Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F009302.530ON42242220540.0
NDAI0H014202.530ON44845711531e-155
Skud_8.492.530ON44745410841e-145
YHR004C (NEM1)2.530ON44644910551e-140
KAFR0A018302.530ON44244510381e-138
Suva_8.582.530ON45245010291e-136
SAKL0A09416g2.530ON38542310151e-135
Smik_8.532.530ON44644710201e-135
TDEL0A030502.530ON35536010081e-135
CAGL0K02959g2.530ON46447010051e-133
KNAG0C058502.530ON44344710011e-132
Kpol_348.82.530ON4224549851e-130
KLTH0D06776g2.530ON4094499421e-124
Kwal_26.80012.530ON4133729401e-124
TPHA0G035002.530ON3923558971e-117
AGL070W2.530ON3433368521e-111
Ecym_72572.530ON3523898471e-110
ZYRO0B01958g2.530ON3363248451e-110
TBLA0I014602.530ON3933568401e-109
KLLA0E18613g2.530ON3744326761e-84
TPHA0E030705.202ON4941742484e-22
NDAI0D018605.202ON5141742441e-21
TBLA0C060905.202ON4841742431e-21
YLR019W (PSR2)5.202ON3971742412e-21
Suva_10.995.202ON3851802402e-21
Skud_12.875.202ON3921742384e-21
Ecym_71045.202ON4921772404e-21
SAKL0G12870g5.202ON3991642375e-21
Smik_12.535.202ON4141872385e-21
Kpol_2002.1005.202ON4771682379e-21
NDAI0I021705.202ON3911782351e-20
Smik_12.825.202ON3921742341e-20
TPHA0N006705.202ON4521652351e-20
Kpol_478.165.202ON3501742321e-20
CAGL0D03234g5.202ON4101742332e-20
CAGL0D05610g5.202ON4471652342e-20
YLL010C (PSR1)5.202ON4271872332e-20
KLTH0B03388g5.202ON4091742296e-20
NCAS0D027405.202ON3981782296e-20
KNAG0M017405.202ON4811752307e-20
Skud_12.575.202ON4151742289e-20
Suva_10.655.202ON4151642271e-19
ZYRO0B10428g5.202ON4821742272e-19
KAFR0J009905.202ON4831742262e-19
KLLA0F15620g5.202ON4141652252e-19
Kwal_33.151405.202ON4101652252e-19
TDEL0E042705.202ON4531742253e-19
TBLA0H019905.202ON6881642264e-19
AAL158W5.202ON4781752236e-19
NCAS0A068005.202ON4731632112e-17
TDEL0B031908.527ON4771161756e-13
YPL063W (TIM50)8.527ON4761531712e-12
ZYRO0F09130g8.527ON4891161685e-12
SAKL0H10296g8.527ON4781101651e-11
Smik_16.1728.527ON4771161622e-11
Suva_16.2498.527ON4801161613e-11
Kpol_457.58.527ON4891161605e-11
Kwal_27.119908.527ON4741161596e-11
NDAI0E029108.527ON4411161588e-11
KLTH0E12254g8.527ON4761161571e-10
Skud_16.2188.527ON4801161552e-10
NCAS0C022108.527ON4911161552e-10
KLLA0E23101g8.527ON4801601542e-10
TBLA0A005408.527ON4851471491e-09
CAGL0H05159g8.527ON4851161491e-09
TPHA0I020008.527ON4781161462e-09
Ecym_11778.527ON4901101444e-09
ADR045W8.527ON4761091364e-08
KNAG0A020608.527ON4501221355e-08
KAFR0E010208.527ON4481601302e-07
KLTH0C03894g8.839ON74595800.30
ZYRO0A04950g3.188ON61840751.1
NCAS0C004208.839ON725129741.6
CAGL0M02959g8.839ON758128731.9
YAL019W (FUN30)7.80ON113192731.9
Smik_1.487.80ON1124101732.0
Kpol_1068.98.839ON745104722.6
Skud_1.427.80ON112692713.3
YDL101C (DUN1)2.352ON51368713.7
Suva_1.487.80ON112884713.7
NDAI0K004208.839ON778118704.4
ZYRO0E00396gsingletonON36662694.5
TPHA0H026607.80ON104786704.9
Kwal_14.23521.282ON94555705.3
KLLA0F26829g2.603ON20763685.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00930
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   795   0.0  
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    448   e-155
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   422   e-145
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   410   e-140
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   404   e-138
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   400   e-136
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   395   e-135
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   397   e-135
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   392   e-135
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   391   e-133
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   390   e-132
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   384   e-130
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   367   e-124
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   366   e-124
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   350   e-117
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   332   e-111
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   330   e-110
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   330   e-110
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   328   e-109
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   265   1e-84
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...   100   4e-22
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     99   1e-21
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    98   1e-21
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    97   2e-21
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    97   2e-21
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    96   4e-21
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    97   4e-21
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    96   5e-21
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    96   5e-21
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    96   9e-21
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     95   1e-20
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    95   1e-20
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    95   1e-20
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    94   1e-20
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    94   2e-20
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    95   2e-20
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    94   2e-20
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    93   6e-20
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    93   6e-20
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    93   7e-20
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    92   9e-20
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    92   1e-19
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    92   2e-19
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    92   2e-19
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    91   2e-19
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    91   2e-19
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    91   3e-19
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    92   4e-19
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    91   6e-19
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    86   2e-17
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    72   6e-13
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    70   2e-12
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    69   5e-12
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    68   1e-11
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    67   2e-11
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    67   3e-11
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    66   5e-11
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    66   6e-11
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    65   8e-11
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    65   1e-10
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    64   2e-10
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     64   2e-10
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    64   2e-10
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    62   1e-09
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    62   1e-09
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    61   2e-09
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    60   4e-09
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    57   4e-08
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    57   5e-08
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    55   2e-07
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...    35   0.30 
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...    33   1.1  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...    33   1.6  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...    33   1.9  
YAL019W Chr1 (114919..118314) [3396 bp, 1131 aa] {ON}  FUN30Cons...    33   1.9  
Smik_1.48 Chr1 (97867..101241) [3375 bp, 1124 aa] {ON} YAL019W (...    33   2.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...    32   2.6  
Skud_1.42 Chr1 (90362..93742) [3381 bp, 1126 aa] {ON} YAL019W (R...    32   3.3  
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    32   3.7  
Suva_1.48 Chr1 (91216..94602) [3387 bp, 1128 aa] {ON} YAL019W (R...    32   3.7  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...    32   4.4  
ZYRO0E00396g Chr5 complement(21090..22190) [1101 bp, 366 aa] {ON...    31   4.5  
TPHA0H02660 Chr8 complement(622277..625420) [3144 bp, 1047 aa] {...    32   4.9  
Kwal_14.2352 s14 complement(721226..724063) [2838 bp, 945 aa] {O...    32   5.3  
KLLA0F26829g Chr6 (2477782..2478405) [624 bp, 207 aa] {ON} simil...    31   5.5  

