L 
Sbjct: 424 CALSETFSVVGFGAGRERASAIDSEQTDVDEVGNEKFYLEQMLQNEESRERWTRVLERLQ 483

Query: 489 NEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXI-IPLKFTSTQKAKLELLRIL 547
           +        L D+EREFLNDEY LYYA            +  PLKF+  Q+AK+EL+RI+
Sbjct: 484 HNNDKKNGPLTDLEREFLNDEYVLYYANRNDEMVQQHLQLPFPLKFSFHQRAKIELIRII 543

Query: 548 ILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVLSLNQRR 607
           ++ Y+TIYY+KG ++L S DQ HNLAVL IL+PLIE WY  YR+LL+I  G+  S+  R+
Sbjct: 544 LIAYDTIYYDKGKRKLTSNDQVHNLAVLGILSPLIEGWYATYRNLLKISSGQPYSIEIRK 603

Query: 608 NKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFVEKAYIA 667
           NKR   E+  +IN E+++SDYYYCQLYIYSLALQVDV+  KL++NE  + A +VE AY+A
Sbjct: 604 NKRAVHELGEEINRESILSDYYYCQLYIYSLALQVDVKGPKLRINEATKSAKYVELAYVA 663

Query: 668 AKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEANTILRLS 727
           AKEIL S+ RVH+L MLKYMPVRWV+RIVR+V+F+VKCYLTLT      N EA TIL+L 
Sbjct: 664 AKEILISSTRVHRLKMLKYMPVRWVMRIVRAVSFLVKCYLTLTGGGGVPNSEAQTILKLC 723

Query: 728 AISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXXXX-------- 779
            IS+DE           LKEA+PDELHLC RYSAIL+YLC+EM L+ K            
Sbjct: 724 CISLDETIHTIRLAALILKEASPDELHLCVRYSAILLYLCKEMNLKSKRNQKLLVSHGIL 783

Query: 780 ---------XXXXXXXXQKILIENSNPDGVEGVASNFGNVPSTLP--------------- 815
                            Q   I+  + D  + + SN   +P+ +                
Sbjct: 784 INESRNRQMGSRRTKATQDSDIDLGSTDDSKNIQSNNELLPNNISTTNGLTTSLFNTEEM 843

Query: 816 ---------PSYAQKSTTKEQLSDDGAHSMSFMDEGPSLSNNVTDWFNVGGDIGLDFVEP 866
                    P+ A    T   L +DG ++ +     PSL +   DWF+   DIGLDFVEP
Sbjct: 844 RSETPNQRIPTSAVADNTPNNLDNDGTNNPTNF---PSLPDEAIDWFSGSADIGLDFVEP 900

Query: 867 WTEMIEQRYLQSGDVNTSFEELYRQLCEP-FNEHST 901
           WTE++EQR+LQSGD N  FEELY Q+  P F E+++
Sbjct: 901 WTELLEQRFLQSGDGNNIFEELYNQVNMPNFAEYTS 936

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/923 (50%), Positives = 600/923 (65%), Gaps = 80/923 (8%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF--SSGGNGMSSANLST 83
           KW+R+++AC++CR RKVKCDLGP++NPH PPCVRC+RE K CIF  S+   G+  AN+S 
Sbjct: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77

Query: 84  MNGKNNQATFTGIKRALSV-DANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNS 142
           +      AT +  K   SV   N++  SQ    K    EN+   LP      EL +MQ++
Sbjct: 78  IAENTANATASMSKAITSVFQGNTSEGSQQPDFK---RENSIDPLPINS---ELTTMQDA 131

Query: 143 LEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQ---QDS---------P 190
           LEFLAKAA SVA + + +    + K  +   S   S  DTP+     QDS         P
Sbjct: 132 LEFLAKAAGSVAKEDSRDLVDASTKY-EELESQSNSRTDTPISSGSAQDSTRNSNSANIP 190

Query: 191 NENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLF 250
           +E  + PL  PH   R  +P +EK  S+RPK S+ L+D+E+IG  K+LSEEEA +LIDLF
Sbjct: 191 DEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLF 250

Query: 251 FLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHV 310
           FLTM+PFFPH+PLQLQ+ DEL +YPILLCAILTISSRYH FDE + YNG      RN+ +
Sbjct: 251 FLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGE--SNNRNVEI 308

Query: 311 HEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTK 370
           HE+LWIYCQRLISQTVWAEASTRSIGT+ AF++FTEWNPRAIHW+WSDYANNP+  D++K
Sbjct: 309 HERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSK 368

Query: 371 RE----------SFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAK 420
           R+          S +    +  DGLTG++A+RRSDRMAWMLTGTAVRLAQD+G + TS+K
Sbjct: 369 RDLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSK 428

Query: 421 VFVATHISESYTAINMNQGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARW 480
           +F ATHISE++TA+NMNQ  ILSQS  E NL+G ++   V+NE  YL QIL++D SK RW
Sbjct: 429 IFTATHISETHTAMNMNQRSILSQSLAEINLNGYED--DVENESYYLGQILKSDGSKERW 486

Query: 481 NGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXIIP---------- 530
           +  LK L +    +   + D+EREF+NDEY LYY+             +           
Sbjct: 487 SKFLKKLGSSS--TRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIE 544

Query: 531 -----LKFTSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESW 585
                LKF+  Q+AK+ELLRI+ +GYETIY  +G  +L S  Q HNLA+L+IL+PLIESW
Sbjct: 545 EEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYHNLALLSILSPLIESW 602

Query: 586 YNNYRSLLEIREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDV- 644
           YN Y+++L+   G   +      K+  FE++ +++ E++ISDYYYCQLYIYSLALQVDV 
Sbjct: 603 YNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVG 662

Query: 645 --EENKLKLNEIRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFI 702
             ++ KL++NEI +CA +VE AY AAKEIL SA RVHKL MLKYMPVRWV RIVRSVAF+
Sbjct: 663 TPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFV 722

Query: 703 VKCYLTLTCSDLSTNPEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAI 762
           VKCYLTLT S ++TNPEANTIL LS I  +E           L+EA+PDELHLCTRYS I
Sbjct: 723 VKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTI 782

Query: 763 LMYLCREMKLRDK---XXXXXXXXXXXXQKILIENS------NPDGVEGVAS-NFGNVP- 811
           LMYLC EMKLR +               ++I +E +      N    +G  S   G +P 
Sbjct: 783 LMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPLPP 842

Query: 812 ---STLPPSYAQKSTTKEQLSDDGAHSMSFMDEGPSLSNNVTDWFNVGGDIGLDFVEPWT 868
              ++LP +           S  GA +         L   V DWF+   +IGLDFVEPWT
Sbjct: 843 PRMNSLPETTNFAFNVDNFFSPQGAQTH-------HLPTQVVDWFSTSDEIGLDFVEPWT 895

Query: 869 EMIEQRYLQSGDVNTSFEELYRQ 891
           EMIEQ+++ S D N +FE LY Q
Sbjct: 896 EMIEQQFI-SNDNNKTFENLYNQ 917

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/917 (48%), Positives = 590/917 (64%), Gaps = 58/917 (6%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85
           K +R+++ACISCR RKVKCDLGP++NPH PPC RC+RE K CIFSS     +    +++N
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFSSNKGTSNDLPPNSIN 76

Query: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145
             +   +    K+ +  D+ S + S    ++   +     +    KWKLEL+SMQN+LEF
Sbjct: 77  AIS-LPSLGKSKQEIQNDSTSPILSDVPLSRKGISSEKSFKSEGMKWKLELSSMQNALEF 135

Query: 146 LAKAADSVAHQSNPESFKETAKLAKN-----GASND--TSENDTPVQQQDSPN---ENYL 195
           LA+AA +VA +   E  KE +   K       A+N   T E    + + DS N   EN  
Sbjct: 136 LAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLKRLSKSDSTNTLYENTA 195

Query: 196 TPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTMN 255
             L    N+ R     +E+   +RP  ++ + D ++IGP  LL++EEA ELI+ FFLTM+
Sbjct: 196 DMLNHTLNTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPDSLLTKEEAIELIEAFFLTMH 255

Query: 256 PFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKLW 315
           PFFP+IPLQL D  EL  YPIL CAILT+S+RYHPFD     NG  G   R+I VH+KLW
Sbjct: 256 PFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLGLDNGEDGM--RHIEVHDKLW 313

Query: 316 IYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESFS 375
           +YCQ+LISQT+WAEASTRSIGT+ AFIIFTEWNPR+IH+KWSDYAN+PE  ++  R S +
Sbjct: 314 VYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNARGSKN 373

Query: 376 QEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAIN 435
               KDE+GLTG+ AIRRSDRM+WMLTG+AVRLAQD+G IE S+KVF+ THISE+ +A+N
Sbjct: 374 ISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKVFIVTHISETTSAMN 433

Query: 436 MNQGLILSQSFNERNL-------DGID-NLNGVDNERLYLEQILQNDESKARWNGILKLL 487
           MNQ  +L++SF+  NL       DG + N + + NE+ YL +IL ++ESK RW  + +  
Sbjct: 434 MNQRSLLAESFSVLNLNLGKIENDGNESNEDYLGNEKFYLNEILPDEESKLRWKRVFENS 493

Query: 488 DNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXI--IPLKFTSTQKAKLELLR 545
           +N+    + +L D EREFLNDEY LYY+            I   PL+F+  Q+AK+E++R
Sbjct: 494 ENDHDNEKNFLTDWEREFLNDEYVLYYSNKKDDTNLAQNHIPPFPLRFSFAQRAKIEIIR 553

Query: 546 ILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVLSLNQ 605
           IL + YETIY EK  ++L +TDQRHNL+VL++ +PLIE W +NYR LL        SL  
Sbjct: 554 ILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYRELLVPLSDVPFSLAD 613

Query: 606 RRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFVEKAY 665
           R+NK++ F+   +IN E++I+D+ YCQLYI+SLALQVD + ++L +NEI   A +VE AY
Sbjct: 614 RKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKTSRLNMNEIVTSARYVELAY 673

Query: 666 IAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEANTILR 725
            +AKEIL SA RV +  MLKYMPVRWV+RI+RS+AFIVKCYLTLT S+L+TNP+A  IL+
Sbjct: 674 RSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARNILK 733

Query: 726 LSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXXXXXXXXXX 785
           LSAISVDE           LKEA PDELHLC RY+AILMYLC EMKLR K          
Sbjct: 734 LSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSYLERPPLLR 793

Query: 786 XXQKILIENSNPDGVEG-------VAS---NFGNVPSTLPPS---YAQKSTTKEQLSDDG 832
                L E++    +EG       + S    +    +T  PS     ++  +  Q S+D 
Sbjct: 794 DGTTPL-ESNRESSLEGQDLTKKPIFSKRIGYNKTETTFEPSERPLTEEINSNSQNSNDT 852

Query: 833 AHSMSFMD-------------------EGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQ 873
           + S   +D                   +GPSLS+ VTDWF    DIGL+FVEPWTE+IEQ
Sbjct: 853 S-SKGIVDPFVEQNNDITTALLNNELFQGPSLSDEVTDWFGASEDIGLEFVEPWTELIEQ 911

Query: 874 RYLQSGDV-NTSFEELY 889
           RY+Q GD  N +FE LY
Sbjct: 912 RYMQCGDGDNNNFENLY 928

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/921 (47%), Positives = 588/921 (63%), Gaps = 62/921 (6%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85
           K +R+++ACI+CR RKVKCDLGP++NPH PPC RC+RE K C+FSS    M + + S +N
Sbjct: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87

Query: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145
             +  A+ +  ++ +  D  S+  S    +       T  +    KWKLEL+SMQN+LEF
Sbjct: 88  ITSKSAS-SKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLEF 146

Query: 146 LAKAADSVAHQSNPESFKETAKLA-------KNGASNDTSENDTPVQQQ-------DSPN 191
           LA+AA +VA +   E  K+ +           +     T E   P+ +        ++P 
Sbjct: 147 LAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNTPI 206

Query: 192 ENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFF 251
           EN    L T  N+ R+    +E+   +RP  ++ + D E+IGP+ LL++EEA ELI+ FF
Sbjct: 207 ENLTVALATTLNANRTTSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEAFF 266

Query: 252 LTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVH 311
           LTM+PFFP+IP QL D  EL +YPIL CAILT+S+RYHPFD     NG  G   R++ VH
Sbjct: 267 LTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENG--TRHVEVH 324

Query: 312 EKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKR 371
           +KLW+YCQ+LISQT+WAEASTRSIGT+ AFIIFTEWNPR+IH KWSDYAN+PE  ++  R
Sbjct: 325 DKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVNVR 384

Query: 372 ESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESY 431
                   +DE+GLTG+ AIRRSDRM+WMLTG+AVRLAQD+G IE S+++F+ THISE+ 
Sbjct: 385 GGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETT 444

Query: 432 TAINMNQGLILSQSFNERNLD--------GIDNLNGVDNERLYLEQILQNDESKARWNGI 483
           +A+NMNQ  +L++SF+  NL+          +N N + NER YL++IL NDESK RW  +
Sbjct: 445 SAMNMNQRSVLAESFSVLNLNLGRFDNDGNENNENYLGNERFYLDEILPNDESKERWKKV 504

Query: 484 LKLLDNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXI--IPLKFTSTQKAKL 541
           L+ L+ +    +  L D EREFLNDEY LYY+            +   PL+F+  Q+AK+
Sbjct: 505 LENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPFPLRFSFAQRAKI 564

Query: 542 ELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVL 601
           E++RIL + YETIY EK  ++L +TDQRHNL+VL++ +PL+E W +NYR +L        
Sbjct: 565 EIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDVPF 624

Query: 602 SLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFV 661
           SL  R+NKR+      +IN E++I+D+ YCQLYI+SLALQVD + ++L ++EI + A +V
Sbjct: 625 SLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMSEIVKSAKYV 684

Query: 662 EKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEAN 721
           E AY +AKEIL SA RV +  MLKYMPVRWV+RI+RS+AFIVKCYLTLT S+++TNP+A 
Sbjct: 685 ELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDAR 744

Query: 722 TILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXXXXXX 781
            IL+LSAISVDE           LKEA PDELHLC RY+AILMYLC EMKLR K      
Sbjct: 745 NILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSHLERP 804

Query: 782 XXXXXXQKIL-------IENSN---------------------PDG---VEGVASNFGNV 810
                    L       +E +N                     P G    E  ++N  N 
Sbjct: 805 PTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVGKTSAEETSNNLNN- 863

Query: 811 PSTLPPSYAQKSTTKEQLSDDGAHSMSF-MDEGPSLSNNVTDWFNVGGDIGLDFVEPWTE 869
            ST  P     ++  EQ +D  A  ++  + +GPSLS  VTDWF+   DIGL+FVEPWTE
Sbjct: 864 -STELPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASEDIGLEFVEPWTE 922

Query: 870 MIEQRYLQSGDV-NTSFEELY 889
           +IEQRY+Q GD  N +FE LY
Sbjct: 923 LIEQRYMQCGDGDNNNFENLY 943

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/924 (48%), Positives = 584/924 (63%), Gaps = 68/924 (7%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS--GGNGMSSANLST 83
           K +R+++ACI+CR RKVKCDLGP++NPH PPC RC+RE K C FSS  G    +S N+ T
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76

Query: 84  MNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTEN-TYKRLPREKWKLELASMQNS 142
              K    TF         + +++  +   T   K+T N T  +    KWK EL+SMQN+
Sbjct: 77  AASK----TFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNA 132

Query: 143 LEFLAKAADSVAHQSNPESFKETA--------------KLAKNGASNDTSENDTPVQQQD 188
           LEFLA+AA +VA +   E  ++ +              + A +G     S  D+      
Sbjct: 133 LEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATC 192

Query: 189 SPNENYLTPLTTPHNSRRSALPQLEKSIS-IRPKSSQTLSDMEFIGPSKLLSEEEARELI 247
           +P+EN    L    N+ R+   QL + IS +RP  ++ + D ++IGP  LL++EEA ELI
Sbjct: 193 TPHENVTAMLAASLNANRTT-SQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELI 251

Query: 248 DLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRN 307
           + FFLTM+PFFP+IPLQL D  EL  YPIL CAILT+S+RYH FD    YNG  G   R+
Sbjct: 252 EAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGL--RH 309

Query: 308 IHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYD 367
           I VH+KLW+YCQ+LISQT+WAEASTRSIGT+ AFIIFTEWNPR+IH+KWSDYAN+PE  +
Sbjct: 310 IEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNN 369

Query: 368 MTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHI 427
           +  R S +    KDE+GLTG+ AIRRSDRM+WMLTG+AVRLAQD+G IE S+K+F+ THI
Sbjct: 370 VNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHI 429

Query: 428 SESYTAINMNQGLILSQSFNERNL-------DGIDN-LNGVDNERLYLEQILQNDESKAR 479
           SE+ +A+NMNQ  +L++SF+  NL       DG +N  N   NE+ YL++IL NDE K R
Sbjct: 430 SETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIKKR 489

Query: 480 WNGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXI--IPLKFTSTQ 537
           W G+ +   +     +  L D EREFLNDEY LYY+                PL+F+  Q
Sbjct: 490 WKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFSFAQ 549

Query: 538 KAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIRE 597
           +AK+E++RIL + YETIY EK  ++L +TDQRHNL+VL+I +PL+E W +NYR +L    
Sbjct: 550 RAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPLS 609

Query: 598 GEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRC 657
               SL  R+NK++ F+   +IN E++I+D+ YCQLYI+SLALQVD + ++L +NEI   
Sbjct: 610 DVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEIVTS 669

Query: 658 ASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTN 717
           A +VE AY +AKEIL SA RV +  MLK+MPVRWV+RI+RS+AFIVKCYLTLT S+L+TN
Sbjct: 670 ARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELATN 729

Query: 718 PEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXX 777
           P+A  IL+LSAISVDE           LKEA PDELHLC RY+AILMYLC EMKLR K  
Sbjct: 730 PDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLR-KSS 788

Query: 778 XXXXXXXXXXQKILIENSNPDGVEGV----ASNF-----GN-------VPSTLPPSYAQK 821
                         +E+++   +EGV     S F     GN        P  LP      
Sbjct: 789 HLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPVDEIGD 848

Query: 822 STTKEQLSDDGAHSMSFMD---------------EGPSLSNNVTDWFNVGGDIGLDFVEP 866
           +          A   SF++               +GPSLS  VTDWF    DIGL+FVEP
Sbjct: 849 NLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFVEP 908

Query: 867 WTEMIEQRYLQSGDV-NTSFEELY 889
           WTE+IEQRY+Q GD  N +FE LY
Sbjct: 909 WTELIEQRYMQCGDGDNNNFENLY 932

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/920 (47%), Positives = 590/920 (64%), Gaps = 65/920 (7%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85
           K +R+++ACI+CR RKVKCDLGP++NPH+PPC RC+RE + C+FSS     +S +   +N
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLFSSQKVVKNSTSPHMVN 76

Query: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145
                 T    K  +   +   ++S+   ++    + T  +    KWKLEL+SMQN+LEF
Sbjct: 77  ------TICQSKGEIPNHSRRLISSEMALSEKGTNDETLFKSDGVKWKLELSSMQNALEF 130

Query: 146 LAKAADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQQ--------------DSPN 191
           LA+AA +VA +   E+ K+ +   +   S+  + + +   ++              ++P+
Sbjct: 131 LAQAAGTVAKEGAKETIKDRSATPRPSESSLDTPHQSAANKELKTLSISECDASATNTPH 190

Query: 192 ENYLTPLTTPHNSRRSALPQLEKSIS-IRPKSSQTLSDMEFIGPSKLLSEEEARELIDLF 250
           EN    L    NS +  + QL K IS  RP  ++ + D E+IGP  LL++EEA ELI+ F
Sbjct: 191 ENITDTLAAALNSNQK-MSQLIKEISRARPMPTRRIDDFEYIGPDNLLTKEEAIELIEAF 249

Query: 251 FLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHV 310
           FLTM+PFFP+IPLQL D  EL  YPIL C+ILT+S+RYHPFD     NG  G   R+I V
Sbjct: 250 FLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLGLDNGENG--IRHIEV 307

Query: 311 HEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTK 370
           H+KLWIYCQ+LISQT+WAEASTRSIGT+ AFIIFTEWNPR+IH+KWSDYAN+PE  ++  
Sbjct: 308 HDKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVGV 367

Query: 371 RESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISES 430
           RES +    KDE+GLTG+ AIRRSDRM+WMLTG+AVRLAQD+G IE S+K+F+ THISE+
Sbjct: 368 RESKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISET 427

Query: 431 YTAINMNQGLILSQSFNERNL-------DG-IDNLNGVDNERLYLEQILQNDESKARWNG 482
            +A+NMNQ  +L++SF+  NL       DG   N N + NE+ YL +IL +DESK RW  
Sbjct: 428 TSAMNMNQRPLLAESFSVLNLNVRKFDDDGNKGNENYLGNEKFYLNEILPDDESKKRWKK 487

Query: 483 ILKLLDNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXI--IPLKFTSTQKAK 540
           + K  +++    +  L D EREFLNDEY LYY+            +   PL+F+  Q+AK
Sbjct: 488 VFKDSEDDDDSEKNILTDWEREFLNDEYVLYYSNKKDDTNLAQNPMPPSPLRFSFAQRAK 547

Query: 541 LELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEV 600
           +E++RIL + YETIY EK  ++L +TDQRHNL+VL++ +PLIE W +NYR +L       
Sbjct: 548 IEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYREVLVPISDVS 607

Query: 601 LSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASF 660
             L  R+NK++ F+   ++N ET+I+D+ YCQLYI+SLALQVD + ++L +NEI   A +
Sbjct: 608 FLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSLALQVDGKTSRLNMNEIMTSARY 667

Query: 661 VEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEA 720
           VE AY +AKEIL SA RV +  MLKYMPVRW +RI+RS+AFIVKCYLTLT S+L+TNP+A
Sbjct: 668 VELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRIIRSIAFIVKCYLTLTGSELATNPDA 727

Query: 721 NTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXXXXX 780
             IL+LSAISVDE           LKEA PDELHLC RY+AILMYLC EMKLR K     
Sbjct: 728 RNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSYTER 787

Query: 781 XXXXXXXQKILIEN--SNPDGVE-----GVASNFGNVPSTLPPSYAQKSTTKE------- 826
                     L  N  S+P+GV+         N  +  +      ++KS  +E       
Sbjct: 788 PPLSTNGTTPLESNCESSPEGVDFTKKPTFPKNIRSNKAECNSESSKKSPMEEIDSNLNN 847

Query: 827 --------------QLSDDGAHSM--SFMDEGPSLSNNVTDWFNVGGDIGLDFVEPWTEM 870
                         + ++D   ++  + + +GPSLS  VTDWF    DIGL FVEPWTE+
Sbjct: 848 PNNLSSKVIFNPFVEQNNDTTTTLLNNELFQGPSLSEEVTDWFGASEDIGLGFVEPWTEL 907

Query: 871 IEQRYLQSGDVN-TSFEELY 889
           IEQRY+Q GD +  +FE LY
Sbjct: 908 IEQRYMQCGDGDINNFENLY 927

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/870 (47%), Positives = 554/870 (63%), Gaps = 74/870 (8%)

Query: 20  RSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSA 79
           RS++D KW+RS++AC++CR+RK+KCD+GPL+ PH+PPC RC+REGKTC F      + S 
Sbjct: 8   RSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF------LQSR 61

Query: 80  NLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREK----WKLE 135
             S       Q    G++    V+ +  +    H   +    +  +R  R K    W+ E
Sbjct: 62  KKSVFK---RQHRTNGLELQDEVEKHVVIT---HEVDVGGPSDRIERHSRNKIDGKWRFE 115

Query: 136 LASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGAS-NDTSENDTPVQQQDSPNENY 194
           ++SMQN+LEFLAKAA SVA + N     E  ++  +  S +D+S  D      ++     
Sbjct: 116 ISSMQNALEFLAKAAGSVAKEDN--QLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGI 173

Query: 195 LTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTM 254
           + PL     S R A+P ++K  S+RPK    LS++EFIG S  L+EEE  +L+D+FFLTM
Sbjct: 174 MAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTM 233

Query: 255 NPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKL 314
            PFFPHIPLQLQD +EL RYP+LLC+I+T+S+RYH F +    +    +  RNI VHE+L
Sbjct: 234 YPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNM--QNNRNIEVHEQL 291

Query: 315 WIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESF 374
           WIYCQ+LISQT+WAEASTRSIGT+ AF++FTEWNPRAIHWKWSDYAN+ +  D +   S 
Sbjct: 292 WIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFSI 351

Query: 375 SQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAI 434
           S    +D + LTG+AAIRRSDRMAWMLTG AVRLAQD+G  ETS+K+F ATHISE++TA+
Sbjct: 352 S----RDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAM 407

Query: 435 NMNQGLILSQSFNERNLDGID--NLNGVDNERLYLEQILQNDESKARWNGILK-LLDNEV 491
           N+ Q   L++S NE NL  I     N V NE+ YLE+IL+ND+SK RW   L  + D+  
Sbjct: 408 NVGQRSTLTESLNEINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYA 467

Query: 492 GISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXIIP--LKFTSTQKAKLELLRILIL 549
              E  L D+EREFLNDEY LYY             ++P  L+F+  Q+AK+ELLRI+ +
Sbjct: 468 HHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIITV 527

Query: 550 GYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVLSLNQRRNK 609
           G+E IY  K  Q+ +  D   NL++L++++PLIESWY +Y  LLE  EG+  +++  RNK
Sbjct: 528 GFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRNK 587

Query: 610 RKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFVEKAYIAAK 669
           R+   + R+I+ E++I +YYYCQLYIYS ALQVDV+E +LKL+EI R A +VE AY AAK
Sbjct: 588 REVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAK 647

Query: 670 EILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEANTILRLSAI 729
            +L SA R+H+LN+LK MPVRWV RIV+SVAFIVKCYLTL  + +  NP ANTIL+L+ I
Sbjct: 648 MLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVI 707

Query: 730 SVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXXXXXXXXXXXXQK 789
             ++           LKEA+PDELHLC RYS ILM LC EM+                + 
Sbjct: 708 PAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR--------------ESED 753

Query: 790 ILIENSNPDGVEGVASNFG--NVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMDEGPSLSN 847
              ++  P       + FG  N PS + P                      +D    L N
Sbjct: 754 YTTDSPTP------GTTFGQDNDPSPIQP----------------------LDTAIPLPN 785

Query: 848 NVTDWFNVGGDIGLDFVEPWTEMIEQRYLQ 877
           +V DWF+   +IGL+FVE W EMIEQRYLQ
Sbjct: 786 DVVDWFSTSDEIGLEFVESWAEMIEQRYLQ 815

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/773 (52%), Positives = 519/773 (67%), Gaps = 25/773 (3%)

Query: 15  TTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSG-- 72
           T      S   KW+R ++ACISCR +K+KCD+GPL+NPH PPC+RCRRE K CI      
Sbjct: 6   TNPESSGSNPTKWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKR 65

Query: 73  -GNGMSSANLSTM-NGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPRE 130
            GN  +   L  + NG        G+      ++  +L SQ        + +    L   
Sbjct: 66  RGNTDTEFKLGKIENG------LVGVMN--KSESEQSLLSQTRAPPPNGSTSNNLDLVDP 117

Query: 131 KWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASN--DTSENDT---PVQ 185
           KWK E+ +M N+LEFLAKAA SV+ +  P   K     +  G  N  DT+ N      + 
Sbjct: 118 KWKFEIGTMYNALEFLAKAAGSVSKEE-PIEMKSPQNRSDLGVGNMPDTALNGVMSDNIG 176

Query: 186 QQDSPNENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARE 245
             D  +E++L PLTT + S+R+A P +EK  S+RPKSS+ L D+++IGPSKLLSE+EA  
Sbjct: 177 NLDISDESFLAPLTTANGSQRAAAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSEDEATR 236

Query: 246 LIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQK 305
           LID+FFLTM+PFFPHIPLQLQD DELVRYPILLCAILTIS+RY+PF E   Y+G      
Sbjct: 237 LIDIFFLTMHPFFPHIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGEA--HN 294

Query: 306 RNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQ 365
           RNI VHE+LWIYCQRLISQT+WAEASTRSIGT+ AF++FTEWNPRAIHWKWSDYANNPE 
Sbjct: 295 RNIEVHERLWIYCQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANNPEL 354

Query: 366 YDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVAT 425
            D+TKRE+      +D +  TG+AA+RRSDRMAWML G AVRLAQD+  I+TS+K+FVAT
Sbjct: 355 NDVTKRETHGANTPRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIFVAT 414

Query: 426 HISESYTAINMNQGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARWNGILK 485
           HI+E++TA+N+NQ  ILS+S +E N + ++ L+ + NE  YLE ILQ DESK RW   L+
Sbjct: 415 HIAEAHTAMNLNQKSILSESLSEVNREVLERLDDIGNENFYLEHILQKDESKERWTNFLQ 474

Query: 486 -LLDNEVGISEEYLQDVEREFLNDEYTLYY--AXXXXXXXXXXXXIIPLKFTSTQKAKLE 542
            + +         L D+EREFLNDEY LYY  A              PLKF+  Q+AK+E
Sbjct: 475 NVSEGRRAKGTGPLTDMEREFLNDEYVLYYVNARNDASSKSSLTLPFPLKFSHPQRAKIE 534

Query: 543 LLRILILGYETIYY--EKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEV 600
           LLRIL +GYE+IYY  EK   +L++ + + NLA+L I++ LIE W+  Y+ LL       
Sbjct: 535 LLRILTIGYESIYYESEKDKTQLINGNPKRNLALLEIISTLIEKWHATYKDLLIPANATP 594

Query: 601 LSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASF 660
            SL+  RNKR   E+++QI+ E++  DY YCQLYIYSLALQ DV+   LK+ EIR+ A +
Sbjct: 595 CSLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSLALQNDVKNMDLKMPEIRKSARY 654

Query: 661 VEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEA 720
           VE AY AA+ IL+SA R+H L ML+YMPVRWV RIVR+VAF+VKCYL LT   L+ NP A
Sbjct: 655 VELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIVRAVAFLVKCYLVLTKDGLAANPVA 714

Query: 721 NTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLR 773
            TILRL+ I  +E           L+EAAPDE+HL  RYS IL +LC E+K+R
Sbjct: 715 GTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLGMRYSKILKFLCAEVKMR 767

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 25/36 (69%), Gaps = 2/36 (5%)

Query: 851 DWFNVGGDIGLDFVEPWTEMIEQRYLQS--GDVNTS 884
           D F    DIGLDFV+ WTEMIE RY+Q   G++ +S
Sbjct: 842 DLFAASDDIGLDFVDTWTEMIENRYMQDELGNIESS 877

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/919 (44%), Positives = 549/919 (59%), Gaps = 66/919 (7%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85
           KW+RS+RAC++CR RK+KCDLGPL+NPHKPPCVRC+RE + CIF        +A ++ M 
Sbjct: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMK 77

Query: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145
           G   + +   I   L      +LN         K  N  K+     W+ ++++MQ +LEF
Sbjct: 78  GSELERSI--ISSILPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDISTMQTALEF 135

Query: 146 LAKAADSVAHQSNPESFK---------ETAKLAKNGASNDTSENDTPVQQQDSPNENYLT 196
           LA A   V  +S+  S           E      +  +ND SE+ +        + N + 
Sbjct: 136 LANAV-GVISKSDTRSLLNLNQNNTLIENEDADDSNPNNDNSEDVSRSDSNTPKSRNSIF 194

Query: 197 PLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTMNP 256
            L     + +   P +    SIRPK ++ LSD+E+IGP+KLL+E+EAR LI++FFLTM+P
Sbjct: 195 SLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLINVFFLTMHP 254

Query: 257 FFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKLWI 316
           +FP+IPLQL + DELVRYPILLCAILT+SSRY+ F+E   +      + RNI VHEKLW 
Sbjct: 255 YFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEI--FINNEYEKDRNIVVHEKLWF 312

Query: 317 YCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESFSQ 376
           YCQRLIS T+WAEASTRSIGTI AF++FTEWNPRAIHW WSDY NNPE    TK    + 
Sbjct: 313 YCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNNENNM 372

Query: 377 EPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAINM 436
              K E   TG  A+R SDRMAWM TG+AVRLAQD+  I+ + K+F+ATHISE++ A+N+
Sbjct: 373 SEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFNAMNV 431

Query: 437 NQGLILSQSFNERNLD-----GIDN--------LNGVDNERLYLEQILQNDESKARWNGI 483
           NQ   LS S +  NL      G +N             NE+ YLEQIL++D+SK +W   
Sbjct: 432 NQRSTLSDSLSNINLSITRSHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSKEKWIKF 491

Query: 484 LKLLD-NEVGISEEYLQDVEREFLNDEYTLYYAXXX--------XXXXXXXXXIIPLKFT 534
           LK ++ N+   +   + D ERE+LNDEY LYY                       PLKF 
Sbjct: 492 LKEINSNKSSENSTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTSTSLPYPLKFA 551

Query: 535 STQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLE 594
           S  KAK+E+LRI+ + YETIY  K  + L   +QR NLAVL+I +PLIESWY+N+  LL+
Sbjct: 552 SFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLK 611

Query: 595 IREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEI 654
           + E     +++ ++K    ++S+ I  E++I DYYYCQLYIYSLAL+VD+++N L L+EI
Sbjct: 612 LFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNNLNLSEI 671

Query: 655 RRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDL 714
            + A +V  AY AAKEIL SA RV+KL +L+Y+PVRWV RI+RSVAFIVKC+L LT S+ 
Sbjct: 672 TKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFLLLTESET 731

Query: 715 STNPEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRD 774
           S N E N I+RLS I VDE           L +A+PDELHLC RYS+IL+Y+C+E++ + 
Sbjct: 732 SENSEINAIIRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCKELRNKT 791

Query: 775 KXXXXXXXXXXXXQKILIENSNPDGVEGVASNFGNVPSTLP------PSYAQKSTTKEQL 828
           +            +   ++  N   +E ++S   +     P      P       T EQ+
Sbjct: 792 QNLYMNEGVAAKQENADVKVGN-KSLENLSSIENSQEPIEPFIMNEHPQTELPINTTEQI 850

Query: 829 SDDG-------------AHSMSFMDEGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRY 875
           +  G              +SMSF  E       V DWF+   DIGL+FVE WTEMIEQ Y
Sbjct: 851 AIVGNEHHGIEQTPILNPNSMSFQGE-------VIDWFSSSADIGLEFVESWTEMIEQMY 903

Query: 876 LQS--GDVNTSFEELYRQL 892
           L+S  GD N     L+  +
Sbjct: 904 LRSSDGDQNIHVNSLFGHM 922

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/972 (43%), Positives = 567/972 (58%), Gaps = 106/972 (10%)

Query: 1   MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
           M+S  NE        TA K+ +    ++R ++AC++C+MRKVKCDLGP +NPH PPCVRC
Sbjct: 1   MVSNGNE------SQTAPKKQT----FKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRC 50

Query: 61  RREGKTCIFS-SGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKK 119
           +RE + C+F+ +   G   A  S ++ K   A  +      SV    TL  +  T   + 
Sbjct: 51  KRESRECMFTETKRGGFRVAKQSLVSLKEESAGKSMADVITSVIQGQTLKKELDTDLDRL 110

Query: 120 TENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSE 179
             +T   +       +  ++QN+  FLAKAA SVA +   +      K  +   ++  S 
Sbjct: 111 QTHTKDDI---SINTDPPTLQNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIEPTDAVSR 167

Query: 180 NDT--------------PVQQQDSPNENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQT 225
             +              P        ++Y+T    P   +   +P +EK  S+RPK S  
Sbjct: 168 QPSVSSYGNKQATGSMEPSSIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPSMK 227

Query: 226 LSDMEFIGPSKLLSEEEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTIS 285
           L D+E+IGP +LL+E EAR+ ID FFLTM+PF P+IPLQLQDADEL RYP+LLC ILTIS
Sbjct: 228 LGDIEYIGPYQLLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTIS 287

Query: 286 SRYHPFDEFDGYNGTPGRQKRNIHV--HEKLWIYCQRLISQTVWAEASTRSIGTIFAFII 343
           +RYH   +  G N         +HV  HE+LWIYCQRL+SQTVWAEASTRSIGTI AF+I
Sbjct: 288 ARYHTLHDL-GLNEI----DNTVHVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLI 342

Query: 344 FTEWNPRAIHWKWSDYANNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTG 403
           FTEWNPRAIHWK SDYAN P+  D+ KR S      +  D LTG+AA+RRSDRM+W+LTG
Sbjct: 343 FTEWNPRAIHWKGSDYANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTG 402

Query: 404 TAVRLAQDIGAIETSAKVFVATHISESYTAINMNQGLILSQSFNERNLDGIDNLNGVDNE 463
            AVRLAQD+  IE S+K+FV THI E++TA+N+N+   LS+S +E  L+G ++ N +DNE
Sbjct: 403 NAVRLAQDLNVIEFSSKIFVMTHICETHTAMNLNKRSSLSESLSEVRLNGFED-NDLDNE 461

Query: 464 RLYLEQILQNDESKARWNGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXX 523
           + +LE+ILQND+SK RW   L+ +       +  L D+EREFLNDEY LY+         
Sbjct: 462 QFFLERILQNDKSKERWARFLERVGERS--KKGSLTDIEREFLNDEYLLYHYNTENPNTQ 519

Query: 524 XXXXIIPLKFTSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIE 583
                  LKF+  Q+ K+ELL+I+ LGYE +Y    + +L S D+   L++L++L+PLIE
Sbjct: 520 SDPE-FRLKFSKIQRGKVELLKIVSLGYENVY----NGKLSSHDRHQRLSMLSVLSPLIE 574

Query: 584 SWYNNYRSLLEIREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVD 643
            WYN Y+SLL    G   S+ +  NK   FEM+ ++  E++ISDYYYCQLYIYSLALQ D
Sbjct: 575 GWYNIYKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWD 634

Query: 644 VEE---NKLKLNEIRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVA 700
            ++   +KL+LNEI + A +VE AY AAKEIL SA RVHKL MLKYMPVRWV+RIVRS+ 
Sbjct: 635 HQDTSTSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIV 694