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/422 (92%), Positives = 391/422 (92%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS 60
           MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS
Sbjct: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS 60

Query: 61  SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMK 120
           SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMK
Sbjct: 61  SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMK 120

Query: 121 HRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATS 180
           HRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATS
Sbjct: 121 HRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATS 180

Query: 181 AKQLXXXXXXXXXXXXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSM 240
           AKQL                  KRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSM
Sbjct: 181 AKQLSSSKTVKSISSNNTSFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSM 240

Query: 241 SRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYA 300
           SRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYA
Sbjct: 241 SRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYA 300

Query: 301 DPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIII 360
           DPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIII
Sbjct: 301 DPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIII 360

Query: 361 IDNSPISYAMNVENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAFY 420
           IDNSPISYAMNVENAIQVEGWISDPTD             RFTTDVRNVLALKNGEKAFY
Sbjct: 361 IDNSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVRNVLALKNGEKAFY 420

Query: 421 TS 422
           TS
Sbjct: 421 TS 422

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  448 bits (1153), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 249/457 (54%), Positives = 296/457 (64%), Gaps = 45/457 (9%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDED-------- 52
           MNALSY+S  L  P+   KKK+      +++  N  EK  +   AT  N E         
Sbjct: 1   MNALSYVSDSLVLPLQLFKKKD------KKDARNVIEKKVAAGAATEINLEQPYVDRIGK 54

Query: 53  ------------YSTPMADSSSSNTI-----EKSIAVYGSDRALRFSV--LFWTFVLFFP 93
                         TP  + + +N I       S+ V   DR  + +V  + W+F+LFFP
Sbjct: 55  QVGTKKAEESLKKPTPGLEFTDNNFIVEEEGHSSLNV-TDDRKTKNNVTSILWSFLLFFP 113

Query: 94  KFLIVKPLLFLWFIVTFPLYLLERGMKHRT--LLKNK-----LDENSQKNAERVPTTSPE 146
           K LI+KP+LFLW+I+TFPL L+ERG K+R     ++K      DE    N   +P    +
Sbjct: 114 KILIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNNSFLPEEPSK 173

Query: 147 LTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATSAKQLXXXXXXXXXXXXXXXXXXKRMG 206
           L  I+E TEDDL  GD IYLQRD +KGSLLKA+S +Q                   KRMG
Sbjct: 174 LDAINELTEDDLVSGDGIYLQRDNVKGSLLKASSVRQPSLSRSMKTMVSNNTSFSSKRMG 233

Query: 207 KFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVST 266
           KFLFPKKLIP+SI QT RRKKLVLDLDETLIHS+SRGTTH+N SQGHIVEVKFS SGVS 
Sbjct: 234 KFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSM 293

Query: 267 LYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCIL 326
           LYYVHKRPYCDFFLSKV KWYDLIIFTASMKEYADPVIDWLE S    F++R YRTDCI 
Sbjct: 294 LYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRTDCIR 353

Query: 327 RDGVGYIKDLSVISEASGMKNISALPPS-LGEIIIIDNSPISYAMNVENAIQVEGWISDP 385
           RDGVGYIKDL++I + S   N+S    S L E+II+DNSPISYAMN +NAIQVEGWISDP
Sbjct: 354 RDGVGYIKDLTIIKDDS---NVSVPQTSTLSEVIILDNSPISYAMNADNAIQVEGWISDP 410

Query: 386 TDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAFYTS 422
           TD             R+TTDVR++LALKNGE+AFY +
Sbjct: 411 TDTALLNLLPLLEALRYTTDVRSILALKNGERAFYAN 447

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  422 bits (1084), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 234/454 (51%), Positives = 295/454 (64%), Gaps = 45/454 (9%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVE----QEPTN-NNEKIKSHSKATTNN------ 49
           MNAL Y S+HL +      KK    + VE    Q+  N +NE  K+ ++ T N+      
Sbjct: 1   MNALKYFSNHLITT-----KKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNH 55

Query: 50  DEDYSTPMADSSSSNTIEKSIAVYGSDRALR------FSVLFWTFVLFFPKFLIVKPLLF 103
             ++ST   + S  N  + + +VY   +ALR       + + WT +LF P +LI+KPL+ 
Sbjct: 56  QHNHSTDNLEGSKQNE-DNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMS 114