Query: 701 FIVKCYLTLTCSDLSTNPEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYS 760
           F++KCYLTLT + ++ NPEANTIL +S +  DE           L+ AAPDELHLC+RYS
Sbjct: 695 FMIKCYLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYS 754

Query: 761 AILMYLCREMKLRDKXXXXXXXXXXXXQKILIENSNPDGVEGVASN-------------- 806
            ILMYLC EMK R K               L + SN    E VA N              
Sbjct: 755 TILMYLCTEMKHRCKPNMQPPVPRSISNDYLDKTSNRS--ENVADNSARHFSVGGYQVSD 812

Query: 807 FGNVPSTL-----------PPSYAQKSTTK-EQLSDD--------GAHSM---------- 836
             NV S+               Y Q+ TT  EQ   D        G  S+          
Sbjct: 813 TANVSSSPFINKGTNVRFGSTEYKQQETTNDEQQRPDTFTVDSALGVASINSAPPAPVPE 872

Query: 837 --------SFMDEGPS-----LSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDVNT 883
                   S ++ GP+     L   + DWFN   +IGLDFV PWTEM+E++++   D ++
Sbjct: 873 PAPDTNPASAINTGPNSSGGYLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVD-DS 931

Query: 884 SFEELYRQLCEP 895
           S+E  +     P
Sbjct: 932 SYENWFNDFYTP 943

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/931 (44%), Positives = 548/931 (58%), Gaps = 85/931 (9%)

Query: 27  WQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS-GGNGMSSANLSTMN 85
           W R F+AC +CR++KV+CD GP +NPH PPC RC+RE K C F++  G           N
Sbjct: 19  WIRGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGKEQDMVTGEATN 78

Query: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145
           G     T    K  L++ A +   S        ++E   +  P   WKLEL SM N+L F
Sbjct: 79  GIPTVDTVPVKKNELALPALAVTVSPGLIQN--RSEMGNEANPNTGWKLELTSMHNTLAF 136

Query: 146 LAKAADSVAHQSNPESFKETAKLAKNGASNDTSE--NDTPVQQQDSPNENYLTPLTTPHN 203
           LA+AA +V++  N    K+T    ++  S + S   + TP     S        L  P N
Sbjct: 137 LAQAAGTVSNTLNKGLMKKTLPSDRSTPSLEISRLGSKTPTGFASSLG------LGMPSN 190

Query: 204 SRRSALPQLE---------KSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTM 254
             ++ L ++E         KS + + K  +TL D++ IG + LLSE+EA   ID FF TM
Sbjct: 191 PTKTLLQEIETQNKVQLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFIDAFFCTM 250

Query: 255 NPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKL 314
           +PFFP+IPLQLQD  EL+ YPILLCAILTIS+RYH F EF   NG     KRN  VHEKL
Sbjct: 251 HPFFPYIPLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNG--DYNKRNFEVHEKL 308

Query: 315 WIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESF 374
           W  CQ ++S+T+W EASTRSIGT+ AFI+FTEWNPR IHWK SDYAN+ +       E+ 
Sbjct: 309 WDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDD-------EAV 361

Query: 375 SQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAI 434
           S+  N + + LTG  AIRRSDRMAWMLTG+AVRLAQD+G +ET+AKV VATHIS+++ ++
Sbjct: 362 SELSNDEAEELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVATHISDAFASM 421

Query: 435 NMNQGLILSQSFN----ERNLDGIDNLNGVDN-------ERLYLEQILQNDESKARWNGI 483
           NMNQ  +LS +FN      N    D LN   +       E+ +++Q+L+N  S  RW  I
Sbjct: 422 NMNQKPVLSGNFNVLQGGTNNYTSDPLNSSGSSHESTCSEQAFMKQMLENTNSHTRWRHI 481

Query: 484 LKLLDNEVGISE---EY---LQDVEREFLNDEYTLYYAXXXXXXXXXXXXIIPLKFTSTQ 537
           L  L  E        EY   L D+EREFLNDE+ LYY+              PL+F+  Q
Sbjct: 482 LSSLQMEDLFQRQRNEYSNDLSDLEREFLNDEFILYYSLERRSDNQETPPF-PLQFSYAQ 540

Query: 538 KAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIRE 597
           KAK+EL  I++LGY+TIYY++G ++L S +Q HNL+VL+IL+PL+E W+N Y++LL    
Sbjct: 541 KAKIELTNIMLLGYDTIYYDRGRKKLASNNQLHNLSVLSILSPLMEGWHNVYKNLLIAPS 600

Query: 598 GEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRC 657
               +   R +KR  +E+S+ I++E++I DY Y QLYIYSLALQ D +  +L ++EI + 
Sbjct: 601 ANPYTTTTRGDKRAMYELSKNIDSESIICDYRYSQLYIYSLALQADFKRAELTVSEITQN 660

Query: 658 ASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDL--- 714
           A +VE A+ AAKEI+ SA RVHKLN+LKYMPVRWV+R+VR+V+F+VKC L L  + +   
Sbjct: 661 AKYVEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRAVSFLVKCCLILNATSIGGG 720

Query: 715 -STNPEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLR 773
            S+  E  TIL+L +ISV +           LKEA PDELHL  RYSAIL+YLCRE++  
Sbjct: 721 GSSEAEVRTILKLCSISVKDTANTIKMAAMTLKEATPDELHLSMRYSAILLYLCRELESE 780

Query: 774 DKXXXXXXXXXXXXQKILI----ENSNPDGVEGVASNFGNVPS-------TLPPSYAQKS 822
                          K  I    E  + +   G A    N          T+P S   ++
Sbjct: 781 KDSSKKIPFPNNATTKYAISPTYEGRDGEIAAGSAGGCANTAHITANRLRTVPLSDINET 840

Query: 823 TTKE------------QLSDD----------GAHSMSFMDE-GPSLSNNVTDWFNVGGDI 859
           T +              L+ D          GA S S  D    SL + VT+WF+   +I
Sbjct: 841 TGRNTEDTANNNIVNGSLNGDRNHLGTTEGTGAASQSTTDRLTGSLPDEVTNWFSGNAEI 900

Query: 860 GLDFVEPWTEMIEQRYLQSGDVNTSFEELYR 890
           GL+FVEPWT+MIEQR+LQSG  N  FEELY+
Sbjct: 901 GLEFVEPWTDMIEQRFLQSGTGNDVFEELYQ 931

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/888 (43%), Positives = 528/888 (59%), Gaps = 78/888 (8%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF----SSGGNGMSSANL 81
           K++R ++AC++CR RK +CDLGP ++P  PPCVRC+RE K C+F      GG       +
Sbjct: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75

Query: 82  STMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQN 141
                 N  A F    + + V   +TL     TT IK+   T           EL SM N
Sbjct: 76  DGNTDVNATARFEAEDKYIPV---ATLKD---TTSIKEGSLT----------PELNSMHN 119

Query: 142 SLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQQDSPNENYLTPLTTP 201
           +LEFLAKAA S A + +        +        D +  +    +++SPN++        
Sbjct: 120 ALEFLAKAAGSAAKEDSRSRIPSYER-------QDKTIREKTYHREESPNQH-------A 165

Query: 202 HNSRRSALPQ----LEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTMNPF 257
             S+R++L      +EK    +P S   L D+E+IG  KLL+E+EA  LIDLFFL M+PF
Sbjct: 166 SGSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPF 225

Query: 258 FPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKLWIY 317
           FP+IP QL+ + EL RYPILLCAILTIS+RYH F E     G   R  RNI VH++LWIY
Sbjct: 226 FPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGE--RSSRNIEVHDRLWIY 283

Query: 318 CQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESFSQE 377
           CQRLISQ+VWAEASTRS+GTI AF++FTEWNPRAIHW W+DYAN+    D+++R+  S+ 
Sbjct: 284 CQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEA 343

Query: 378 PNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAINMN 437
              D   LTG+ A+RRSDRMAWMLTGTAVRLAQD+G +  S K+F A HI+E+ TA+NMN
Sbjct: 344 KRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMN 403

Query: 438 QGLILSQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKARWNGILKLLDNEVGISEEY 497
           Q  ILSQS  E +L+G D  +G+ +    +E+I +N++SK RW    +  D+  G S  +
Sbjct: 404 QRSILSQSLAEVSLNGHDGDSGLSSA--CIEEIFRNEDSKRRWKSYTQQRDSVEGKSVGF 461

Query: 498 LQDVEREFLNDEYTLYY----------AXXXXXXXXXXXXIIPLKFTSTQKAKLELLRIL 547
             D E+EFL DEY  ++          +               L FT  Q+AK+ELLRI+
Sbjct: 462 C-DNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIM 520

Query: 548 ILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVLSLNQRR 607
            +GYE IYY+  D +L   D +H LAVL ILAP+I+ W+N Y+ LL    G      +  
Sbjct: 521 SIGYEAIYYK--DTKLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDE 578

Query: 608 NKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDV---EENKLKLNEIRRCASFVEKA 664
           NK   ++   +I++E++ISDY+YCQLYIYSLALQ++    ++ K  +NE+ + A +VE A
Sbjct: 579 NKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELA 638

Query: 665 YIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEANTIL 724
           Y AAKE+L SA RVHKL  LKYMPVRW  RI+R+VAF+V+CY+TLT S L ++P A TIL
Sbjct: 639 YNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTLTGSGLGSDPRATTIL 698

Query: 725 RLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLRDKXXXXXXXXX 784
            +  IS +E           L+EA+PDELHLC+R+S +LM+LC EMK +           
Sbjct: 699 AVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQH--------- 749

Query: 785 XXXQKILIENSNPDGVEGVASNFGNVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMDEGPS 844
              Q   +  S+   +         +P+T   +YA         + D A         PS
Sbjct: 750 SEPQNSELRRSSSHSLHNPTDAPARMPTTPAENYA---------ATDFAIPAFLETPHPS 800

Query: 845 -LSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDVNTSFEELYRQ 891
            L + + DWF    D+GLDFVEPW EM+EQ+++ + D N +FE LY +
Sbjct: 801 HLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFI-NNDKNMTFENLYNE 847

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/899 (43%), Positives = 546/899 (60%), Gaps = 71/899 (7%)

Query: 14  GTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGG 73
           G+ +++ SS+  KW+RSFRAC +CR RK+KC+LGPL+NPHKPPC RC+RE + CIF    
Sbjct: 2   GSKSNRTSSK--KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPS 59

Query: 74  NGMSSANLSTMN----GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPR 129
               S +   +N    G +N+  F   ++  +  AN+           K+ +N    L  
Sbjct: 60  RKSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANN-----------KEIQNM--ALED 106

Query: 130 EKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAK--NGASNDTSENDTPVQQQ 187
             W+ +++SMQN+LE+LA AA SV   S  E+ K T+KL+   N  S D           
Sbjct: 107 SAWESDVSSMQNALEYLASAAKSV---SQFENHKPTSKLSDMVNSYSKD----------- 152

Query: 188 DSPNENYLTPL---TTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEAR 244
           D   EN +  L   T   N   S + QL +   IR K  + LSD+ +IG  KLL+EEEAR
Sbjct: 153 DMTQENIIKELFEKTELKNPASSLIAQLSR---IRTKPHKKLSDIVYIGDDKLLTEEEAR 209

Query: 245 ELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQ 304
            LI++FF  ++PFFP+IPLQL + ++LVRYPILLCA++TIS+RY+ F + D    T    
Sbjct: 210 RLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDL--KTRESP 267

Query: 305 KRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPE 364
             NI +HEKLW+YCQRLIS+T+WAEASTRSIGTI AF++FTEWNPRAIHW WSDYAN+ E
Sbjct: 268 DYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSE 327

Query: 365 QYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVA 424
             +  +   F    +   + +TG  A+R SDRMAWMLTG+AVRLAQD+  I+TS K+F+A
Sbjct: 328 TINFNELNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLA 387

Query: 425 THISESYTAINMNQGLILSQ-----SFNERNLDGIDNLNG------VDNERLYLEQILQN 473
           THI+E+Y A+N+N    LS+     + + + +D +  ++G        NE+ YLEQI +N
Sbjct: 388 THIAETYNAMNVNLRSSLSESLSNVNIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKN 447

Query: 474 DESKARWNGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYAXXXXXXXXXXXXIIPLKF 533
            + +     +L+ +  E   ++ +  D ER+FLNDEY L+Y+              PL F
Sbjct: 448 AKDRESSYDLLENILRERRNAKAF-PDNERDFLNDEYILFYSNPDDATQNDELD-TPLDF 505

Query: 534 TSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLL 593
           T  Q+AK+ELL+I+ +GYETIY EKG +   + +Q+ NLA+LNI + LI+SWY NY  LL
Sbjct: 506 TVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELL 565

Query: 594 EIREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNE 653
              E     LN  +   ++  M++ I  E++I DYYYCQLYIYSL+LQV+ EE+KLKL E
Sbjct: 566 SPEETLDPVLNASKMGLQS--MTQIIENESLICDYYYCQLYIYSLSLQVEDEESKLKLKE 623

Query: 654 IRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSD 713
           + + A +V  AY +AKEIL SA R+ ++ MLK++PVRWV+RIVR+++FIVKCY+T T  D
Sbjct: 624 LSQSAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKD 683

Query: 714 LSTNPEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLR 773
                E N++L LS I VDE           LKE+ PDELHLCTRYS IL+ L RE+K+ 
Sbjct: 684 SMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMD 743

Query: 774 DKXXXXXXXXXXXXQKILIENSNPDGVE---GVASNFGNVPSTLPPSYAQKSTTKEQLSD 830
                         +++  + +  + +       SN G+     P S   K  T     +
Sbjct: 744 TLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNSGSQVELTPLS--NKLATLPIDRN 801

Query: 831 DGAHSMSFMDEGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDV-NTSFEEL 888
                 SF  E       V DWF+   DIGL+FVEPWTEMIEQRY++SG+  N  F++L
Sbjct: 802 TTPPYASFPTE-------VVDWFSTSADIGLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/934 (40%), Positives = 540/934 (57%), Gaps = 95/934 (10%)

Query: 21  SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSG-------G 73
           SS+  K + +F AC+ C+ +K+KCDLGP + P  PPC  CRR    C F++        G
Sbjct: 25  SSQGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLG 84

Query: 74  NGMSSANLS------------------------TMNGK-----NNQATFTGIKRA--LSV 102
           N + S  L                          MNG      NN +   G+K      V
Sbjct: 85  NILDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGV 144

Query: 103 DANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESF 162
             NS   +        K++          WKLEL SMQ++LEFLAKA        N E F
Sbjct: 145 SLNSPNTALIEACDRVKSDTA--------WKLELTSMQSALEFLAKATKLRNDYKNNEPF 196

Query: 163 KETAKLAKNGASNDTSENDTPVQQQDSPNE-NYLTPLTTPHNSRRSALPQLEKSISIRPK 221
             T    ++ A++ TSE    + ++D+ NE +  T  T+   S RS+ P +E   +I+P+
Sbjct: 197 GST----RSDAASTTSET-RDLSEKDNGNESDSTTNSTSKDTSTRSSYPSIE---AIKPE 248

Query: 222 -SSQTLSDMEFIGPSKLLSEEEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCA 280
             + +  + + +G  KL++ +EAR L+++FF  M+PF+P+IPL LQD DEL +YP+LL  
Sbjct: 249 VPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHC 308

Query: 281 ILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFA 340
           IL IS+RY+PFD+    NG  G   RN+ +H KLW +CQ+L+SQTVW++ASTRSIGT  A
Sbjct: 309 ILAISARYNPFDKVGFDNGIEGN--RNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLA 366

Query: 341 FIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWM 400
           F++FTEWNPRAIHW+ SD A     Y      S S+E   D DGL GIA ++RSDRMAWM
Sbjct: 367 FLLFTEWNPRAIHWEVSDTA----HYLSDNNVSSSKE---DPDGLGGIATVKRSDRMAWM 419

Query: 401 LTGTAVRLAQDIGAIETSAKVFVATHISESYTAINMNQGLILSQSF-------NERNLDG 453
            TGTA+RLAQ++  +E +AK++ A +I+E   A NMN    L +S         E  +D 
Sbjct: 420 FTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDN 479

Query: 454 IDNLNGVDNERL--YLEQILQNDESKARWNGILKLLDNEVGISEEYLQDVEREFLNDEYT 511
             + + ++NE L  +++ + QN ES  +W       D     + + + D+E EFLNDEY+
Sbjct: 480 PKSQDDIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYS 539

Query: 512 LYYAXXXXXXXXXXXXIIPLKFTSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHN 571
           + Y               P+ +T+ QKA+LELLRI+ + Y+TIYYEK  +R+ S DQ+ N
Sbjct: 540 INYLDENSSFLKN-----PIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKN 594

Query: 572 LAVLNILAPLIESWYNNYRSLLEIREGE---VLSLNQRRNKRKAFEMSRQINTETMISDY 628
           L +L++L+P++ +WY NY  L++    E   ++SL+        F+ +  I  E+ ISDY
Sbjct: 595 LMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDL----SKFKRTANIRGESFISDY 650

Query: 629 YYCQLYIYSLALQVDVEENKLKLNEIRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMP 688
           YYCQLY +SLALQV+V+E+KL LNE+ + A FVE+AY AAKEIL+SA RVHK++MLKYMP
Sbjct: 651 YYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMP 710

Query: 689 VRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEANTILRLSAISVDEXXXXXXXXXXXLKEA 748
           VRWV+RIVRS +FIVKCY+TL    ++TN EA +IL+LS I VD+           LKE+
Sbjct: 711 VRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKES 770

Query: 749 APDELHLCTRYSAILMYLCREMKLRDKXXXXXXXXXXXXQKILIENSNPDGVEGVASNFG 808
            PDELHL +++S ILM+LC+E+  R +                +E+         ASN  
Sbjct: 771 TPDELHLASKFSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLEASNHD 830

Query: 809 NVPSTL--PPSYAQKS--TTKEQLSDD----GAHSMSFMDEGPS-LSNNVTDWFNVGGDI 859
            + S    PPS    S  TT +  ++     G +S+  + +  + L  +V DWF+   +I
Sbjct: 831 TISSDAQEPPSENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNI 890

Query: 860 GLDFVEPWTEMIEQRYLQSGDVNTSFEELYRQLC 893
           GLDFVEPWTE+IEQ+Y+Q+ D    F++L+ +  
Sbjct: 891 GLDFVEPWTELIEQKYIQNKDGFQDFDQLFDEFA 924

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/811 (41%), Positives = 482/811 (59%), Gaps = 71/811 (8%)

Query: 19  KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSS 78
           K   + ++W+RS++ACI+CR++KVKCDLGPLENPH PPCVRC+RE + CIF      + +
Sbjct: 16  KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75

Query: 79  ANLSTMNGKNNQAT----------FTGI--KRALSVDA-------NSTLNSQYHTTKIKK 119
                 +  +NQ             T I  +R  S+ A       N   NSQ H  K K 
Sbjct: 76  VENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKP 135

Query: 120 TENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSE 179
           +E       +   K+   +M+N+LEFLA AA   A +   E  +E     +   ++D   
Sbjct: 136 SER------KSNLKVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFEKELNDDHIS 189