Query: 104 LWFIVTFPLYLLERGMKHRTLLKNKLDENS-----------QKNAERVPTTSPELTVIDE 152
           LWF+ TFPL ++ER +KH T  ++K   NS             + E+  + +  L  I E
Sbjct: 115 LWFVFTFPLSVIERRVKH-TDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPE 173

Query: 153 TTEDDLAGGDEIYLQRDTIKGSLLKATSAKQLXXX-----XXXXXXXXXXXXXXXKRMGK 207
           T +DDL   DEI LQRD +KGSLLKA S K                         KRMG+
Sbjct: 174 TVDDDLNASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRMGR 233

Query: 208 FLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTL 267
           FLFPKKLIP+SI+ T ++KKLV+DLDETLIHS SR TTHSNSSQGH+VEVKF +SG+ TL
Sbjct: 234 FLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTL 293

Query: 268 YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILR 327
           Y++HKRPYCDFFL+KVS+WYDLIIFTASMKEYADPVIDWLE S P  FS+R YR+DC+LR
Sbjct: 294 YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLR 353

Query: 328 DGVGYIKDLSVI--SEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDP 385
           DGVGYIKDLS+I  SE +G     + P SL ++IIIDNSP+SYAMNV+NAIQVEGWISDP
Sbjct: 354 DGVGYIKDLSIIKSSEENGK---GSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDP 410

Query: 386 TDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
           TD             R++TDVRN+LALK+GEKAF
Sbjct: 411 TDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 444

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  410 bits (1055), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 223/449 (49%), Positives = 285/449 (63%), Gaps = 36/449 (8%)

Query: 1   MNALSYISSHLAS-----PIHYLKKKEPTIVPVEQEPTNNNEKIKSHSK----ATTNNDE 51
           MNAL Y S+HL +      I+    K   ++   +E +N   K  SHS+    +  +   
Sbjct: 1   MNALKYFSNHLITTKKQKKINVEVTKNQDLLGPSKEVSN---KYTSHSENDCVSEVDQQY 57

Query: 52  DYSTPMADSSSSNTIEKSIAVYGSDRALR------FSVLFWTFVLFFPKFLIVKPLLFLW 105
           D+S+     S  N  E+  +V    +ALR       + + W  +LF P +LI+KPL+ LW
Sbjct: 58  DHSSSHLKESDQNQ-ERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLW 116

Query: 106 FIVTFPLYLLERGMKH-------RTLLKNKL---DENSQKNAERVPTTSPELTVIDETTE 155
           F+ TFPL ++ER +KH           +N+L     N   ++E+    +  L  I E  E
Sbjct: 117 FVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVE 176

Query: 156 DDLAGGDEIYLQRDTIKGSLLKATSAKQLXXXXXXXXXXXXXXXXX-----XKRMGKFLF 210
           DDL   DEI LQRD +KGSLL+A S K                         KRMG+FLF
Sbjct: 177 DDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLF 236

Query: 211 PKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYV 270
           PKKLIP+S++ T ++KKLV+DLDETLIHS SR TTHSNSSQGH+VEVKF +SG+ TLY++
Sbjct: 237 PKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFI 296

Query: 271 HKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGV 330
           HKRPYCD FL+KVSKWYDLIIFTASMKEYADPVIDWLE S P  FS+R YR+DC+LRDGV
Sbjct: 297 HKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGV 356

Query: 331 GYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXX 390
           GYIKDLS++ ++   +N      SL ++IIIDNSP+SYAMNV+NAIQVEGWISDPTD   
Sbjct: 357 GYIKDLSIVKDSE--ENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 414

Query: 391 XXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
                     R++TDVRN+LALK+GEKAF
Sbjct: 415 LNLLPFLEAMRYSTDVRNILALKHGEKAF 443

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  404 bits (1038), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 224/445 (50%), Positives = 288/445 (64%), Gaps = 32/445 (7%)

Query: 1   MNALSYISSHLASPIHYLK---KKEPTIVPVEQEPTNNNEKIKSHSKATTNND----EDY 53
           MNALSYI++H+  P   L+   K +  IVP       +   I +  K T   +    E  
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60

Query: 54  STPMADSSSSNTIEKSIAVYGSDRALRFSVL--FWTF---------VLFFPKFLIVKPLL 102
            + + D+ + N +E +I +       R ++L  F  F         +LF P++L + PL+
Sbjct: 61  LSSVKDAHNQN-VEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLI 119

Query: 103 FLWFIVTFPLYLLERGMKHRTLLKN-KLDENSQKNAERVPTTSPELTVIDETTEDDLAGG 161
           ++WFI+T PL L+ERG+K R   K  +L  N  +++E  P  S     I E  E+DL+  
Sbjct: 120 YVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRS-----ISEVGEEDLSTS 174

Query: 162 DEIYLQRDTIKGSLLKATSAK-----QLXXXXXXXXXXXXXXXXXXKRMGKFLFPKKLIP 216
           DE +LQRDTIKGSLL+A+S K     +                   K+MG+FLFPKKLIP
Sbjct: 175 DEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIP 234

Query: 217 RSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYC 276
           RSI+   R+K LV+DLDETLIHS+SRGTTH NSSQGH+VEVKFS++G+STLYYVHKRP+C
Sbjct: 235 RSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFC 294

Query: 277 DFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDL 336
           D FLSKVSKWY+++IFTASMKEYADPVIDWLE S    F++RLYR +C+LRDGVGYIKDL
Sbjct: 295 DLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDL 354

Query: 337 SVISEASGMKNISALPP--SLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXXXXXX 394
           SV+  A+  ++     P   L E+IIIDNSP+SYA+NV+NAIQVEGWISDPTD       
Sbjct: 355 SVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISDPTDTDLLNLL 414

Query: 395 XXXXXXRFTTDVRNVLALKNGEKAF 419
                 R+TTDVRNVLALKNGEK F
Sbjct: 415 PILEALRYTTDVRNVLALKNGEKMF 439

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  400 bits (1029), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 214/450 (47%), Positives = 274/450 (60%), Gaps = 32/450 (7%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATT-------NNDEDY 53
           MNAL Y S+HL +     K     +   +   + +NE   + +  T        N+  + 
Sbjct: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60

Query: 54  ST-----PMADSSSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIV 108
           ST     P  D   + ++        S    +   + W  +LF P +LI+KPL+ LWF+ 
Sbjct: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120

Query: 109 TFPLYLLERGMKHRTLLKNKLDENSQKNA----------ERVPTTSPELTVIDETTEDDL 158
           TFPL ++ER +KH      +  ++  + +          E+    +  L  I E  EDDL
Sbjct: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180

Query: 159 AGGDEIYLQRDTIKGSLLKAT---------SAKQLXXXXXXXXXXXXXXXXXXKRMGKFL 209
              DEI LQRD +KGSLL+A          S +                    KRMG+FL
Sbjct: 181 NASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFL 240

Query: 210 FPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYY 269
           FPKKLIP+SI+ T ++KKLV+DLDETLIHS SRGTTHSNSSQGH+VEVKF +SG+STLY+
Sbjct: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300

Query: 270 VHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDG 329
           +HKRPYCD FL+K SKWYDLIIFTASMKEYADPVIDWLE S    FS+R YR+DC+LRDG
Sbjct: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360

Query: 330 VGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXX 389
           VGYIKDLS++  +      S+L  SL ++IIIDNSP+SYAMNV+NAIQVEGWISDPTD  
Sbjct: 361 VGYIKDLSILKSSEENGKGSSL-SSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTD 419

Query: 390 XXXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
                      R++TDVRN+LALK+GEKAF
Sbjct: 420 LLNLLPFLEAMRYSTDVRNILALKHGEKAF 449

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  395 bits (1015), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 271/423 (64%), Gaps = 44/423 (10%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS 60
           MNA+SYI++H+  P    K  E   +  +Q     +  +    +    +DED +      
Sbjct: 1   MNAISYITNHVTPP----KFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQ----- 51

Query: 61  SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMK 120
                         + +A + S+L W+ +LF P F I+KP+LF W+I+TFPL L+E    
Sbjct: 52  --------------TKKATKLSLL-WSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPA 96

Query: 121 HRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATS 180
                +N  + NS  + E+ P+    + +I E  E+DLAG DEI LQ D +KGSL   + 
Sbjct: 97  DDEDERNGEEGNSTGDEEKTPS----INIIVEEDEEDLAG-DEIILQTDAVKGSLSTISE 151

Query: 181 AKQLXXXXXXXXXX----XXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETL 236
           ++Q+                      +RMG+FLFPKKLIP+S++   ++K LVLDLDETL
Sbjct: 152 SQQVKTIKASTRSSIRSGSTGTALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETL 211

Query: 237 IHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASM 296
           IHSMSRGT+ SNSSQGH+VEVKF+VSG+S+LY+VHKRPYCD FLSKV+KWY L++FTASM
Sbjct: 212 IHSMSRGTSSSNSSQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASM 271

Query: 297 KEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLG 356
           KEYADPVIDWLE S    FSQRLYR DCILRDGVGYIKDLS+IS+            SL 
Sbjct: 272 KEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKK-----------SLN 320

Query: 357 EIIIIDNSPISYAMNVENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVRNVLALKNGE 416
           EIII+DNSPISYAMNV+NAIQVEGWISDPTD             RFTTD+RNVL+LK+GE
Sbjct: 321 EIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLSLKSGE 380

Query: 417 KAF 419
           +AF
Sbjct: 381 QAF 383

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  397 bits (1020), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 217/447 (48%), Positives = 282/447 (63%), Gaps = 32/447 (7%)

Query: 1   MNALSYISSHLASPI-----HYLKKKEPTIVPVEQEPTNN-NEKIKSHSKATTNNDEDYS 54
           MNAL Y S+HL +       H        I+    E +N     I+++     N   D+S
Sbjct: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60

Query: 55  TPMADSSSSNTIEKSIAVYGSDRALR------FSVLFWTFVLFFPKFLIVKPLLFLWFIV 108
           +      + N  E+ + +    ++LR         + W  +LF P +L++KPL+ LW++ 
Sbjct: 61  SDHLKDFNQNE-ERKLFISAKPKSLRSILKEKIGSILWALLLFLPYYLVIKPLMSLWYVF 119

Query: 109 TFPLYLLERGMKHRTLLKNKLDENSQKNA-----------ERVPTTSPELTVIDETTEDD 157
           TFPL ++ER +KH T  +NK   +++  +           E++ + +  L  I ET EDD
Sbjct: 120 TFPLSVIERRVKH-TDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISETVEDD 178

Query: 158 LAGGDEIYLQRDTIKGSLLKATSAKQLXXXXXXXXXXXXXXXXX-----XKRMGKFLFPK 212
           L   DEI LQRD +KGSLL+A S K                         KRMG+FLFPK
Sbjct: 179 LNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPK 238

Query: 213 KLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHK 272
           KLIP+S++ T ++KKLV+DLDETLIHS SR TTHSNSSQGH+VEVKF +SG+ TLY++HK
Sbjct: 239 KLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTLYFIHK 298