Query: 180 NDTPVQQQ----------DSPNENYLTPLTTPHNSRRSALPQL-EKSISIRPKSSQTLSD 228
            D+P  Q           D  +E+  +   + + + R  +  L E  I+ RP S++ L+D
Sbjct: 190 IDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTD 249

Query: 229 MEFIGPSKLLSEEEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRY 288
            ++IG SK++SE EA +LI+ FFLTM+PF+P++P QLQD  EL RYPILLC ILTISSR+
Sbjct: 250 YDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRH 309

Query: 289 HPFDEFDGYNGTPGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWN 348
           H F+E   YNG     KR+I VHEKLW+YCQ++ISQTVWAEASTRS+GT+ AF++FTEWN
Sbjct: 310 HKFNELGTYNGV--NDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWN 367

Query: 349 PRAIHWKWSDYANNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRL 408
           PRAIHWKW+DYANNP+  D +  ++   +  K     TG+ AIRRSDRMAWML GT+VR+
Sbjct: 368 PRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRI 427

Query: 409 AQDIGAIETSAKVFVATHISESYTAINMNQGLILSQSFNE-----------RNLDGIDNL 457
           AQD+G IE S+ VFVATH SE++ A+N+ Q   L++S N+           RN       
Sbjct: 428 AQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRN----KQQ 483

Query: 458 NGVDNERLYLEQILQND---ESKARWNGILKL-LDNEVGISEEY-LQDVEREFLNDEYTL 512
             + NE  Y+E I   +     +  W   L+  ++N++ I ++  L D  R FLNDE+ L
Sbjct: 484 QTLKNEIFYIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALSDKVRGFLNDEFAL 543

Query: 513 YYAXXXXXX----------XXXXXXIIPLKFTSTQKAKLELLRILILGYETIYYEKGDQR 562
           +Y+                       +P+  + +Q+A +ELLRI    Y+TIY    +Q+
Sbjct: 544 FYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRNQNQK 603

Query: 563 LVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIRE-GEVLSLNQRRNKRKAFEMSRQINT 621
           L S +Q HN+++L+I APL+ +W   +  LL+  +  E ++LN R NKR   E ++ I  
Sbjct: 604 LSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNRNNKRVVKEFNKIIEG 663

Query: 622 ETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFVEKAYIAAKEILESAGRVHKL 681
           E++I DY YCQLYI+SLALQ+ ++   L +NEI + ++++  AY +AKE + S  RV  L
Sbjct: 664 ESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTL 723

Query: 682 NMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSD--LSTNPEANTILRLSAISVDEXXXXXX 739
            MLKYMPVRW+ R++R+ AF+VKCYL++  +D  L++  E N I +L   S +E      
Sbjct: 724 KMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIK 783

Query: 740 XXXXXLKEAAPDELHLCTRYSAILMYLCREM 770
                L  ++PDELHLC+RYS+I+M   +EM
Sbjct: 784 KSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 802  GVASNFGNVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMDEGPSLSNNVTDWFNVGGDIGL 861
            G +S+ G      P +    S    + S +  H+    +   S +N   DWF+  GDIGL
Sbjct: 940  GTSSDLG------PTNRDLLSYNTRETSPNTGHTGVTGEPTGSHANEFLDWFSASGDIGL 993

Query: 862  DFVEPWTEMIEQRYLQSGD 880
            +FVE WTEM+EQRY++  D
Sbjct: 994  EFVESWTEMLEQRYMKDDD 1012

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/968 (37%), Positives = 512/968 (52%), Gaps = 131/968 (13%)

Query: 16  TASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS---- 71
           T S  +    KW+R ++AC++CR RKV+CDLGP++ P +PPCVRC RE K CIF+     
Sbjct: 14  TQSSNAGSGRKWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRG 73

Query: 72  ------------GGNGMSSANLSTMNGKNNQAT----FTGIKRALSVDANSTLNSQYHTT 115
                        G+      +   N   + ++    F+G   ALS  ++ + +S  +  
Sbjct: 74  RNRRIRVAKNDRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSASNRG 133

Query: 116 KIKKTENT----YKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKN 171
           +  ++ N+    +   P      E  ++ N+LEFL KAA SVA + N      +  + K+
Sbjct: 134 RDDQSSNSDEPEFSERPELSLSSEFTTLHNTLEFLTKAAGSVA-KDNGRLLSSSTAVGKH 192

Query: 172 GASNDTSENDTPVQQQDSPNENYLTPLTTPHN-------SRRSALPQLEKSISIRPKSSQ 224
            A+    E+ T        N  Y + ++ P N       +  S  PQ E   +  P    
Sbjct: 193 SAA--ICESITLQLYNPLHNGQYASVVSGPRNPEAITDQAAASRTPQEEPESTKYP---- 246

Query: 225 TLSDMEFIGPSKLLSEEEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTI 284
            L ++E++GP+  L+ EE   L +LFF+T  PFFPHIPL +QD +EL RYPILLC +L+I
Sbjct: 247 LLRNIEYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLSI 306

Query: 285 SSRYHPFDEFDGYNGTPGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIF 344
           S+RYH F++    N   G   RNI VHE LW YCQ++ISQTVW EASTRSIGT+  F+IF
Sbjct: 307 SARYHKFEDIGLSNR--GSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIF 364

Query: 345 TEWNPRAIHWKWSDYANNPEQYDMTKRESFSQEPNK--------------------DEDG 384
           TEWNPRAIH K +DYAN     D    +S S++ N                      + G
Sbjct: 365 TEWNPRAIHRKCNDYAN---ATDRQNEQSHSEKANTAHCGSGIPATERNGPRRFVLADQG 421

Query: 385 LTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAINMNQGLILSQ 444
            +G++A+RRS RMAWML G AVRLAQD+  I TS+K+FVATH SE+  A+NM Q   LS 
Sbjct: 422 SSGLSAMRRSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTLSH 481

Query: 445 SFNERNLDGIDNLNGVDNERLYLEQILQNDESKARWNGILKLLDNEV----GISEEYLQD 500
           S    N+ G ++   + N  +         E++ R+  +L+ L   V    G+S+ Y   
Sbjct: 482 SLMNANIIGSESSTAISNPPM-------PSETEERYKSVLQRLGKHVPRGRGLSQLY--- 531

Query: 501 VEREFLNDEYTLY-------YAXXXXXXXXXXXXIIPLK----------------FTSTQ 537
              EFL DE  LY       Y              + ++                 +  Q
Sbjct: 532 --NEFLEDERILYGLGGGSEYVEAYCDSLDQTKNNVSIETAYESSLLERGGQQVFLSFAQ 589

Query: 538 KAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIRE 597
           +AK+ELLRI+ +GYETIY      +LV  ++ H L+VL +L+P IE+WY  Y SLL    
Sbjct: 590 RAKIELLRIMSVGYETIY--SNHAKLVLREKHHILSVLGLLSPQIENWYTQYNSLLVPAG 647

Query: 598 GEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEE----NKLKLNE 653
           G   +     ++    ++ R+I+ E++I DYYYCQLYIYSLAL VD  +    N   L+ 
Sbjct: 648 GAPFNPTADFSRINPLDLVRRIDAESIICDYYYCQLYIYSLALTVDFRKPRHPNASWLDR 707

Query: 654 IRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSD 713
           + + A +VE AY AA+E+L SA RVH++ MLKYMP RWV RIV +VAFIVKCYLT+  + 
Sbjct: 708 LMKSARYVELAYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIVKCYLTMA-AH 766

Query: 714 LSTNPEANTILRLSAISVDEXXXXXXXXXXXLKEAAPDELHLCTRYSAILMYLCREMKLR 773
           L+ + EA+ IL LSAI  DE           L+EA+PD++HLC +YS ILMYLC EMKLR
Sbjct: 767 LTASHEASAILTLSAIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTILMYLCSEMKLR 826

Query: 774 DKXXXXXXXXXXXXQKILIENSNPDGVEGVASNFGNVPSTLPPSYAQKSTT-----KEQL 828
           +             + +  E       E  A+    + S  PP +  +S T        L
Sbjct: 827 N----WPTPTPPLPRSVSGEPIRVPVFECSATPAARIFS--PPHHPAESQTTGGTDPPPL 880

Query: 829 SDDGAHSMSFMDEGPS-------LSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDV 881
            D   H+++     P+       L   + DW +   +IGLDFVEPWT++IE R ++SG  
Sbjct: 881 PD---HTLAAPSSDPAPFDTTSHLPWELIDWLHTSDEIGLDFVEPWTDVIE-RLMESGPD 936

Query: 882 NTSFEELY 889
           N     LY
Sbjct: 937 NIDTNSLY 944

>CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly
           similar to uniprot|Q06639 Saccharomyces cerevisiae
           YDR303c RSC3 or uniprot|P38781 Saccharomyces cerevisiae
           YHR056c
          Length = 834

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 67/134 (50%), Gaps = 9/134 (6%)

Query: 33  ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMNGKNNQAT 92
           AC  CR RK+ CD G      KP C  C ++GKT  F     G +SA+ +++NG+  Q  
Sbjct: 15  ACQQCRRRKIGCDRG------KPICGNCLKQGKTDCFYPKVPGGASADYTSLNGQVGQLP 68

Query: 93  FTGIKRALSVDANSTLNSQYHTTKIKKTEN-TYKRLPREKWKLE-LASMQNSLE-FLAKA 149
               K   +VD +S      +   I   EN +++RL  E   +E L   Q +L+ F A  
Sbjct: 69  TDFTKAKFTVDKSSKSKQSGYKNSILPGENGSHRRLELELSTVEKLREYQTALQLFNAHN 128

Query: 150 ADSVAHQSNPESFK 163
            DS+A  S+ +++K
Sbjct: 129 PDSLATSSSYDNYK 142

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 8   RAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
            +I  AGT A+  SS   K  ++ RAC  CR +K+KCD     +  K  C  C+R G+ C
Sbjct: 49  HSISAAGTNAASNSSSQKKRTKASRACDQCRKKKIKCDF----SEEKTLCSNCQRNGEKC 104

Query: 68  IF 69
            F
Sbjct: 105 TF 106

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
           Ashbya gossypii AAL175W
          Length = 908

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 37/78 (47%), Gaps = 19/78 (24%)

Query: 29  RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI-------------FSSGGNG 75
           ++F  C +CR+RKVKCDLG      KP C RC + G +C              F S GN 
Sbjct: 41  KTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSCGGYDIKLRWSNPIRFDSYGNQ 94

Query: 76  MSSANLSTMNGKNNQATF 93
           ++S N    +G   Q  F
Sbjct: 95  VTSGNDKDGDGDRQQQPF 112

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 10  IDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +D+A      RS      + +F AC+SC   KVKC    L++ ++ PC RC + GK C F
Sbjct: 99  LDDARVQKPTRSEGGSSKRNTF-ACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTF 157

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 16/105 (15%)

Query: 14  GTTASKRS--SRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS 71
           GT   K S   + ++ QR    CI+C+ +K++CD        +P C RCRR G+ C++ S
Sbjct: 9   GTHQYKMSLQQKSLRRQRRSHVCITCKNQKLRCD------RERPSCSRCRRIGRDCVYES 62

Query: 72  GGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTK 116
                +  N    +G    +  +GI    S D +   N ++H  K
Sbjct: 63  PTPEETMTN----HGNKELSVTSGI----STDGSLENNDEFHNEK 99

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 13/67 (19%)

Query: 3  SASNERAID--EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
          +A N+ A+   E   TA +R        ++F  C +CR+RKVKCDLG      KP C RC
Sbjct: 16 AARNDEALQKKEGSGTAVRRPR-----AKTFTGCWTCRLRKVKCDLG------KPSCQRC 64

Query: 61 RREGKTC 67
           + G  C
Sbjct: 65 EKSGLDC 71

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 17 ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          +S    ++++  ++F  C +CR RKVKCDLG      KP C RC + G  C
Sbjct: 6  SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa]
          {ON} similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%)

Query: 15 TTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          T  SK ++ D K +RS  ACISC   K KC+     + ++ PC+RC +  K C F
Sbjct: 45 TPMSKETNADGKVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQF 99

>Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106W
           (RDS1) - transcriptional regulator [contig 139] FULL
          Length = 827

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 33  ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMNGKNNQAT 92
            C+ CR RK+KCD        +P C RC++   TC +++ GN    + L       + + 
Sbjct: 14  VCLECRNRKLKCDKA------RPKCTRCKQNLLTCSYANDGNSPGGSKLYVDKAFPHSSE 67

Query: 93  FTGIKRALSVDANSTLNSQYHTTKIK 118
           F G + + S   N T    Y  + I+
Sbjct: 68  FLGTQHSESSSTNETRVPSYSNSPIE 93

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 6/46 (13%)

Query: 22 SRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          +++++  ++F  C +CR RKVKCDLG      KP C RC + G  C
Sbjct: 11 AKEVRRVKTFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {ON} 
          Length = 860

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 114/287 (39%), Gaps = 76/287 (26%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF-SSGGNGMSSANLSTMNG 86
           QR    C+ CR RK+KCD        +P C RC+++GK C + S   + ++  + S+ + 
Sbjct: 9   QRPSYVCLECRSRKLKCD------KARPYCNRCKKDGKVCAYESENASQITIPDDSSNHT 62

Query: 87  KNNQATFTGIKRALSVDANSTLNS----QYHTTKIKKTENTYKRLPREKWKLELASMQNS 142
                +FT I    S D NS ++S     +H+  +  T         E +K +  ++   
Sbjct: 63  LKLSTSFTDI----STDGNSNIDSGSTLTFHSHNLGNTV-----FDLEYFKHKNITIDIR 113

Query: 143 LEFLAKAADSVAH----------------QSNPE-----SFKETAKLAK-----NGASND 176
           L+ L      V +                Q +P      +F   + +A      NG SND
Sbjct: 114 LDLLKPRDTYVTYGSTTYYDMPLSCHSMIQHDPYKRVLCAFLHGSTMADLQYRLNGISND 173

Query: 177 TSENDTPVQQQDSP--------------NENYLT---PL---TTPHNSRRSALPQLEKSI 216
           T  ++  +  Q SP              + NY+T   PL    T +    +  P L  SI
Sbjct: 174 TVYSNELLGNQLSPLSFIETVIAKWVEKSNNYVTNQLPLDYFNTLYTIEDTMHPNLLSSI 233

Query: 217 SIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTMNPFFPHIPL 263
                    L ++E I    L+ +++   L+  F+  + PFFP I +
Sbjct: 234 ------KTLLREVELI----LVDKQQINLLLKNFYENIYPFFPLIDI 270

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++F  C +CR RKVKCDLG      +P C RC R G  C
Sbjct: 15 KTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 10/56 (17%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++  T +KR  R     ++F  C +CR RKVKCDL       +P CVRC + G  C
Sbjct: 3  KSAKTQTKRPRR----AKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          EAG  AS R     +  ++ RAC  CR +K +CD     +  +P C  C+R GKTC F
Sbjct: 18 EAGGAASDR-----RRSKTSRACDQCREKKTRCDF----SDERPICSACQRMGKTCTF 66

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 11/71 (15%)

Query: 28  QRSFRACISCRMRKVKCD-LGPLENPHKPPCVRCRREGKTCIF------SSGGNGMSSAN 80
           +R+ RAC SCR RK+KCD + P+ N     C  C +    C+F      ++  N  S+  
Sbjct: 135 KRATRACESCRKRKIKCDPVDPITN----KCSNCTKFHMICVFDNRKRKATNANTNSNKL 190

Query: 81  LSTMNGKNNQA 91
           L TMN K++++
Sbjct: 191 LKTMNPKSHES 201

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 9/49 (18%)

Query: 19 KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          K+S+R +K   ++  C +CR RKVKCDL       +P C+RCRR    C
Sbjct: 3  KKSTRSVK---TYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 8/49 (16%)

Query: 21 SSRDI--KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          SSRD   K  ++F  C +CR+RK+KCDL       KP C +CR    +C
Sbjct: 8  SSRDADNKRAKTFEGCWTCRLRKIKCDL------KKPKCDKCRSSAISC 50

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 25 IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          I+  ++F  C +CR RKVKCDL       +P C RC R G  C
Sbjct: 13 IQRAKTFTGCWTCRARKVKCDLT------RPSCTRCERSGLKC 49

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 6/47 (12%)

Query: 23 RDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          + I+ QR    C +CR +K++C      N  +P C RC+R G+TC++
Sbjct: 4  KSIRGQRPTHVCAACRTQKLRC------NRERPSCSRCQRIGRTCVY 44

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 1   MLSASNERAIDEAGTTASKRS-SRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVR 59
           M  AS   ++D +G T S  +  + +K + S   C+ C+ R++KCD G      KP C +
Sbjct: 121 MSPASGISSVDASGATPSTDADGKIVKRKYSRNGCLECKKRRMKCDEG------KPTCWQ 174

Query: 60  CRREGKTCIF 69
           C R  + C++
Sbjct: 175 CARLNRKCVY 184

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 10  IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
           I+  G T SK S+   K+  +S   CI+C+ R+VKCD G      KP C +C     +C+
Sbjct: 72  IEVDGKTVSKTSTGKRKFHNKSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCV 125

Query: 69  FSS 71
           + S
Sbjct: 126 YIS 128

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON}
          Anc_2.547 YKL038W
          Length = 1088

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 18 SKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          + RSS + +  ++ RAC  CR +KVKCD G      +  C  C+R G+ C F
Sbjct: 47 ASRSSSNKRRTKASRACDQCRKKKVKCDNG----DDRSVCTNCQRNGEKCTF 94

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 6/40 (15%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++SF  C +CR RKVKCDL      ++P C RC R G  C
Sbjct: 11 RKSFNGCWTCRSRKVKCDL------NRPKCQRCDRLGIIC 44

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 21 SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          S R +K  R  + C++CR RKVKCD         P C+RC +    C ++
Sbjct: 2  SRRGVKKPRPSKVCLTCRRRKVKCD------QQHPSCMRCIKSSTLCTYT 45

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 21  SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +S   K +R+  ACISC   K KC      + ++ PC+RC + GK C F
Sbjct: 95  TSEGGKLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRF 143

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 56/126 (44%), Gaps = 20/126 (15%)

Query: 29  RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMNGKN 88
           R F+ACI+CR +K +CD        K PC  C R    C +++     S + ++  N  +
Sbjct: 27  RVFKACIACRKKKRRCD-------GKSPCSHCARTSIICEYTNTARPRSHS-IAFANDVS 78

Query: 89  NQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWK-LELASMQN-SLEFL 146
           N               +ST +S+ H+ K+    N YK L    +    L S+QN S E L
Sbjct: 79  NDIHLI----------DSTTSSRSHSPKLSDKVNPYKTLIERLYSGASLESLQNLSREQL 128

Query: 147 AKAADS 152
            K  +S
Sbjct: 129 IKTLNS 134

>KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON}
          conserved hypothetical protein
          Length = 728

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNG 75
          RS   C +CR++++KCD         P C RC+R   TCI+   GNG
Sbjct: 38 RSKSGCFTCRLKRMKCD------EQHPICGRCKRNLLTCIWPKEGNG 78

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON}
          Anc_8.423 YLR228C
          Length = 973

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          ID  G   SK S+   K+  +S   C +C+ R+VKCD        KP CV+C      C+
Sbjct: 27 IDVGGKKVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDEA------KPACVKCSNMKLDCV 80

Query: 69 FS 70
          +S
Sbjct: 81 YS 82

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 6/45 (13%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          K  R    C++CR RK KCD G      KP C  C + G+TC++S
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRG------KPSCSNCLKLGETCVYS 51

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 22 SRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          SR +K  R  R C+ C+ RK++CD        +P C RC+R    C +
Sbjct: 3  SRVVKKPRPSRVCVQCKKRKLRCD------RQRPTCTRCKRSSTICTY 44

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGN-GMSSANL 81
          K ++  +AC+ CR RK+KCDL       KP C +C      CI+++  N  +S A L
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLT------KPKCKQCSSRNLNCIYTNQYNFDLSDAEL 56

>TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447
           bp, 1148 aa] {ON} Anc_5.577 YML034W
          Length = 1148

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSAN 80
           K  +  RAC++CR  K+ CD        KP C  C ++ KTCI+    +  +S+N
Sbjct: 300 KLNKKPRACLTCRKSKIGCDRT------KPDCNNCTKKNKTCIYPDVPSTANSSN 348

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 17 ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ASK   R +   ++F  C +CR RKVKCD   L +PH   C RC +    C
Sbjct: 4  ASKSGVRKLGRAKTFTGCWTCRGRKVKCD---LRHPH---CQRCEKSNLPC 48

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 16/117 (13%)

Query: 25  IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSG----GNGMSSAN 80
           +K +R  RAC  CR +KVKCD        + PC+ C      C ++       N  SS  
Sbjct: 57  LKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSTRRNNSNSSTP 109

Query: 81  LSTMNGKNNQATFTGIKRALSVDAN-----STLNSQYHTTKIKKTENTYKRLPREKW 132
           +STM   ++    T +    + ++N     +  N + +  K+ +  N YK L  E +
Sbjct: 110 ISTMVNSHSMTNLTMMSNQSNTNSNINKKSTHCNKRLNNVKLNEQLNKYKLLFNELF 166

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 32  RACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMNGKNNQA 91
           RAC SCR +K+KC  G L      PC  C   G  C++S    G++     T   K++ +
Sbjct: 53  RACDSCRKKKIKCS-GTL------PCKSCETYGCECVYSHAPYGVAKGKKKT--AKSDSS 103

Query: 92  TFTGIKRALSVDANSTL 108
            FT  K ++    NST+
Sbjct: 104 AFTKEKLSVQSIPNSTV 120

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMNGK 87
           +R  +AC +CR RK+KCD     +P K  C  C +  K C FS      +  N+S  N  
Sbjct: 157 RRVVKACYNCRRRKIKCDAI---DPSKNKCSNCLKLNKICSFSENDEINTPFNIS-HNST 212

Query: 88  NNQ 90
           NN+
Sbjct: 213 NNK 215

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1066

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 10/57 (17%)

Query: 13 AGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
            T+ASKR ++      + RAC  CR RK++CD     +  K  C  CR+ G++C F
Sbjct: 53 GNTSASKRRTK------ASRACDQCRKRKIRCDY----DDDKGVCTSCRKNGESCAF 99

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++F  C +CR RKVKCDL       +P C RC + G  C
Sbjct: 35 KTFTGCWTCRSRKVKCDL------RRPHCQRCEKSGLVC 67

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 21 SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSAN 80
          S+  IK  RS RAC +CR RK+KC           PC  C   G  C+F    NGM+  N
Sbjct: 5  SNGKIKKLRSSRACSNCRRRKIKCS-------GIQPCPNCEIYGCLCVFEP-VNGMTPMN 56

Query: 81 LST 83
           S+
Sbjct: 57 FSS 59

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON}
          conserved hypothetical protein
          Length = 680

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 2  LSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCR 61
          +  S++ +  + GT   K   ++ K +R+ RAC +CR  K +C L P+  P++  C+RC 
Sbjct: 1  MPPSDDISKSKYGTGVHKPRKKEFKGKRAVRACDTCRRLKTRCILSPI--PNEFYCLRCE 58

Query: 62 REGKTCIF 69
               C F
Sbjct: 59 SLKIHCSF 66

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 34/74 (45%), Gaps = 17/74 (22%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMS-----SANLST 83
          ++F  C +CR RKVKCDL       +P C RC + G  C    GG  +           T
Sbjct: 9  KTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLIC----GGYDVKLRWTRPIQFDT 58

Query: 84 MNGKNNQATFTGIK 97
          M   N  AT TGIK
Sbjct: 59 MG--NVTATPTGIK 70

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          +DE G   SK S+   K+  +S   C +C+ R+VKCD G      KP C +C      C+
Sbjct: 9  VDEHGKRVSKNSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECV 62

Query: 69 FS 70
          F+
Sbjct: 63 FT 64

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 3   SASNERAIDEAG--TTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
           S S  RA   AG  T++S    + +K + S   C  C+ R++KCD G      KP C +C
Sbjct: 116 SNSGIRAPTVAGQATSSSGADGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQC 169

Query: 61  RREGKTCIF 69
            R  + C++
Sbjct: 170 ARLNRECVY 178

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 22 SRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          ++  K  R    C +CR+RK+KCD        KP C RC + G  CI++
Sbjct: 3  NKQTKRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIYN 45

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 15/69 (21%)

Query: 25 IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF--------SSGGNGM 76
          +K +R  RAC  CR +KVKCD        + PC+ C      C +        SS    M
Sbjct: 9  VKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKRTNSSVTGSM 61

Query: 77 SSANLSTMN 85
          S+ N+S+ N
Sbjct: 62 SATNISSQN 70

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
          YML099C (REAL)
          Length = 882

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 18 SKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          SK  ++ +   ++F  C +CR RKVKCDL       +P C RC +    C
Sbjct: 5  SKHGAKKLGRAKTFTGCWTCRGRKVKCDL------RRPHCQRCEKSNLPC 48

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++F  C +CR RKVKCDL       +P C RC + G  C
Sbjct: 23 KTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 18/79 (22%)

Query: 3   SASNERAIDE------------AGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLE 50
           + SNER  DE              T+  K S+ ++K + S   C  C+ R++KCD     
Sbjct: 80  TTSNERVADEEIMDGSAAMPPTPVTSTVKDSNGNVKRKYSRNGCTECKRRRIKCD----- 134

Query: 51  NPHKPPCVRCRREGKTCIF 69
              KP C +C R  + CI+
Sbjct: 135 -ETKPTCWQCARLNRECIY 152

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 6/67 (8%)

Query: 3   SASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRR 62
           +AS+ +A+D   T+ S  S +  K + S   C  C+ R++KCD G      KP C +C R
Sbjct: 133 TASDTKAVDANSTSTSTSSGKISKRKYSRNGCTECKKRRMKCDEG------KPSCWQCTR 186

Query: 63  EGKTCIF 69
             + C++
Sbjct: 187 LNRECVY 193

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 6/37 (16%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           C+ CR +KVKCD        +P C RCR+  K C++
Sbjct: 14 VCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVY 44

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 32 RACISCRMRKVKCDLGPLENPHKPP--CVRCRREGKTCIFSSGGNG 75
          RAC++CR RK+KCD     +P   P  C  C R    C+F +   G
Sbjct: 25 RACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVASNRG 70

>TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON} 
          Length = 873

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 13 AGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          AG  A + S+ D   +R   AC+ CR +K KCD   LE   + PC +C ++G +C+ 
Sbjct: 14 AGHEARRSSAID---KRKKFACVECRQQKSKCD--ALEKAPE-PCTKCSKKGVSCVL 64

>Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON}
           similar to Ashbya gossypii ACL093C
          Length = 1041

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 121/303 (39%), Gaps = 71/303 (23%)

Query: 3   SASNERA--IDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGP-LENPHKPPCVR 59
           S+ ++RA  +++   +++K++ ++ K   + + C  CR R+ KC + P + N     CV+
Sbjct: 118 SSVSQRASDVNKGMMSSTKQAEQEHKSAIASKPCDHCRRRRTKCVIVPGMAN-----CVQ 172

Query: 60  CRREGKTCIFSSGGNGMSSANLSTMNGKNNQATFTG----------IKRALSVDANSTLN 109
           C  +G  C FS     ++    + MN +  +   TG          +KRA   D  +  N
Sbjct: 173 CETKGIKCGFSE---LITPKMPNDMNQEGQKKRSTGDEANTNVHELLKRAKLNDMMNQDN 229

Query: 110 -SQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKL 168
            SQ++T  ++        +P         + QN  +F   +    +H SN       ++ 
Sbjct: 230 ISQFYTDLLQNLNTNASDMPGMA-----QTNQNHFDFPLSSVGQGSHMSN------VSRG 278

Query: 169 AKNGASNDTSENDTPVQQQDSPNENYLTPLTTPHNSRRSALP---------------QLE 213
                SN TS +  P QQ +     Y  P ++ +    S                  QL 
Sbjct: 279 QAVQISNTTSSSRVPRQQSNQSTIQY--PRSSFYVGPTSVFDINLVNHMKLDNIDQIQLS 336

Query: 214 KSISIRPKSSQTLSDMEFIGPSKL-----------------LSEEEARELIDLFFLTMNP 256
           KS+S+R    +   D++FI  +                   L     + L+D+FF  ++P
Sbjct: 337 KSVSLR----KVAPDVQFILRADFNQQLYLKHEREIDLVERLVHPHGKILVDIFFKLVHP 392

Query: 257 FFP 259
           +FP
Sbjct: 393 YFP 395

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 17 ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
           SK  ++ +   ++F  C +CR RKVKCD   L +PH   C RC +    C
Sbjct: 4  TSKNGTKKLGRAKTFTGCWTCRGRKVKCD---LRHPH---CQRCEKSNLPC 48

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 72/164 (43%), Gaps = 20/164 (12%)

Query: 18  SKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMS 77
           S  S+  ++ +R  RAC  CR RK+KCD   ++N     C  C + G  C F +      
Sbjct: 107 SNVSTTKVQKRRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTFKNWEEH-D 163

Query: 78  SANL--STMNGKNNQ-ATFTGIKRALSVDANSTLNSQYHTTK-------IKKTENTYKRL 127
           S NL  ++ N KNN  + F   K  L  D +S +N+   +T         K T N  ++L
Sbjct: 164 SQNLLAASKNDKNNNLSNFDNDKNKL--DNSSNINTPASSTSPADVIPPSKVTNNKIEKL 221

Query: 128 PREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKN 171
            R     +++ + + +  L    D +A   N  S   T+ L  N
Sbjct: 222 DR-----KVSLIFDHIAKLEWLLDKIATNQNITSTNNTSSLTSN 260

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 6/37 (16%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           C+ CR RK+KCD        +P C++C  +G TC++
Sbjct: 24 VCLECRRRKIKCD------KQRPCCIQCAEQGLTCVY 54

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 6/58 (10%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          ++ TT++ R  R+     +F AC +C  +K KC    + + ++ PCVRCR+  K C F
Sbjct: 44 DSPTTSAGRPKRN-----TF-ACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 10  IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
           I+  G   SK S+   K+  +S   C++C+ R+VKCD G      KP C +C      C+
Sbjct: 178 IEVNGKKVSKTSTGKRKFHNKSKNGCVNCKRRRVKCDEG------KPTCKKCLNMKLDCV 231

Query: 69  F 69
           +
Sbjct: 232 Y 232

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTM 84
          +R  +AC +CR  K KCD        + PC RC  E K C +S+   G S   L  +
Sbjct: 5  KRVSKACDTCRKSKTKCD-------GERPCQRCLSENKICTYSNSSIGYSEGKLKKL 54

>TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {ON} 
          Length = 801

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 43/106 (40%), Gaps = 12/106 (11%)

Query: 17  ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGM 76
           ASK S R +  + S   CI C+   +KC      N  KP C  C R  K C +      +
Sbjct: 2   ASKLSKRTVISKYSKHGCIQCKKSHIKC------NEEKPACQNCIRSKKDCKY------L 49

Query: 77  SSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTEN 122
           +     +++G N        K  +  + N+  N    + KI  TEN
Sbjct: 50  TQFISKSISGSNRDTFKIKFKSQILKETNNNTNHTSSSNKIHTTEN 95

>SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 645

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 16 TASKRSSRDIKWQR-SFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGN 74
          +A++   R IK ++ S   C  C+ RKVKCD        KP C +C   GK C++SS   
Sbjct: 2  SATETLRRGIKKRKYSKLGCTECKRRKVKCD------ETKPMCWQCSHLGKNCVYSSPST 55

Query: 75 GMS--SANLSTMNGKNNQ 90
           ++   AN S +  K  +
Sbjct: 56 RITFCEANFSGVGSKAKE 73

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          RS+  C +CR RKVKCD        +P C RC++ G  C
Sbjct: 15 RSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa]
           {ON} Anc_3.264
          Length = 759

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 14/68 (20%)

Query: 2   LSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCR 61
           +SASN    D+ G  A ++ SR+         C  C+ R++KCD        KP C +C 
Sbjct: 107 VSASNASTSDKKGHIAKRKYSRN--------GCTECKRRRMKCD------ETKPICWQCA 152

Query: 62  REGKTCIF 69
           R  + C++
Sbjct: 153 RLNRECVY 160

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           K +R+  ACISC   K KC    L++    PC RC R  K C F
Sbjct: 59  KRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAF 102

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 27 WQRSFR---ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          WQ+  R   ACI+C   K KC    L N    PC+RC +  + C F
Sbjct: 32 WQKRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTF 77

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 50/121 (41%), Gaps = 12/121 (9%)

Query: 11  DEAGTTASK-RSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           D   +T SK  ++ + K +R+  AC+ C   K KC      + ++ PC RC R GK C F
Sbjct: 62  DPRHSTPSKMETTENGKIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCKF 121

Query: 70  -----------SSGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIK 118
                       S     SS  L+ ++  +  A    I    S    +TLN +    K +
Sbjct: 122 DLSKRTRKRRLKSDPTSRSSTPLTLLSSGDTTALNASIGNVASSQLPNTLNIEVQQAKRQ 181

Query: 119 K 119
           K
Sbjct: 182 K 182

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++F  C +CR RKVKCDL       +P C RC R    C
Sbjct: 7  KTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++F  C +CR RKVKCDL       +P C+RC +    C
Sbjct: 18 KTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>KAFR0A00220 Chr1 complement(42494..45250) [2757 bp, 918 aa] {ON}
           Anc_2.651 YIR023W
          Length = 918

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 109/279 (39%), Gaps = 50/279 (17%)

Query: 11  DEAGTTASKRSSRDIKWQRSFRACISCRMRKVKC----DLGPLENPHKPPCVRCRREGKT 66
           DE+ T   K+S+  I      ++C SC   KVKC    DLG         C+ C      
Sbjct: 89  DESYTDNGKKSNHKISLDG--KSCNSCARNKVKCVFVPDLGS--------CLECETLKIK 138

Query: 67  CIFSSGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKR 126
           CIFS     +   N    N  NN+     +K+  S    S + S+Y+T  ++   ++   
Sbjct: 139 CIFSPIRKRLIGDNSMDKNAINNEKQ---LKKTKSETNTSKVTSRYYTNFLQSLNSSAST 195

Query: 127 LPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQ 186
               +   E A+        +     +  Q++ +S           +S   ++   PVQ 
Sbjct: 196 PATSQISYEQATSPVGSNLTSSTTPYMYQQTHNQSPGAIPSAINGTSSFLHAQKSMPVQH 255

Query: 187 QDSPNENYLTPLTTPHN------SRRSALPQLE--KSISIRPKSSQTLSDMEFIGPSKLL 238
              P  ++   LT+ ++       +   + Q++  K++S+R  SS    D++F+     +
Sbjct: 256 ---PRSSFYVGLTSIYDINIINKVKLDNIDQIKISKNLSLRKVSS----DVQFLLRDDYV 308

Query: 239 SEE------------------EARELIDLFFLTMNPFFP 259
           S E                    + LID+FF  ++P+FP
Sbjct: 309 SNETMAKDYREIDYVERLIYPNGKTLIDIFFKLVHPYFP 347

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 17 ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          +SK   + +   ++F  C +CR RKVKCD   L +PH   C RC +    C
Sbjct: 4  SSKNGPKKMGRAKTFTGCWTCRGRKVKCD---LRHPH---CQRCEKSNLPC 48

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON}
          Anc_4.344 YML076C
          Length = 903

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 23 RDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          R  K +R+  AC+ C   K KC      + ++ PCVRC R+ K C F
Sbjct: 48 RGGKNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKF 94

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS 71
          E  T     + +  K +R+   CI C+ +K++C      N  +P C RC+R GK C + +
Sbjct: 13 ENCTYTFAMAGKSQKSKRTVSVCIPCKSQKLRC------NKARPICSRCQRLGKHCHYGA 66

Query: 72 GGNGMSSANLSTMNG 86
              ++ A     NG
Sbjct: 67 HTQILTPAEELLDNG 81

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa]
          {ON} 
          Length = 847

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 23 RDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLS 82
          +D +  R    C++CR +K+KCD        +P C RC +  + C++    +  S    S
Sbjct: 4  KDFRKIRPSYVCVTCRTQKLKCD------KQRPSCGRCLKNKRKCVYEINSSLDSLHENS 57

Query: 83 TMNGKNNQAT 92
            +  NNQ +
Sbjct: 58 MRSHSNNQIS 67

>Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON}
          similar to Ashbya gossypii ACL195C
          Length = 114

 Score = 38.1 bits (87), Expect = 0.016,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          K ++  R+C+ CR  KVKCD   +  P   PC  C ++G +C
Sbjct: 28 KMKKPLRSCVRCRKNKVKCD-SAIRRPK--PCSSCLKKGVSC 66

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 12/73 (16%)

Query: 19 KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS-----SGG 73
          ++ SR  K +R  RAC  CR +KVKCD     N H  PC+ C      C ++     +GG
Sbjct: 7  RQGSRIAKRRRITRACDECRKKKVKCD-----NRH--PCIHCTVYSYECTYNQPARRTGG 59

Query: 74 NGMSSANLSTMNG 86
          N  S    +   G
Sbjct: 60 NKNSEGGENVCRG 72

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 922

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 10 IDEAGTTASKRSSRDIKW-QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          I+  G   SK S+   K+ ++S   C +C+ R+VKCD G      KP C +C      C+
Sbjct: 23 IEVNGKRVSKTSTGKRKFHKKSKTGCDNCKRRRVKCDEG------KPGCKKCSNLNLVCV 76

Query: 69 FSS 71
          +S+
Sbjct: 77 YST 79

>Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]
          {ON} YDL170W (UGA3) - zinc-finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 161] FULL
          Length = 643

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 13/54 (24%)

Query: 16 TASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          T  KR+ R          CI C++RK +C      + HKP C  C R G TC++
Sbjct: 16 TVGKRTHRKT-------GCIPCKIRKKRC------SEHKPTCTDCERLGFTCVY 56

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 25  IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
           I  +R  +AC  CR RK+KC  GP+ NP K  C  C +    C F+
Sbjct: 94  IAKRRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTFT 136

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 7/38 (18%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          AC+ CR ++ KC++       K PC  C+R G  CIF+
Sbjct: 20 ACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIFT 50

>KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 12 EAGTTASKRSSRDIKWQRS-FRACISCRMRKVKCDLGPLENPHKPPCVRCR-REGKTCIF 69
          + G+ A     R  K +R   R C+ CR RK+KCD        KP C +CR R   TC++
Sbjct: 7  KVGSDAGSHDERSKKRRRKEVRNCLFCRKRKLKCDRA------KPKCSQCRNRNLPTCLY 60

Query: 70 SSGGN 74
          ++  N
Sbjct: 61 TNRFN 65

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          K QR   +C++C  RK+KCD        KP C  C + G  C++
Sbjct: 38 KRQRQILSCVACHKRKIKCDRA------KPVCESCGKNGWECLY 75

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 23 RDIKWQRSFRACISCRMRKVKCDLGPLENPHKP-PCVRCRREGKTCIF 69
          ++I   R   AC+ CR +K KCD     N   P PC +C R+G  CI 
Sbjct: 8  KEIPMGRRKYACVECRQQKSKCD----ANDKAPNPCSKCARKGVPCIL 51

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON}
          similar to uniprot|P32862 Saccharomyces cerevisiae
          YKL038w RGT1
          Length = 1287

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 24 DIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          D K     RAC  CR +K+KCD     N  +  C  C+R G+ C F
Sbjct: 6  DKKRTNVSRACDQCRRKKIKCD----RNQERNICTSCQRNGERCKF 47

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNG 75
           C  C+ RKVKCD        KP C +C   GK C++    NG
Sbjct: 20 GCNECKKRKVKCD------EQKPECWQCSHLGKKCVYDQPSNG 56

>KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON}
          Anc_6.154 YBR240C
          Length = 459

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 13 AGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          + TT  K++SR     R+F  C +CR++K +C+L       KP C  C R G  C +
Sbjct: 9  SSTTDMKKASR----ARTFTGCWACRLKKRRCNL------EKPICSLCVRHGDHCSY 55

>KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {ON}
           similar to uniprot|P21657 Saccharomyces cerevisiae
           YIR023W DAL81 Positive regulator of genes in multiple
           nitrogen degradation pathways contains DNA binding
           domain but does not appear to bind the dodecanucleotide
           sequence present in the promoter region of many genes
           involved in allantoin catabolism
          Length = 1085

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 4   ASNERAIDEAGTTASKRSSRDIKWQR-----SFRACISCRMRKVKCDLGPLENPHKPPCV 58
            S + + D +G  A   +S+ +  Q      + + C  CR R++KC + P      P CV
Sbjct: 100 GSGDNSPDPSGVVAPNTNSKALAAQENKSVIAEKPCDHCRRRQIKCVIAP----DLPNCV 155

Query: 59  RCRREGKTCIFS 70
           +C  +G  C +S
Sbjct: 156 QCENKGIKCAYS 167

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 10  IDEAGTTASKRSSRDIKWQRSFR-----ACISCRMRKVKCDLGPLENPHKPPCVRCRREG 64
           I E  T   K+ S+  K +R F       C +C+ R+VKCD G      KP C +C    
Sbjct: 77  IIELITVDGKKVSKTSKGKRKFHNKSKNGCANCKRRRVKCDEG------KPTCQKCLNMK 130

Query: 65  KTCIF 69
             C++
Sbjct: 131 LQCVY 135

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 13  AGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           + +T S + S  I  +++ RAC  CR RK+KCD    +N     C  C R G  C F
Sbjct: 56  SSSTGSAKGS--IGGKKATRACDQCRKRKIKCDYDNDKN----VCSSCNRNGDRCQF 106

>TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.61
           YOR172W
          Length = 799

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 75/174 (43%), Gaps = 43/174 (24%)

Query: 13  AGTTASKRSSRDIKWQRS--FRACISCRMRKVKCDLGPLENPHKPPCVRC-RREGKTCIF 69
           A  + S  +++ +K +R+   ++C  CRMRK+KCD       +KP C  C  R+ K C +
Sbjct: 4   ASPSPSNGTNQGVKKKRNKLIKSCTFCRMRKLKCD------KNKPMCSTCVVRQRKECSY 57

Query: 70  SSGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPR 129
                                 T+T   RA S  AN   + + + + + K EN Y  L  
Sbjct: 58  ----------------------TYTTSSRASSPTAN---DGKVNISNLSKKENVYDSLSP 92

Query: 130 EKWKLE-LASMQNSLEFLAK--AADSVAHQSNPE------SFKETAKLAKNGAS 174
            +  +E L    N+  +LA   +  +  ++ NP         KE+ K++ +G +
Sbjct: 93  SEGNIEMLKDTVNTNGYLADSPSVSNTKYKKNPYYDYYNFQMKESGKISVSGPT 146

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 4/41 (9%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          ++ RAC  CR +K +CD    ENP    C  C+R  KTC F
Sbjct: 34 KTSRACDQCRGKKTRCDFSD-ENPV---CTSCQRMSKTCTF 70

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 176 DTSENDTPVQQQDSPNENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPS 235
           ++  N  P  +  SPN +   P      SRRS     +  +S  P +SQ+ SD +   P 
Sbjct: 336 ESPRNPNPNHRDASPNSDVF-PDGRKVKSRRSV--HRKDPVSQSPANSQSSSDQQ---PI 389

Query: 236 KLLSEEEARELIDLFFLTMNPFFPHIPL 263
               +   ++LID++F  ++P FP IP+
Sbjct: 390 VTYGKIPDKQLIDIYFEFIHPNFPVIPV 417

>CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON}
          similar to uniprot|P08638 Saccharomyces cerevisiae
          YLR451w LEU3 transcription factor
          Length = 940

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          AC+ CR +K KCD     +    PC RC+++G  C+ 
Sbjct: 57 ACVECRQQKSKCD---AHDKAPEPCTRCQKKGVPCVL 90

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 15/67 (22%)

Query: 18 SKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF-------- 69
          +++  + +K +R  RAC  CR +KVKCD        + PC+ C      C +        
Sbjct: 5  AQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQ 57

Query: 70 SSGGNGM 76
          +SG +GM
Sbjct: 58 NSGNSGM 64

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
          {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          K  ++ RAC  CR +K+KCD   + N     C  C+R G+ C F
Sbjct: 47 KRTKASRACDQCRRKKIKCDYNDMRN----ICTNCQRIGERCSF 86

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 11  DEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDL--GPLENPHKPPCVRCRREGKTCI 68
           D   +  S  ++   +  +  RAC  CR +K+KCD   G   NP +  C  CR+ G+ C 
Sbjct: 94  DSVSSNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQ-SCTGCRKIGEKCS 152

Query: 69  F 69
           F
Sbjct: 153 F 153

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 7/78 (8%)

Query: 18 SKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMS 77
          +++  + +K +R  RAC  CR +KVKCD        + PC+ C      C +        
Sbjct: 5  AQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQ 57

Query: 78 SANLSTMNGKNNQATFTG 95
          ++  S +    N AT  G
Sbjct: 58 NSGNSGVLALGNAATAAG 75

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 32 RACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNG 75
          RAC +CR RK+KC        H  PC  C   G  CIFS  G G
Sbjct: 33 RACNNCRKRKIKC-----TGLH--PCASCEAYGCPCIFSPRGKG 69

>TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {ON}
           Anc_3.264 YDR034C
          Length = 825

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 12  EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +  +T      + IK + S   C  C+ R++KCD        KP C +C R  ++CI+
Sbjct: 141 DVSSTVKNEKGKVIKRKYSRNGCTECKKRRMKCD------ETKPICWQCSRLNRSCIY 192

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNG 75
          +R  +AC +CR  K KCD        + PC RC +E K C +S+   G
Sbjct: 16 RRVSKACDACRKSKTKCD-------GERPCSRCLKENKLCTYSNSNIG 56

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 21 SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          SS+  K +R  RAC  CR +KVKCD        + PC+ C      C ++
Sbjct: 23 SSQQPKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYN 65

>TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa]
          {ON} Anc_2.547 YKL038W
          Length = 981

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 11/66 (16%)

Query: 4  ASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRRE 63
          A NE +    G+ + KR+       ++ RAC  CR RK+KCD     +  K  C  C + 
Sbjct: 26 ARNEESNSPPGSVSKKRT-------KASRACDQCRKRKIKCDF----SEEKGICTSCSKN 74

Query: 64 GKTCIF 69
             C F
Sbjct: 75 ADRCAF 80

>KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa]
           {ON} similar to uniprot|P21657 Saccharomyces cerevisiae
           YIR023W DAL81 Positive regulator of genes in multiple
           nitrogen degradation pathways contains DNA binding
           domain but does not appear to bind the dodecanucleotide
           sequence present in the promoter region of many genes
           involved in allantoin catabolism
          Length = 1133

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 3   SASNERAIDEAGTTASKRSSRDIKWQRSF--RACISCRMRKVKCDLGPLENPHKPPCVRC 60
           SA++ + +  +GT  +   +  ++ Q +   + C  CR R+ KC + P  +     CV C
Sbjct: 174 SANSPQFVPSSGTNGAPSPNVSVRTQNTLTEKPCDHCRRRRTKCIVPPESDS----CVPC 229

Query: 61  RREGKTCIFSSGGNGMSSANL 81
             +G  C FS   +G  +A++
Sbjct: 230 DTKGIKCTFSELPSGKVAADV 250

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON}
          Anc_7.512 YLR451W
          Length = 766

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 25 IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSG 72
          +K +R   AC+ CR +K KCD          PC RC+++G  C    G
Sbjct: 9  MKSKRRKYACVECRQQKSKCD---YTTKFPEPCSRCKKKGIICAVKQG 53

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
          Anc_8.423
          Length = 948

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          I+  G   SK S+   K+  +S   C +C+ R+VKCD        KP C +C     TC+
Sbjct: 38 IEVGGKKVSKTSTGKRKFHNKSKNGCDNCKKRRVKCD------EVKPSCKKCTNMQLTCV 91

Query: 69 FS 70
          +S
Sbjct: 92 YS 93

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 17  ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +S  + + +K + S   C  C+ R++KCD G      KP C +C R  + C++
Sbjct: 132 SSNSNGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVY 178

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 14/123 (11%)

Query: 18  SKRSSRDIKWQRSFRACISCRMRKVKCD---------LGPLENPHKPPCVRCRREGKTCI 68
           +++  + +K +R  RAC  CR +KVKCD         +   E  +K P  R +  G + +
Sbjct: 5   AQQGEQSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKKPTKRTQNSGNSGV 64

Query: 69  FSSGG--NGMSSANLSTMNGKNNQATFTGIK--RALSVDANSTLNSQYHTTKIKKTENTY 124
            + G    G SS+ +      N     + IK  RA+   A ST+ +  + +K +K +   
Sbjct: 65  LTLGNVTTGPSSSTVVAAAASNPNKLLSNIKTERAILPGA-STIPASNNPSKPRKYKTKS 123

Query: 125 KRL 127
            RL
Sbjct: 124 TRL 126

>YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON}
          ECM22Sterol regulatory element binding protein,
          regulates transcription of sterol biosynthetic genes;
          contains Zn[2]-Cys[6] binuclear cluster; homologous to
          Upc2p; relocates from intracellular membranes to
          perinuclear foci on sterol depletion
          Length = 814

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          I+  G   SK S+   K+  +S   C +C+ R+VKCD G      KP C +C      C+
Sbjct: 19 IEVGGKKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCV 72

Query: 69 FS 70
          +S
Sbjct: 73 YS 74

>SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]
           {ON} conserved hypothetical protein
          Length = 632

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 54/126 (42%), Gaps = 15/126 (11%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNG-MSSANLSTMNG 86
           +R+   C++CR RK KCD        KP C  C+R    C +    +G +      + N 
Sbjct: 6   KRTITGCLTCRKRKKKCD------EVKPVCTGCQRNFLQCEWPDYSDGRIRRRRKESDNL 59

Query: 87  KNNQATFTGIKRALSVDANS-TLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145
           K  Q       R L ++ NS   + Q++ TK    E  + R  R KW+ EL +     + 
Sbjct: 60  KPEQT-----PRKLLLERNSRQPDLQFNITKCDCQE--FVRYGRLKWQFELYTKGEKSDT 112

Query: 146 LAKAAD 151
           L K  D
Sbjct: 113 LYKFDD 118

>Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa]
          {ON} YLR228C (REAL)
          Length = 812

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          I+  G   SK S+   K+  +S   C +C+ R+VKCD G      KP C +C      C+
Sbjct: 19 IEVGGKRVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCV 72

Query: 69 FS 70
          +S
Sbjct: 73 YS 74

>Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON}
          (64772..66079) [1308 nt, 436 aa]
          Length = 435

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 24 DIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          D ++ R+F  C +CR +K KCD        KP C  C R G  C
Sbjct: 5  DNRYSRNFTGCWACRFKKRKCD------ELKPSCSLCVRHGDCC 42

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
          similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 880

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 13/58 (22%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          EA   A KR      ++ SF  C  CR  K KCD        KP C RC+R  K CI+
Sbjct: 6  EANLKAKKR------YKLSF-VCQLCRKSKTKCD------RKKPSCARCQRLNKPCIY 50

>NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON}
          Anc_6.154
          Length = 475

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 6/41 (14%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          R+F  C +CR++K +CD        KP C  C R G TC +
Sbjct: 19 RTFTGCWACRLKKRRCD------ELKPTCSLCVRHGDTCSY 53

>Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa]
          {ON} YLR228C (REAL)
          Length = 814

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          ++  G   SK S+   K+  +S   C +C+ R+VKCD G      KP C +C      C+
Sbjct: 20 VEVGGKKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCV 73

Query: 69 FS 70
          +S
Sbjct: 74 YS 75

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 7/42 (16%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          R   ACI CR R VKC       P+  PC+RC +    C +S
Sbjct: 35 RKSNACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYS 69

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 11/55 (20%)

Query: 15  TTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           TT  KR+       ++ RAC  CR +K+KCD    +N     C  C+R  + C F
Sbjct: 79  TTVKKRT-------KASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTF 122

>Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar to
           Ashbya gossypii ABL099W
          Length = 770

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 25/90 (27%)

Query: 1   MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
           ++++S  RA  +A   + KR     K+ R+   C  C+ R++KCD G      KP C +C
Sbjct: 126 LINSSRSRA--DASVKSGKR-----KYSRN--GCTECKRRRMKCDEG------KPVCWQC 170

Query: 61  RREGKTCIF----------SSGGNGMSSAN 80
            R  ++C++              +GM SAN
Sbjct: 171 SRLNRSCVYIINPKNKKRKKPMASGMVSAN 200

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa]
          {ON} YLR228C (REAL)
          Length = 813

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          I+  G   SK S+   K+  +S   C +C+ R+VKCD G      KP C +C      C+
Sbjct: 18 IEIGGKRVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLECV 71

Query: 69 FS 70
          +S
Sbjct: 72 YS 73

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
          {ON} Anc_7.17
          Length = 1059

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          +++ SF  C  CR  K KCD        KP C RC + G TCI+
Sbjct: 46 RYRLSF-VCQECRKSKTKCD------KEKPSCSRCLKIGITCIY 82

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 14 GTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          GTT S   ++  K  +  RAC  CR +K+KCD+    +   P C  C + G  C F
Sbjct: 18 GTTYSTTETK--KRSKVSRACDQCRKKKIKCDV----SEDNPVCSGCFKVGDRCTF 67

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
          Ashbya gossypii AER141C
          Length = 665

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGN 74
          +R  + C +C+  KVKC     E     PC RC R G  C F   GN
Sbjct: 8  KRRTKPCSNCKQNKVKC-----EYNEGLPCSRCTRNGLECYFIQRGN 49

 Score = 38.5 bits (88), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 237 LLSEEEARELIDLFFLTM-NPFFPHIPLQLQDADELVRYPILLCAILTISSRYHP 290
           +L++++A+EL+ LF     N  F +    L   D  V  P+LL AI T++SRYHP
Sbjct: 156 VLTKQQAQELLALFDKNCSNHLFHYTIGDLHIDDLWVNSPLLLAAICTVASRYHP 210

>NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}
          Anc_7.512
          Length = 906

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 13 AGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          A +T   +   + K +R F AC+ CR +K KCD          PC +C+++G  C+ 
Sbjct: 26 ANSTDQHQQDTNHKRKRKF-ACVECRQQKSKCD---AYEKAPDPCTKCQKKGVPCVL 78

>TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON}
          Anc_7.512 YLR451W
          Length = 923

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          AC+ CR +K KCD     +    PC RC + G TC+ 
Sbjct: 37 ACVECRQQKSKCD---AYDRAPEPCTRCMKRGLTCVL 70

>KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa]
          {ON} Anc_7.512 YLR451W
          Length = 846

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 14 GTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKP-PCVRCRREGKTCIF 69
          G T+S  S  +   ++   AC+ CR +K KCD     +   P PC +C ++G  C+ 
Sbjct: 19 GNTSSNMSVANTAARKRKFACVECRQQKSKCD----AHERAPEPCSKCAKKGVPCVL 71

>Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106W
          (REAL)
          Length = 867

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 21 SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          S +  +  R    CI C+ RK+KCD        +P C RCR+  K C +
Sbjct: 3  SDKSARRPRPSFVCIPCKSRKLKCD------RLRPVCTRCRKTSKQCTY 45

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +R+ +AC  CR RK KCD     +P+   C  C + G  CIF
Sbjct: 172 RRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIF 210

>CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa]
          {ON} weakly similar to uniprot|Q03631 Saccharomyces
          cerevisiae YML076c
          Length = 945

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          +R+  AC+ C   K KC    + + ++ PCVRC R    CIF
Sbjct: 56 KRNTFACVKCHDLKQKCRPSDVGDIYRNPCVRCLRSRDPCIF 97

>ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {ON}
           conserved hypothetical protein
          Length = 686

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANL---STM 84
           +RS   C++CR RK KCD        KP C  CRR    CI+  G +   + +    S  
Sbjct: 28  KRSKSGCLTCRNRKKKCD------ETKPLCKGCRRNFLQCIWPQGNSKRKTNDQKEDSYQ 81

Query: 85  NGKNNQATFTGIKRALSVDANSTLNS 110
           NG  N  T   +   + +D+ + LN+
Sbjct: 82  NGFYN-LTIHDMIGEVELDSKTKLNT 106

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          K ++  RACI CR R +KC       P   PC +C      C FS
Sbjct: 51 KKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFS 88

>KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa]
          {ON} Anc_6.60 YLR266C possible pseudogene; N added to
          avoid frameshift
          Length = 855

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 11 DEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCR-REGKTCIF 69
          D A  T  +R +   K ++  ++C  CR RK+KCD        KP C  C+ R  + C++
Sbjct: 22 DAAKITKKRRKASVNKKRKPIKSCAFCRRRKLKCD------QRKPICSSCKSRNFQVCMY 75

Query: 70 S 70
          +
Sbjct: 76 T 76

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON}
          conserved hypothetical protein
          Length = 750

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMNGK 87
          +RS   C++CR RK KCD        +P C  C+R    C++ +   G +       +G+
Sbjct: 30 KRSKSGCLTCRKRKKKCDEA------RPRCTGCKRNLLDCVWVNEAQGTAQPEFEKKDGE 83

Query: 88 N 88
          +
Sbjct: 84 S 84

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          R++  C +CR RK+KCD        KP C RC +    C
Sbjct: 11 RTYSGCWTCRSRKIKCD------QQKPQCKRCLKANLKC 43