Query: 273 RPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGY 332
           RPYCD FL+KVSKWY+LIIFTASMKEYADPVIDWLE S P  FS+R YR+DC+LRDGVGY
Sbjct: 299 RPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDGVGY 358

Query: 333 IKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXXXX 392
           IKDLS+I  +   +N      SL ++IIIDNSP+SYAMNV+NAIQVEGWISDPTD     
Sbjct: 359 IKDLSIIKNSE--ENEKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLN 416

Query: 393 XXXXXXXXRFTTDVRNVLALKNGEKAF 419
                   R++TDVRN+LALK+GEKAF
Sbjct: 417 LLPFLEAMRYSTDVRNILALKHGEKAF 443

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  392 bits (1008), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 194/360 (53%), Positives = 250/360 (69%), Gaps = 31/360 (8%)

Query: 66  IEKSIAVYGSDRALR----FSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKH 121
           +E  +AV   ++ +R    F+   W  +LFFP++LI+KP   +W+I++ PL L+E G+K 
Sbjct: 23  VEDKVAVQKREKIVRRRSKFTSYAWAVILFFPQWLIIKPTQLIWWIISLPLLLIEYGLKS 82

Query: 122 RTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATSA 181
           R           +K+ +R   T   L  I E  EDDLAGGDEI+LQRD +KGSL  A   
Sbjct: 83  RL---------QRKSTKRSTGT---LQSISELEEDDLAGGDEIFLQRDAVKGSLAPAKYR 130

Query: 182 KQLXXXXXXXXXXXXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMS 241
           +                    KRMG+FLFPKKLIPRS++   +RK+LV+DLDETLIHS S
Sbjct: 131 RS------RSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSAS 184

Query: 242 RGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYAD 301
           R T+HSNS+QGH+VE++F++SGVSTLYYVHKRP+CD FLSKVSKWYDL++FTASM+EYAD
Sbjct: 185 RTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYAD 244

Query: 302 PVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIII 361
           PVIDWLE S   +FS+RLYR +CILRDGVGYIKDLS++   +          +LGE+I++
Sbjct: 245 PVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPT---------VTLGEVILV 295

Query: 362 DNSPISYAMNVENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAFYT 421
           DNSPISYAMNV+NAIQVEGWISDP+D             R+TTDVR++LALKN E+AF +
Sbjct: 296 DNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAFLS 355

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  391 bits (1005), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 221/470 (47%), Positives = 287/470 (61%), Gaps = 54/470 (11%)

Query: 1   MNALSYISSHLASPIHYLK----KKEPTI----VPVEQEPTN-----NNEKIKSHSKATT 47
           MNALSY+  +L  PI + K    +KE  +    V   +E TN     N++ + + ++   
Sbjct: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60

Query: 48  NND--------------EDYSTPMADSSSSNTIEKSIAVYG-SD------------RALR 80
           N+D              +D +    DS + N     I +   SD            R L+
Sbjct: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120

Query: 81  FSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHR--TLLKNKLDENSQKNAE 138
           F ++ W+ + FFP ++++KP LF+WFI+TFPL L+E  ++ R        L ++   N +
Sbjct: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180

Query: 139 RVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLL------KATSAKQLXXXXXXXX 192
             P  S  L VI+E  EDDL  G+ + LQ+D +KGSLL         S+++         
Sbjct: 181 NSP--SKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTST 238

Query: 193 XXXXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQG 252
                     K MG+F FPKKLIPRSI+ + ++K LV+DLDETLIHS+SRGTTHSNSSQ 
Sbjct: 239 PSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQA 298

Query: 253 HIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLP 312
           HI+EV+F++SGVSTLYYVHKRPYCD FLSKV KWY+LIIFTASMKEYADPVIDWLE S  
Sbjct: 299 HIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFS 358

Query: 313 DKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNV 372
             F+QR+YR  CI RDGVGYIKDL  I +    KN + +P  L +++IIDNSP+SYAM+V
Sbjct: 359 GSFTQRMYRNHCIARDGVGYIKDLGNIKDPYS-KN-ATIP--LTDVVIIDNSPVSYAMHV 414

Query: 373 ENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAFYTS 422
           +NAIQVEGWISDPTD             R+TTDVRNVLALKN EKAF  S
Sbjct: 415 DNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAFQLS 464

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/447 (50%), Positives = 283/447 (63%), Gaps = 35/447 (7%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNN------NEKIKSHSKATTNNDEDYS 54
           MN +SYI+ HL  P+    K     V   +   ++      N+      K T N ++  +
Sbjct: 1   MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKLKTTANVEKQEN 60

Query: 55  TPMAD------SSSSNTIEKSIAVYGSDRALRFSVL---FWT---FVLFF-PKFLIVKPL 101
           + + +       S +    K I V      L  ++L    W    FV+FF P +LI KPL
Sbjct: 61  STLKEELLDRQGSDAEKASKPIIVINDGDILNENILHQKVWNVLVFVIFFLPTYLIYKPL 120

Query: 102 LFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGG 161
           L LWF+VT PL L+ERG+K    L+N+    ++K +E V +   +L  I+E  E+DLA G
Sbjct: 121 LLLWFLVTLPLALVERGIK----LRNRPKMKTEKVSELVLSDPSKLGSINEEVEEDLAAG 176

Query: 162 DEIYLQRDTIKGSLLKAT---------SAKQLXXXXXXXXXXXXXXXXXXKRMGKFLFPK 212
           DE YLQRD +KGSLLKAT         S K                    K+MG+FLFPK
Sbjct: 177 DEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNSTVFGTKKMGRFLFPK 236

Query: 213 KLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHK 272
           KLIP+SI+   ++K LV+DLDETLIHS+SRGTTH NSSQGHIVEVKFS+SGVSTLYYV K
Sbjct: 237 KLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSISGVSTLYYVFK 296

Query: 273 RPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGY 332
           RPYCD FL+KVSKWYD++IFTASMKEYADPVIDWLE S   KFS+RLYR DCILRDGVGY
Sbjct: 297 RPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRNDCILRDGVGY 356

Query: 333 IKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXXXX 392
           IKDL +++  S   N+   P  L ++II+DNSP+SYA+NV+NAIQVEGWI+DPTD     
Sbjct: 357 IKDLKMVTRGS---NLGTSPDRLEDVIIVDNSPVSYALNVDNAIQVEGWINDPTDTDLLN 413

Query: 393 XXXXXXXXRFTTDVRNVLALKNGEKAF 419
                     TTDVRN+L+LKNGEKAF
Sbjct: 414 LIPLLEALENTTDVRNILSLKNGEKAF 440

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  384 bits (985), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 217/454 (47%), Positives = 275/454 (60%), Gaps = 71/454 (15%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMAD- 59
           MNALSYISS+L             I P+E+E        +  S + + + + Y+  ++D 
Sbjct: 1   MNALSYISSNL-------------ITPIEEE--------ELPSGSQSEDVQTYTNDVSDT 39

Query: 60  --SSSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLER 117
             SS +  I K   V   D      VL    +LFFPK+L+VKP+ FLWF++TFP+ L E+
Sbjct: 40  CVSSQTQIISKVEDVLNEDNQRSTLVLV---LLFFPKYLLVKPIFFLWFLITFPITLFEQ 96

Query: 118 GMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLK 177
                   KNK    S  N + + + S  L ++    E+DL+GG EI LQRDT+ GSLLK
Sbjct: 97  --------KNKKLPKSSANLDTM-SKSKNLNIL---VEEDLSGGGEIILQRDTLNGSLLK 144

Query: 178 ATSAKQLXXXXXXXXXXXXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLI 237
           + + +Q                   K++G+FLFPKKLIPRSI+ + R+KKLVLDLDETLI
Sbjct: 145 SRANQQHSHQSRHAKSSSSSVGLISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLI 204

Query: 238 HSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMK 297
           HS+SR T +SN++Q H+VEVKF +SG+STLYYVHKRPYCD FLSKV +WYDLIIFTASMK
Sbjct: 205 HSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMK 264

Query: 298 EYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPS--- 354
           EYADPVIDWLE S    FS+R YR DCILRDGVGYIKDLS+++   G    S    +   
Sbjct: 265 EYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHN 324

Query: 355 -----------------------------LGEIIIIDNSPISYAMNVENAIQVEGWISDP 385
                                        L E+I+IDNSP+SYAMNV+NAIQV+GWISDP
Sbjct: 325 NNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDP 384

Query: 386 TDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
           TD             R TTDVRN+L+LKNGE+AF
Sbjct: 385 TDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  367 bits (942), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/449 (45%), Positives = 266/449 (59%), Gaps = 73/449 (16%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS 60
           MNA+SY+++++  P H    +E T  P   E                  D + +    D 
Sbjct: 1   MNAISYLTNNILPPKH----EESTATPHRVE------------------DSEKANARIDV 38

Query: 61  SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMK 120
           +     ++  A +          L W+ + F P  ++VKP+LF+WF++TFPL L+ER   
Sbjct: 39  APKEAQKRKRARW---------TLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASS 89

Query: 121 HRT----LLKNKLDENSQKNAERV-PTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSL 175
                      + D  S+ +A  + P  S  ++ I E  EDDLAG +E+ LQ DT+KGSL
Sbjct: 90  SENQGMGFDNAEGDSKSEASAGTISPKNSSRISTITEE-EDDLAG-EEMILQADTVKGSL 147

Query: 176 LKATSAKQL-------------------------XXXXXXXXXXXXXXXXXXKRMGKFLF 210
              + AK+                                            +RMG+FLF
Sbjct: 148 TVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLF 207

Query: 211 PKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYV 270
           PKKLIP+S++   +R+ LVLDLDETLIHSMSRGT+ SNSSQGH+VEVKF+ SG+STLY+V
Sbjct: 208 PKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFATSGISTLYHV 267

Query: 271 HKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGV 330
           HKRPYCD FL+K++KWY+L++FTASMKEYADPVIDWLE S P KFS+RLYR DCILRDGV
Sbjct: 268 HKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGV 327

Query: 331 GYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXX 390
           GYIKDLSV+   +          SL +I IIDNSP+SYAM+V+NAIQVEGWISDPTD   
Sbjct: 328 GYIKDLSVVVPNA----------SLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDL 377

Query: 391 XXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
                     RFTTD+RNVLALK+GE AF
Sbjct: 378 LNLLPLLEALRFTTDIRNVLALKSGEHAF 406

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  366 bits (940), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 192/372 (51%), Positives = 240/372 (64%), Gaps = 42/372 (11%)

Query: 77  RALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKN 136
           R +R++ L W+ ++F P  L+VKP+LF+WF++TFPL L+ER     +    +       N
Sbjct: 52  RGIRWAFL-WSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGN 110

Query: 137 A---ERVPTTS------PELTVIDETTEDDLAGGDEIYLQRDTIKGSLL----------- 176
               E+V TTS      P +  I E  EDD  GGDEI+LQ DT+KGSL            
Sbjct: 111 LYSDEQVSTTSDSVGSKPRINTIQE--EDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQ 168