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
           YMR280C
          Length = 1237

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 21  SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
           SSR     R+ +AC  CR++K+KCDL       +P C  C   G  C  S
Sbjct: 163 SSRPDAAGRASQACDRCRLKKIKCDL------KRPQCSSCASVGFECKLS 206

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 3   SASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRR 62
           SA      D+ G T  ++ SR+         C  C+ R++KCD        KP C +C R
Sbjct: 124 SAVTSTVTDKKGNTVKRKYSRN--------GCSECKRRRMKCD------ETKPTCWQCAR 169

Query: 63  EGKTCIF 69
             + CI+
Sbjct: 170 LNRHCIY 176

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           K +R+  AC +C  +K KC    + + ++ PCVRC +  K C F
Sbjct: 104 KPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKF 147

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 38.5 bits (88), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 7/38 (18%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          ACI+CR R+ KCD+       + PC  C + G  C+F+
Sbjct: 18 ACITCRQRRRKCDM-------QEPCSICIKFGTRCVFT 48

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 38.5 bits (88), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 9/53 (16%)

Query: 20 RSSRDIK--WQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          + S+D K   +R+ RAC++CR RKVKC         + PC  CR     C ++
Sbjct: 2  KVSKDTKKPAERAARACLNCRRRKVKCS-------GQSPCANCRNYNCACTYA 47

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON}
          Anc_7.512 YLR451W
          Length = 869

 Score = 38.5 bits (88), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 27 WQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          ++R   AC+ CR +K +CD          PC +C+++G TC+ 
Sbjct: 41 YRRKKFACVECRQQKSRCDAS---EKAPGPCTKCKQKGVTCVL 80

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
          RGT1Glucose-responsive transcription factor that
          regulates expression of several glucose transporter
          (HXT) genes in response to glucose; binds to promoters
          and acts both as a transcriptional activator and
          repressor
          Length = 1170

 Score = 38.5 bits (88), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          K  ++ RAC  CR +K+KCD        K  C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDEKGVCSNCQRNGDRCSF 78

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 6/40 (15%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          +RS +AC  CR++K+KCD        +P C  C++ G  C
Sbjct: 23 KRSSQACDRCRLKKIKCD------GLRPSCTSCKKIGYQC 56

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 844

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          +D  G   S  S+   K+  +S   C  C+ R+VKCD G      KP C +C +    C+
Sbjct: 29 VDIGGKKVSTTSTGKRKFHNKSKNGCDHCKRRRVKCDEG------KPMCDKCVKMKLECV 82

Query: 69 FS 70
          ++
Sbjct: 83 YT 84

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
          {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
          lactis KLLA0A03421g and weakly similar to YAL051W
          uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate- activated transcription factor acts alone and
          as a heterodimer with Pip2p activates genes involved in
          beta- oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 946

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 6/37 (16%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           C SCR  K KCD        KP C RC R G  CI+
Sbjct: 28 VCQSCRKSKTKCD------KQKPSCSRCLRLGHQCIY 58

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 10 IDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          I+ +    +K S + IK   +F  C +CR RK+KCDL       KP C +C      C
Sbjct: 5  IERSQAKNNKNSYKRIK---TFTGCWTCRSRKIKCDLT------KPSCRKCTNSRIEC 53

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
          (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 38.5 bits (88), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          E  TT S  S R  + + SF  C SCR  K KCD        KP C RC + G  C++
Sbjct: 10 EVKTTQSAHSGR--RNRLSF-VCQSCRKGKTKCDRA------KPSCSRCLKHGIRCVY 58

>TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON}
          Anc_8.423 YLR228C
          Length = 810

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 11/57 (19%)

Query: 19 KRSSRDIKWQRSFR-----ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          KR SR    +R F       C +C+ R+VKCD G      KP C +C      C+++
Sbjct: 30 KRVSRTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACQKCLNMKLDCVYT 80

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON}
          similar to uniprot|P07272 Saccharomyces cerevisiae
          YLR014C PPR1 Zinc finger transcription factor
          containing a Zn(2)-Cys(6) binuclear cluster domain
          positively regulates transcription of genes involved in
          uracil biosynthesis activity may be modulated by
          interaction with Tup1p
          Length = 906

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 10 IDEAGTTASKRSSRDI-KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          ID + +   KR S  I    RS  AC  CR++KVKCD         P C +C    + C+
Sbjct: 18 IDTSYSKQKKRPSSSILGISRSIAACKRCRLKKVKCD------QKFPSCSKCASANEPCV 71

>KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.264
           YDR034C
          Length = 741

 Score = 38.1 bits (87), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 15  TTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +T   ++   +K + S   C+ C+ R++KCD        KP C +C R  + C++
Sbjct: 120 STHGSKNGHIVKRKYSRNGCVECKRRRMKCD------ETKPKCWQCDRLNRDCVY 168

>KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON}
          conserved hypothetical protein
          Length = 597

 Score = 38.1 bits (87), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGN---GMSSANLSTM 84
          +RS   C+ CR RK KCD        KP C  C+R    CI+ +  N   G     +S +
Sbjct: 5  KRSSTGCLICRRRKKKCD------EVKPTCTACKRNFLECIWPNSSNTKDGKVGKKISQV 58

Query: 85 NGKNNQATFTGIK 97
            ++ +   T +K
Sbjct: 59 ESEDTKFNITHLK 71

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON}
          Anc_5.235 YLR014C
          Length = 862

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          E G++  + SS      +S  AC  CR++K+KCD         P C++C R    C+
Sbjct: 8  EDGSSKKRPSSAVAGITKSISACKRCRLKKIKCD------QEFPSCLKCARVKVPCV 58

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 11/98 (11%)

Query: 16  TASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS-GGN 74
            +S  +S+  K QR  +AC+ CR RK KC+        K PC  C   G  C ++   G+
Sbjct: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCN-------GKSPCEMCIAYGYACHYTDVDGS 54

Query: 75  GMSSANLSTMNGKNNQA-TFTGIKR--ALSVDANSTLN 109
             S     T  G +N+  +   I R  A SVDA +  N
Sbjct: 55  STSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTN 92

>NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}
          Anc_7.512
          Length = 944

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          +R F AC+ CR +K KCD     +    PC +C+++G  C+ 
Sbjct: 43 KRKF-ACVECRQQKSKCD---AYDKAPDPCTKCQKKGVPCVL 80

>KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON}
          Anc_8.423 YLR228C
          Length = 864

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 14 GTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          G   SK S+   K+  +S   C++C+ R+VKCD        KP C++C      C++
Sbjct: 34 GKKVSKTSTGKRKFHNKSKTGCLNCKRRRVKCD------ETKPFCIKCTNMKLDCVY 84

>Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451W
          (REAL)
          Length = 886

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 8/73 (10%)

Query: 1  MLSASNERAIDEAGTTASKRSSRD---IKWQRSFRACISCRMRKVKCDLGPLENPHKP-P 56
          M   SN  A  ++G+  S   +R+   I  ++   AC+ CR +K KCD     +   P P
Sbjct: 1  MEGRSNSVATSQSGSEMSHSETRNRAGINARKRKFACVECRQQKSKCD----AHERAPEP 56

Query: 57 CVRCRREGKTCIF 69
          C +C ++   CI 
Sbjct: 57 CTKCAKKNVPCIL 69

>AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; No
          homolog in Saccharomyces cerevisiae
          Length = 612

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 11/60 (18%)

Query: 10 IDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          + EAG     R S+  K       C  C+ RKVKCD        KP C +C   GK C++
Sbjct: 3  VPEAGRKGVARRSKYSK-----NGCSECKRRKVKCD------ETKPACWQCSHLGKRCVY 51

>Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {ON}
           similar to Ashbya gossypii ACR209W + ACR208C
          Length = 856

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 47/118 (39%), Gaps = 28/118 (23%)

Query: 32  RACISCRMRKVKCD---LGPLENPHKPPCVRCRREGKTCIF---SSGGNGMSSANLSTMN 85
           RAC++CR RK++CD    G +    +  C  C   G  CIF     GG  M    L    
Sbjct: 16  RACLACRKRKIRCDGETRGTVVEDGQRVCSNCANHGLKCIFVRSQRGGRRMPRKKLQHAT 75

Query: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWK-LELASMQNS 142
            +N  +          +D+N T                YK  P + +  L++A++ NS
Sbjct: 76  SENKTS---------CIDSNDT------------NRQGYKESPFQTFNALQIANLDNS 112

>Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON}
          [contig 161] FULL
          Length = 755

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 1  MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
          M +A+ + AI   G +A+    R  K  RS   C +CR+R+ KCD        +P C  C
Sbjct: 1  MGAATTQPAI-STGNSATALMLRP-KRNRSRAGCFTCRLRRKKCDEA------RPKCGTC 52

Query: 61 RREGKTCIFSSGGNG 75
           +    CI+   G G
Sbjct: 53 SKHMLKCIWPRKGQG 67

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 11/61 (18%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMNGKN 88
          R  RAC  CR RKVKCD          PC  C      CI+    NG++  ++ +   ++
Sbjct: 16 RVIRACDVCRKRKVKCD-------GDQPCSSCMTASTVCIY----NGVAFPHVKSFYHRD 64

Query: 89 N 89
          N
Sbjct: 65 N 65

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 25 IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          +K +R  RAC  CR +KVKCD        + PC+ C      C ++
Sbjct: 28 VKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 66

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          K  ++ RAC  CR +K+KCD        +  C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDERGVCTNCQRNGDRCSF 78

>Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 3   SASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRR 62
           SA      D+ G T  ++ SR+         C  C+ R++KCD        KP C +C R
Sbjct: 130 SAVTSTVTDKKGNTVKRKYSRN--------GCSECKRRRMKCD------ETKPTCWQCAR 175

Query: 63  EGKTCIF 69
             + C++
Sbjct: 176 LNRQCVY 182

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {ON}
           weakly similar to uniprot|Q6B2M3 Saccharomyces
           cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
           transcription factor that activates genes involved in
           multidrug resistance paralog of Yrr1p acting on an
           overlapping set of target genes
          Length = 771

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 17  ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC-RREGKTCIFSSGGN 74
           AS + S   + ++  ++C  CR RK+KCD        KP C  C  R+   CI++ G N
Sbjct: 51  ASSKPSTRRRRRKVIKSCTFCRQRKMKCD------QQKPMCGSCVERKLSECIYTDGFN 103

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 23 RDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          R  + QRS  AC+SCR R +KC       P   PC +C      C
Sbjct: 23 RQGRQQRSSIACLSCRKRHIKC-------PGGNPCQKCVASNAIC 60

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +R  RAC  CR RK+KCD  P+ NP    C  C +    C F
Sbjct: 112 KRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTF 150

>KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} similar
          to uniprot|P26370 Saccharomyces cerevisiae YDL170W UGA3
          Transcriptional activator necessary for gamma-
          aminobutyrate (GABA)-dependent induction of GABA genes
          (such as UGA1 UGA2 UGA4) zinc- finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type localized to the nucleus
          Length = 623

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 13/55 (23%)

Query: 15 TTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          T  +KR+ R          C+ C++RK +C      + HKP C  C+R G  C++
Sbjct: 15 TACAKRTHRKT-------GCVPCKIRKKRC------SEHKPVCTDCQRLGFYCVY 56

>KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa]
          {ON} similar to uniprot|Q05958 Saccharomyces cerevisiae
          YLR228C ECM22 Sterol regulatory element binding protein
          regulates transcription of the sterol biosynthetic
          genes ERG2 and ERG3 member of the fungus-specific
          Zn[2]-Cys[6] binuclear cluster family of transcription
          factors homologous to Upc2p
          Length = 775

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 10 IDEAGTTASKRSSRDIKW-QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
          I+  G T SK ++   K+ ++S   C  C+ R+VKCD        +P C+ C++    C+
Sbjct: 32 IELHGKTVSKTATGKRKFHKKSKNGCDHCKRRRVKCD------ETRPHCLNCKKMSLDCV 85

Query: 69 FS 70
          ++
Sbjct: 86 YT 87

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 13/65 (20%)

Query: 5  SNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREG 64
          S  ++I+++  T  KR      ++ SF  C  CR  KVKCD        KP C RC +  
Sbjct: 18 SPSKSINDSQVTKKKR------YRLSF-VCQGCRRSKVKCD------QEKPVCSRCSKHD 64

Query: 65 KTCIF 69
            C++
Sbjct: 65 LECVY 69

>TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON}
          Anc_5.322 YHR056C
          Length = 852

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLS 82
          AC+ CR RK+ CD        KP C  C + GK   F     GM + ++S
Sbjct: 13 ACVQCRRRKIGCD------RVKPVCGNCNKSGKYDCFFPDVPGMYTPSVS 56

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           K +R+  AC+ C   K KC+   + + ++ PC RC +  K C F
Sbjct: 68  KTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKF 111

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 6/40 (15%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          +RS +AC  CR++K+KCD        +P C  C++ G  C
Sbjct: 24 KRSSQACDRCRLKKIKCD------GVRPSCTSCKKIGYQC 57

>Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON}
          YBL066C (REAL)
          Length = 1159

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 5/41 (12%)

Query: 28 QRSFRACISCRMRKVKCDLGPLEN-PHKPPCVRCRREGKTC 67
           R   +C  CR  K+KCD    +N PH  PC RC++ G  C
Sbjct: 47 HRPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCQKIGLHC 83

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 34/82 (41%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85
           K +R+  AC+ C   K KC    + + +  PC RC R  + C F            ++  
Sbjct: 54  KLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKFDLSKRTRKRKPKNSAT 113

Query: 86  GKNNQATFTGIKRALSVDANST 107
              +    +G+KR  S+   ST
Sbjct: 114 PSRSPTPLSGLKREPSMGEQST 135

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           K  R    C SCR  K KC      N  KP C RC++ G  C++
Sbjct: 66  KRNRISFVCQSCRKSKTKC------NKDKPSCSRCKKLGIFCVY 103

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 19 KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          ++  + +K +R  RAC  CR +KVKCD        + PC+ C      C +
Sbjct: 6  QQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 49

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 17  ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKT-CIFSSGGN 74
           AS  + +  K ++  ++C  CR RK+KCD        +P C  C+  G + C+++ G N
Sbjct: 73  ASTSNGKVRKRRKVIKSCTFCRKRKLKCD------RKRPMCTGCKMRGLSECVYTDGYN 125

>ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON}
          NOHBY314; No homolog in Saccharomyces cerevisiae
          Length = 109

 Score = 35.0 bits (79), Expect = 0.14,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKP-PCVRCRREGKTC 67
          K ++  R+C+ CR  K+KCD        +P PC  C ++G  C
Sbjct: 23 KMKKPLRSCVRCRKNKIKCD----SATRRPKPCSSCLKKGVGC 61

>ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {ON}
           similar to gnl|GLV|CAGL0F06743g Candida glabrata
           CAGL0F06743g and similar to YIR023W uniprot|P21657
           Saccharomyces cerevisiae YIR023W DAL81 Positive
           regulator of genes in multiple nitrogen degradation
           pathways contains DNA binding domain but does not appear
           to bind the dodecanucleotide sequence present in the
           promoter region of many genes involved in allantoin
           catabolism
          Length = 1106

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 13/90 (14%)

Query: 32  RACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNG----MSSANLSTMNGK 87
           R C  CR R+ KC L     P    CV+C  +G  C FS   N     M  A+    NGK
Sbjct: 212 RPCDHCRRRQTKCVLV----PDLADCVQCETKGIKCTFSDLPNNVNKFMGVADTMNPNGK 267

Query: 88  ----NNQATFTGIKRALSVDANSTLNSQYH 113
               +N     G+ +   ++ N  + +QY+
Sbjct: 268 HQRQDNGVDLEGLLKRAKINNNDNV-AQYY 296

>ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]
           {ON} conserved hypothetical protein
          Length = 707

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 20/157 (12%)

Query: 194 YLTPLTTPHNSRRSA-LPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFL 252
           Y T   T HN      LP L   ++   K++ T  ++     +K+LS +EA+EL+ +F  
Sbjct: 183 YPTASITNHNGASPVELPPLSTLMNNNGKTAGTPLEL-----NKVLSIDEAKELMQIFME 237

Query: 253 TMNPFFPHIPLQLQDADEL-VRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVH 311
            M        L+   A EL  R P+LL +I  ++  +HP          P   K+   + 
Sbjct: 238 NMAQHMLGYQLENLSARELWYRCPVLLLSICAVACPHHP----------PLASKQGQLIS 287

Query: 312 EKLWIYCQRLISQTVWAEASTRSI-GTIFAFIIFTEW 347
              W +C RL++    A   T+++  TI A II + W
Sbjct: 288 SLKW-HCSRLLNDYE-AVYETKAVEQTILALIIASLW 322

>AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YDR303C
          (RSC3) and YHR056C (RSC30)
          Length = 809

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 19/65 (29%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF---------SSGGNGMS----SA 79
          AC+ CR RK+ CD        KP C  C R GK+  F          SGG G +    SA
Sbjct: 15 ACVQCRKRKIGCDRA------KPLCGNCVRNGKSDCFYPDIPGVYAQSGGGGATPPGKSA 68

Query: 80 NLSTM 84
           L+++
Sbjct: 69 ELASV 73

>SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1228

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 55/137 (40%), Gaps = 27/137 (19%)

Query: 32  RACISCRMRKVKCDLGPLENPHKPPCVRCRREGKT--CIFSSGGNGMSSANLSTMNGKNN 89
           ++C+ CR RKVKCD        KP C+ C R   T  C +    + M    +  +N   +
Sbjct: 13  KSCLVCRRRKVKCD------KTKPVCLACVRHQSTMQCDYDINNDNMIIFQVPDINQPAS 66

Query: 90  QATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEFLAKA 149
            +      +      N+T+ S           N  K L   K KL+      SLE L + 
Sbjct: 67  GSRINKTSKKGQATKNTTIES-----------NVTKELDFLKSKLQ------SLEALLQ- 108

Query: 150 ADSVAHQSNPESFKETA 166
            + VA   N E  K++A
Sbjct: 109 -NQVAQDQNKEELKKSA 124

>Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar to
          Ashbya gossypii ABR174W
          Length = 884

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 14 GTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          G    + SS + K +R   AC+ CR +K KCD     +    PC RC ++   C+ 
Sbjct: 19 GEMYVRSSSDERKQKRKKFACVECRQQKSKCD---AHDRAPEPCTRCFKKNVPCVL 71

>Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AGL206C
          Length = 739

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS--GGNGMSSANLSTMN 85
           +RS   C++CR R+ KCD        KP C+ C+R    C +S   GG+  +S N   + 
Sbjct: 45  KRSRNGCLTCRARRKKCD------ETKPKCIGCQRNLLLCRWSDKEGGSTETSPNGDEVG 98

Query: 86  GKNNQA 91
            K N  
Sbjct: 99  IKANDG 104

>ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR064W
          Length = 795

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 36/86 (41%), Gaps = 14/86 (16%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREG--KTCIF-----SSGGNGMSS 78
           K QR    C +C+ RK +CD G      KP C  C R G  +TC +       GG+G  S
Sbjct: 6   KRQRQTLVCSNCKRRKSRCDRG------KPACGNCIRLGNRETCHYFISPSEKGGDGGDS 59

Query: 79  ANLST-MNGKNNQATFTGIKRALSVD 103
              ST  NG   +  F        VD
Sbjct: 60  PGESTGSNGALERCQFVRAHSCGRVD 85

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
          YOR363C
          Length = 951

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 13/58 (22%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          +AG    KR+       R    C +CR  K KCD        KP C RCR++   C++
Sbjct: 50 KAGKVVKKRN-------RISFVCQACRKAKTKCD------KEKPMCSRCRKQDLECVY 94

>TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]
           {ON} Anc_4.344 YML076C
          Length = 1435

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 27  WQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           ++RS  AC+ C   K KC      + ++ PC RC +  + C F
Sbjct: 336 FKRSTFACVRCHSLKQKCLPSDFNDIYRKPCKRCLKTNRLCKF 378

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
          similar to uniprot|P46954 Saccharomyces cerevisiae
          YJL089W SIP4 Possibly involved in Snf1p regulated
          transcriptional activation shows homology to DNA
          binding domain of Gal4p has a leucine zipper motif and
          acidic region lexA-Sip4p activates transcription
          Length = 919

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 6/40 (15%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          +RS +AC  CR++K+KCD        KP C  C++ G  C
Sbjct: 23 ERSSQACDRCRLKKIKCD------GLKPNCTSCKKVGFHC 56

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          K  ++ RAC  CR +K+KCD        K  C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDEKGLCSNCQRNGDRCSF 78

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          K +R  RAC  CR +KVKCD        K PC+ C      C ++
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTYN 43

>KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {ON}
           conserved hypothetical protein
          Length = 728

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 99/241 (41%), Gaps = 20/241 (8%)

Query: 11  DEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
           +++ +  SK        QR+ +AC SCR  K +C   PL  P +  C+RC      C F 
Sbjct: 3   EKSSSKVSKPRKLKKNGQRALKACDSCRRMKTRCIPSPL--PEEVQCLRCDTFNLRCSFQ 60

Query: 71  SGGNGMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPRE 130
              +    A    +  +   ++ TG         ++T  S   T ++ K+  +      E
Sbjct: 61  DLLSDDEGAETLALLKEQKSSSGTG---------SATYESAELTKRLLKSGYS-----PE 106

Query: 131 KWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNG--ASNDTSENDTPVQQQD 188
            + +    +QN  + + K  + +A+Q+ P + + ++  A  G  +S   S     VQ   
Sbjct: 107 DFAVHAKLLQNVNKNVTKILELLANQAPPAAPESSSHPAAPGNPSSRAVSALTEAVQMMT 166

Query: 189 SPNENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELID 248
           S + + L P        R   P+L+  IS +    + L+      P  ++S+  +RE + 
Sbjct: 167 SSSGHTLVPSGLVGPESREVSPELD-DISAKRTEQRHLTPY-LTCPFTMVSQMVSRENLP 224

Query: 249 L 249
           L
Sbjct: 225 L 225

>NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON}
          Anc_2.547
          Length = 924

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 10/70 (14%)

Query: 1  MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
          M +++NE    ++ T  SK+ S+        RAC  C  R+++C+   + N     C  C
Sbjct: 24 MSNSNNEPTSPKSLTETSKKRSK------VSRACDQCHKRRIRCNYNKVTN----MCAGC 73

Query: 61 RREGKTCIFS 70
          +R G+ C+F+
Sbjct: 74 KRIGEHCLFT 83

>Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480
          aa] {ON} ANNOTATED BY YGOB - possible frameshift into
          ORF downstream
          Length = 480

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          ++  R+CI CR  K KCD      PH  PC  C R+G +C
Sbjct: 15 KKPLRSCIRCRKNKTKCD-SLHTRPH--PCTSCARKGVSC 51

>Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON}
          YBL066C (REAL)
          Length = 1155

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 28 QRSFRACISCRMRKVKCDLGPLEN-PHKPPCVRCRREGKTC 67
           R   +C  CR  K+KCD    +N PH  PC RC + G  C
Sbjct: 52 HRPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCEKIGLHC 88

>KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa]
          {ON} similar to uniprot|P08638 Saccharomyces cerevisiae
          YLR451W LEU3 Zinc-finger transcription factor that
          regulates genes involved in branched chain amino acid
          biosynthesis and ammonia assimilation positively
          regulated by alpha-isopropylmalate an intermediate in
          leucine biosynthesis
          Length = 925

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKP-PCVRCRREGKTCIF 69
          Q+   AC+ CR +K KCD     +   P PC RC ++G  C+ 
Sbjct: 43 QKKKLACVECRQQKSKCD----AHERAPEPCSRCLKKGVPCVL 81

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206c
          Length = 832

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 43/99 (43%), Gaps = 12/99 (12%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANL---- 81
           + QR  RAC  C+ RK KC  G        PC  CR+    CI+    +   S +L    
Sbjct: 28  RTQRLSRACDLCKKRKTKCQGG-------NPCQSCRKANIQCIYREIASHDKSHDLILGS 80

Query: 82  -STMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKK 119
            + +  ++       +K++L V+   T++S  +   + K
Sbjct: 81  PNKIKKRSGPLLAVKVKKSLKVNNGDTIHSANYQQDVPK 119

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 7/42 (16%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          + QRS  AC+SCR R +KC       P   PC +C      C
Sbjct: 26 RQQRSSVACLSCRKRHIKC-------PGGNPCQKCVTSNAIC 60

>Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343
          bp, 780 aa] {ON}
          (9848..11548,11550..11612,11615..12193) [2343 nt, 781
          aa]
          Length = 780

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRC-RREGKTCIFSSGGN 74
          ++  ++C  CR RK+KCD G      +P C +C  RE   CI++ G N
Sbjct: 30 RKVIKSCTFCRKRKLKCDHG------RPMCNQCSSRELPECIYTEGFN 71

>YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}
           LYS14Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway; requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 790

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 15  TTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +T + +    +K + S   C  C+ R++KCD        KP C +C R  + C++
Sbjct: 140 STVTDKKGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVY 188

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSG 72
          R  +AC  C+ RKVKCD          PC  C + G+ C + SG
Sbjct: 12 RVRKACEICKRRKVKCD-------GSQPCANCVKHGQECKYISG 48

>TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa]
          {ON} 
          Length = 777

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGG 73
          R  R C SCR++K+KCD        +P C RC +  + C + +  
Sbjct: 10 RISRVCNSCRIQKLKCD------RERPSCKRCLKNKRPCYYDTSS 48

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
          uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          K +R  +AC  CR++K+KCD        KP C  C++ G  C
Sbjct: 55 KVKRFSQACDRCRLKKIKCD------GIKPSCSNCKKIGYHC 90

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 10  IDEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
           I+  G   SK ++   K+  +S   C +C+ R+VKCD G      KP C +C +   +C+
Sbjct: 64  IEVDGKKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEG------KPGCQKCLKMRLSCV 117

Query: 69  FS 70
           ++
Sbjct: 118 YT 119

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 7/37 (18%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          ACI+CR RK+KC         K PC  C     TC+F
Sbjct: 14 ACINCRKRKIKCT-------GKHPCTNCISYNCTCVF 43

>Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}
           complement(38664..41510) [2847 nt, 949 aa]
          Length = 948

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 10  IDEAGTTASKRSSRDIKW-QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCI 68
           ++  G T SK S+   K+ ++S   C +C+ R+VKCD        KP C +C      C+
Sbjct: 86  VNVGGKTFSKTSTGKRKFHKKSKNGCDNCKRRRVKCD------ESKPICQKCINMKLNCV 139

Query: 69  FS 70
           ++
Sbjct: 140 YT 141

>YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}
          SEF1Putative transcription factor, has homolog in
          Kluyveromyces lactis
          Length = 1148

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 28 QRSFRACISCRMRKVKCDLGPLEN-PHKPPCVRCRREGKTC 67
           R   +C  CR  K+KCD    +N PH  PC RC + G  C
Sbjct: 51 HRPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCEKIGLHC 87

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 22 SRDIKWQRSFRACISCRMRKVKCD---LGPLENPHKPPCVRCRREGKTCIFSSGGNG 75
          + D K + + RAC++CR +K+KCD      L       C  C   G  C+F +   G
Sbjct: 7  TSDPKRKVARRACLTCREKKIKCDGEVRASLGGSDPGICSNCAASGSKCVFVASMRG 63

>SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON}
          conserved hypothetical protein
          Length = 770

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          K +R+ RAC SCR  K +C   PL  P++  C+RC      C F
Sbjct: 22 KGKRALRACDSCRRLKTRCIPSPL--PNEIQCLRCDSLKLRCSF 63

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           K +R+  AC+ C   K KC+     + ++ PC RC +  K C F
Sbjct: 67  KIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKF 110

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
           Anc_7.56 YOR337W
          Length = 757

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 89/214 (41%), Gaps = 31/214 (14%)

Query: 33  ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGG---NGMSSANLSTMNGKNN 89
           AC +CR R+ KCD+       + PC  C R G  C  +         SS+++ T+    +
Sbjct: 50  ACSNCRKRRKKCDV-------EYPCGGCSRLGLECNINEEDLRKTRHSSSHVKTLEAHIS 102

Query: 90  QATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEFLAKA 149
                 I+R +S+ ++   N+      +  T+   K  P  K      S  + +  +AKA
Sbjct: 103 NLE-KDIQRMVSIFSS---NASEFDHNLMPTDIIIKYFPLTKSSSTSMSNSSDVANIAKA 158

Query: 150 ADSVAHQSNPESFKETAKLAKNGASNDTSENDTPVQQQDSPNENYLTPLTTPHNSRR--- 206
            +S++  S+      T KL +       S++DT + ++ S ++ Y       HN R+   
Sbjct: 159 KESISVGSSTTDITRTVKLEETDPIL-RSKSDTEIVEKTSLDQTY-------HNVRKKKA 210

Query: 207 ----SALPQLEKSISIRPKSSQTLSDMEFIGPSK 236
               S  P  E  +S +PK   T   + F+   K
Sbjct: 211 LVKGSLYP--EGPVSYKPKIKSTNLTISFLVSEK 242

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 46/129 (35%), Gaps = 36/129 (27%)

Query: 1   MLSASNERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60
           M+ ++N   +  +G  + KR S+         AC  CR RK++CD     +P    C  C
Sbjct: 112 MVESTNSNDLGASGKNSKKRVSK---------ACDHCRKRKIRCDEV---DPQTDKCSNC 159

Query: 61  RREGKTCIFS------------------------SGGNGMSSANLSTMNGKNNQATFTGI 96
            +    C F                            N +SS   S++ G N+   F   
Sbjct: 160 VKFQSVCTFKHRDEILQKKRKLEIKQHLASEKSPQSQNNVSSYASSSLPGNNDNGRFESF 219

Query: 97  KRALSVDAN 105
               S+++N
Sbjct: 220 NSGASLESN 228

>ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa]
          {ON} similar to uniprot|P08638 Saccharomyces cerevisiae
          YLR451W LEU3 Zinc-finger transcription factor that
          regulates genes involved in branched chain amino acid
          biosynthesis and ammonia assimilation positively
          regulated by alpha-isopropylmalate an intermediate in
          leucine biosynthesis
          Length = 860

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          AC+ CR +K KCD     +    PC +C+++G  C+ 
Sbjct: 45 ACVECRQQKSKCD---AHDRAPEPCTKCQKKGVPCVL 78

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          K  ++ RAC  CR +K+KCD        +  C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDERGVCSNCQRNGDRCSF 78

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 994

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 13 AGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          +G++    ++R  K  R    C +CR  K +CD        KP C RC++    C++
Sbjct: 6  SGSSPEGNAARTRKRNRISFVCQACRRSKTRCD------KEKPICTRCKKLKLECVY 56

>Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON}
          YBL066C (REAL)
          Length = 1150

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 28 QRSFRACISCRMRKVKCDLGPLEN-PHKPPCVRCRREGKTC 67
           R   +C  CR  K+KCD    +N PH  PC RC + G  C
Sbjct: 55 HRPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCEKIGLHC 91

>ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 807

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 6/37 (16%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           C SCR  K KCD        KP C RC + G  C++
Sbjct: 38 VCQSCRRSKTKCD------KVKPSCTRCVKNGSVCVY 68

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 8/58 (13%)

Query: 12 EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHK-PPCVRCRREGKTCI 68
          E   +  + SS  +   +S  AC  CR +K+KCD       H+ P C +C R  K C+
Sbjct: 11 EEEVSRKRPSSVVVGITKSISACKRCRTKKIKCD-------HEFPSCKKCARANKPCV 61

>YDL170W Chr4 (156318..157904) [1587 bp, 528 aa] {ON}
          UGA3Transcriptional activator necessary for
          gamma-aminobutyrate (GABA)-dependent induction of GABA
          genes (such as UGA1, UGA2, UGA4); zinc-finger
          transcription factor of the Zn(2)-Cys(6) binuclear
          cluster domain type; localized to the nucleus
          Length = 528

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 25 IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS 71
          +K + S   CI+C++RK +C      +  KP C  CRR    CI+ S
Sbjct: 8  LKLKYSKHGCITCKIRKKRC------SEDKPVCRDCRRLSFPCIYIS 48

>TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {ON}
           Anc_3.264 YDR034C
          Length = 770

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 25  IKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           IK + S   C  C+ R++KCD        KP C +C R  + C++
Sbjct: 131 IKRKYSRNGCTECKRRRMKCD------ETKPTCWQCSRLNRHCVY 169

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
          (PPR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
          FULL
          Length = 881

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 6/63 (9%)

Query: 6  NERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGK 65
          N+  + E      + +S  +   RS  AC  CR+RKVKCD         P C RC    +
Sbjct: 21 NDVQLKEQSNRKRRPTSAIMGISRSIAACKRCRIRKVKCD------QKFPSCSRCVSANE 74

Query: 66 TCI 68
           C+
Sbjct: 75 PCV 77

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa]
          {ON} Anc_6.279
          Length = 960

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 28 QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFS 70
          ++S +AC  CR++K+KC         KP C +C + G  C +S
Sbjct: 6  EKSEQACDICRIKKLKCSR------EKPKCAKCMKNGWECCYS 42

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 7/42 (16%)

Query: 26 KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          K +RS  AC  CR R +KC       P   PC +C + G  C
Sbjct: 38 KVKRSSLACTRCRRRHIKC-------PGGNPCSKCLKAGVAC 72

>CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa]
           {ON} similar to uniprot|P40971 Saccharomyces cerevisiae
           YDR034c LYS14 transcriptional activator of lysine
           pathway genes
          Length = 831

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 11  DEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           D  G T  ++ SR+         C  C+ R++KCD        KP C +C R  + C++
Sbjct: 189 DAEGNTVKRKYSRN--------GCAECKRRRMKCD------ESKPKCWQCTRLNRDCVY 233

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
          Anc_4.344 YML076C
          Length = 936

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 21 SSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          + +D K +R   AC+ C   K KC      + ++ PC RC R+   C F
Sbjct: 41 TKKDGKTKRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKF 89

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 6/37 (16%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           C +CR  K+KCD        KP C RC ++G  C++
Sbjct: 49 VCQNCRKSKMKCDR------EKPECTRCLKQGIKCVY 79

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 23 RDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          + ++  ++ +AC++CR +K KCD        +P C +CR     C++
Sbjct: 5  KAVRRNKAIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVY 45

>Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON}
          (88566..91013) [2448 nt, 816 aa]
          Length = 815

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 6/37 (16%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          AC+ CR RK+ CD G      KP C  C +  KT  F
Sbjct: 14 ACVQCRRRKIGCDRG------KPICGNCAKSHKTDCF 44

>TDEL0E03050 Chr5 (575425..577893) [2469 bp, 822 aa] {ON}
          Anc_5.322 YHR056C
          Length = 822

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 7/38 (18%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKT-CIF 69
          AC+ CR RK+ CD        KP C  C + GKT C F
Sbjct: 13 ACVQCRKRKIGCDRV------KPICGNCLKNGKTDCFF 44

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa]
          {ON}
          Length = 812

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
          AC+ C   K KC    L + ++ PC +C+R    C+F
Sbjct: 48 ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVF 84

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS--GGNGMSSAN 80
           +R  RAC  CR RK+KCD     +P+   C  C +    C F +    + +++AN
Sbjct: 247 KRVSRACDHCRKRKIKCDEK--RDPNTNKCSNCIKYNSECTFKNWEQNDAIAAAN 299

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON}
          Anc_1.277 YJL089W
          Length = 725

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS 71
          R  +AC  CR++K+KCD        KP C  C++    C  S+
Sbjct: 11 RVSQACDRCRLKKIKCD------GQKPRCSNCKKINFNCAIST 47

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 7   ERAIDEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKT 66
           ++      +T +    + +K + S   C  C+ R++KCD        KP C +C R  + 
Sbjct: 93  QKTAGSVSSTVTDGEGKVVKRKYSRNGCTECKRRRMKCD------ETKPTCWQCARLNRE 146

Query: 67  CIF 69
           C++
Sbjct: 147 CVY 149

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 11  DEAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           D+ G T  ++ SR+         C  C+ R++KCD        KP C +C R  + C++
Sbjct: 138 DKKGNTVKRKYSRN--------GCSECKRRRMKCD------ETKPTCWQCARLNRECVY 182

>TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {ON}
           Anc_4.344 YML076C
          Length = 806

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 28  QRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF 69
           +R+  AC+SC   K KC      + ++ PC RC R  K C F
Sbjct: 70  KRNSFACVSCHSLKQKCVPSDPHDIYRKPCERCLRNFKLCKF 111

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 7/45 (15%)

Query: 23 RDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67
          R  K  RS  AC+SCR R +KC       P   PC +C      C
Sbjct: 23 RQRKQPRSAVACLSCRKRHIKC-------PGGNPCQKCITSNAIC 60

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
          Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 12/55 (21%)

Query: 19 KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGG 73
          K+S   IK     RAC +CR RK+KC           PC  C      C++SSGG
Sbjct: 6  KKSQLKIK-----RACDNCRRRKIKC-------TGTQPCACCVAYQCGCVYSSGG 48

>YHR056C Chr8 complement(215183..217834) [2652 bp, 883 aa] {ON}
          RSC30Component of the RSC chromatin remodeling complex;
          non-essential gene required for regulation of ribosomal
          protein genes and the cell wall/stress response; highly
          similar to Rsc3p; null mutants are osmosensitive
          Length = 883

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 27/73 (36%), Gaps = 23/73 (31%)

Query: 33 ACISCRMRKVKCDLGPLENPHKPPCVRCRREGK-TCIFSSG----------------GNG 75
          AC  CR RK+ CD        KP C  C +  K  C +  G                GNG
Sbjct: 14 ACTQCRKRKIGCDRA------KPICGNCVKYNKPDCFYPDGPGKMVAVPSASGMSTHGNG 67

Query: 76 MSSANLSTMNGKN 88
            S + S  NG N
Sbjct: 68 QGSNHFSQGNGVN 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,403,993
Number of extensions: 4061576
Number of successful extensions: 17068
Number of sequences better than 10.0: 631
Number of HSP's gapped: 17503
Number of HSP's successfully gapped: 651
Length of query: 904
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 785
Effective length of database: 39,836,145
Effective search space: 31271373825
Effective search space used: 31271373825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)