Query: 177 ---------KATSAKQLXXXXXXXXXXXXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKK 227
                    K +                       +RMG+FLFPKKLIP+S++   + + 
Sbjct: 169 DLSRRQQHSKGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRT 228

Query: 228 LVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWY 287
           LVLDLDETLIHSMSRGT+ SNSSQGH+VEVKF++SG+STLY+VHKRPYCD FL+ ++ WY
Sbjct: 229 LVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWY 288

Query: 288 DLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKN 347
           +L++FTASMKEYADPVIDWLE S P KFS+RLYR DCILRDGVGYIKDLS ++  +    
Sbjct: 289 ELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNT---- 344

Query: 348 ISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVR 407
                  L +I IIDNSP+SYAM+V+NAIQVEGWISDPTD             RFTTDVR
Sbjct: 345 ------LLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVR 398

Query: 408 NVLALKNGEKAF 419
           N+LALK+GE AF
Sbjct: 399 NILALKSGEHAF 410

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/355 (54%), Positives = 241/355 (67%), Gaps = 22/355 (6%)

Query: 85  FWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTS 144
           FW  +LF P+ L+VKPLLF W+++TFPL L E+   +    ++    NS  +A  +   +
Sbjct: 37  FWFVLLFLPRLLLVKPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNN 96

Query: 145 P-----------ELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATS------AKQLXXX 187
                       +L  +D   EDD+ GG E+ LQRDT+KGSLL A++      A      
Sbjct: 97  AFYVTKGRKRTEQLQNLDSVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKN 155

Query: 188 XXXXXXXXXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHS 247
                          K+MG+FLFPKKLIPRSI+ + R+KKLVLDLDETLIHS+SR  ++S
Sbjct: 156 NSAVKSMSSSVAFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNS 215

Query: 248 NSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWL 307
           N++Q H+VEVKF +SG+STLYYVHKRPYCD FLS VSKWYDLIIFTASMKEYADPVIDWL
Sbjct: 216 NNAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWL 275

Query: 308 EDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEAS---GMKNISALPPSLGEIIIIDNS 364
           E S    FS+R YR  CILRDGVGYIKDLS+I++ +   G + + A    L EII+IDNS
Sbjct: 276 ESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRA-NSILHEIILIDNS 334

Query: 365 PISYAMNVENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
           P+SYAMNV+NAIQVEGWISDPTD             R+TTDVRN+L+LKNGE+AF
Sbjct: 335 PVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  332 bits (852), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 229/336 (68%), Gaps = 46/336 (13%)

Query: 86  WTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVP--TT 143
           W  + F PK+L+VKP++ +WF++TFPL L+E              + S K A+  P    
Sbjct: 51  WRVLFFLPKWLVVKPVVLVWFVLTFPLSLIE--------------QTSSKEADGAPGPEA 96

Query: 144 SPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATSAKQLXXXXXXXXXXXXXXXXXXK 203
           + E  + +   +DDLAG + + LQ D++K S    + +                      
Sbjct: 97  AEEEQLAEAVEDDDLAG-ESMVLQEDSVKSSRPSTSRSSY-----------------TST 138

Query: 204 RMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSG 263
           R+GKFLFPKKLIP+SI+QT+R+K LVLDLDETLIHSMSR T+  ++SQGH+VEV F+ SG
Sbjct: 139 RLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASG 198

Query: 264 VSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTD 323
           VSTLYYVHKRPYCD FLS+VSKWYDL+IFTASMKEYADPVIDWLE  +  +FSQR YR+D
Sbjct: 199 VSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSD 258

Query: 324 CILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWIS 383
           C+LRDGVGY+KDLS+IS+            +L +III+DNSPISYAMNV+NAIQVEGWIS
Sbjct: 259 CLLRDGVGYVKDLSIISK------------NLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306

Query: 384 DPTDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
           DPTD             RFTTD RN+L+LKNGE+AF
Sbjct: 307 DPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  330 bits (847), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/389 (48%), Positives = 245/389 (62%), Gaps = 42/389 (10%)

Query: 34  NNNEKIKSHSKATTNNDEDYSTPMADSSSSNTIEKSIAVYG---SDRALRFSVLFWTFVL 90
           N+   +   S+ T+++ E+   P ++SS  N  E+     G    D         W  V 
Sbjct: 2   NSLSYLTGSSQPTSSSKEELRFPFSESSLPNVTEEQEVENGEVSQDSKGGRPSWVWRVVF 61

Query: 91  FFPKFLIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTSPELTVI 150
           F P +LI+KP+  +WF++TFPL L+E              + S +  E +PT S + +  
Sbjct: 62  FLPTWLIIKPIWLIWFVLTFPLNLIEH---------TSSKDGSVEEEEVIPTNS-QGSGG 111

Query: 151 DETTEDDLAGGDEIYLQRDTIKGSLLKATSAKQLXXXXXXXXXXXXXXXXXXKRMGKFLF 210
            E  EDD   G+ + L  D+IK S    + +                      R+GKFLF
Sbjct: 112 GEVIEDDDLVGESMVLHEDSIKSSRPSTSRSSY-----------------TSTRLGKFLF 154

Query: 211 PKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYV 270
           PKKLIP+SI+QT+R+K LVLDLDETLIHSMSR T+ SN+SQGH+VEV FSVSGVS+LYYV
Sbjct: 155 PKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTFSVSGVSSLYYV 214

Query: 271 HKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGV 330
           HKRPYCD FLS+V KWYDL+IFTASM+EYADPVIDWLE  +  +F++R YR+DCILRDG+
Sbjct: 215 HKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYRSDCILRDGI 274

Query: 331 GYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXX 390
           GY+KDL++IS+            +L + II+DNSP+SYAMNV+NAIQVEGWISDPTD   
Sbjct: 275 GYVKDLTMISK------------NLQDTIIVDNSPVSYAMNVDNAIQVEGWISDPTDTGL 322

Query: 391 XXXXXXXXXXRFTTDVRNVLALKNGEKAF 419
                     RFTTD RN+L+LKNGE AF
Sbjct: 323 LNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  330 bits (845), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 165/324 (50%), Positives = 212/324 (65%), Gaps = 47/324 (14%)

Query: 96  LIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTE 155
           + +KP   +WF++T PL L+E G+K +               ++V +TS +  +I +   
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLKSK---------------QKVESTSRKGEIIRKKEV 103

Query: 156 DDLAGGDEIYLQRDTIKGSLLKATSAKQLXXXXXXXXXXXXXXXXXXKRMGKFLFPKKLI 215
           DD    DE++LQRDT+KG L                           K+MG+FLFPKKL+
Sbjct: 104 DDDLAEDEMFLQRDTVKGGLRGKAFG--------------------TKKMGRFLFPKKLV 143

Query: 216 PRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPY 275
           P+SI+   R+K+LV+DLDETLIHS +R  +HSNS+QGH+VEV+F  S +STLYYVHKRP+
Sbjct: 144 PQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPH 203

Query: 276 CDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKD 335
           CD FLSKVSKWYDLIIFTASMKEYADPVIDWLE S   KF +RLYR +C++R+GVGYIKD
Sbjct: 204 CDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKD 263

Query: 336 LSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXXXXXXX 395
           LSV++E             L E+++IDNSP SYA N +NAIQVEGWISDP+D        
Sbjct: 264 LSVVTEV------------LDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDLLNLLP 311

Query: 396 XXXXXRFTTDVRNVLALKNGEKAF 419
                R+ TDVR++L LKNGEKA 
Sbjct: 312 LLEALRYVTDVRSILGLKNGEKAL 335

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  328 bits (840), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 180/356 (50%), Positives = 220/356 (61%), Gaps = 52/356 (14%)

Query: 96  LIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTE 155
           +++KPL+FLW+I TFPL L+E+               ++K  +  P   P++     T  
Sbjct: 57  ILIKPLIFLWYIFTFPLLLIEQ-------------HTNRKYKDTPPLIDPKIASSSATDL 103

Query: 156 DDLAGGDEIYLQRDTIKGSLLK---------------ATSAKQLXXXXXXXXXXXXXXXX 200
           DDL   DEI LQ D+IKGSLL+               ATS   L                
Sbjct: 104 DDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVYSLT 163

Query: 201 X----XKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVE 256
                 K MG+FLFPKKLIP SI++TN+RKKL+LDLDETLIHSMSR  + S  S  H++E
Sbjct: 164 SNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHLIE 223

Query: 257 VKF--------SVSG----VSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVI 304
           VKF        S  G    +S+LYYV+KRPYCD FL+ VS WYDLIIFTASMKEYADPVI
Sbjct: 224 VKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVI 283

Query: 305 DWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNS 364
           DWLEDS    F +RLYR  CILRDG+GYIKDLSV++  +          +L E+I+IDNS
Sbjct: 284 DWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQS--------TLNELILIDNS 335

Query: 365 PISYAMNVENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVRNVLALKNGEKAFY 420
           PIS+AMNV+NAIQV+GWISDPTD             R TTDVRN+LALKNGE+AF+
Sbjct: 336 PISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAFH 391

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  265 bits (676), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 157/432 (36%), Positives = 233/432 (53%), Gaps = 73/432 (16%)

Query: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNN-EKIKSHSKATTNNDEDYSTPMAD 59
           MNA+S++S+ L +P     K++  I+ V+  PTN    K+K+ +   +            
Sbjct: 1   MNAISFLSNALPAPQEVPIKEKEGIL-VDPTPTNTQPNKVKNKTTTAS------------ 47

Query: 60  SSSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLE--- 116
              + T   + +   + R   F    W  ++F P +L++KP++ +W+++TFPL L+E   
Sbjct: 48  ---TTTSTTTTSTATNKRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNT 104

Query: 117 RGMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLL 176
           +G K    + ++ D  ++K ++ V              E+DL+  DEI + +D +K   +
Sbjct: 105 QGNKGLIQVGSETDSRTEKLSKYV-------------VEEDLSPTDEIIINQDKMKPRPI 151

Query: 177 KATSAKQLXXXXXXXXXXXXXXXXXXKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETL 236
                                     + +GKF FPKKL+P+S++ +  RK LVLDLDETL
Sbjct: 152 -------------------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETL 186

Query: 237 IHSMSRGTTHSNSSQG---------HIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWY 287
           IHSMS   +  N +           H+VEV+F  + +STLY V KRPYCD FL + S+WY
Sbjct: 187 IHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWY 246

Query: 288 DLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKN 347
           D+ IFTASMKEYADPVIDWL+ +   +F  R YR DC LR GVGY+KD+  ++       
Sbjct: 247 DIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSR 306

Query: 348 ISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDXXXXXXXXXXXXXRFTTDVR 407
                  L ++IIIDNSPISYAM+++NAIQV GWI+DP+D             R  TD R
Sbjct: 307 ------DLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSR 360

Query: 408 NVLALKNGEKAF 419
            +LALK+G  + 
Sbjct: 361 CILALKSGRASI 372

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score =  100 bits (248), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 94/174 (54%), Gaps = 20/174 (11%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L P+ I +  R+K L+LDLDETL+HS  +       S   ++ V  ++   +   YV KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYV----DSADFVIPV--TIDNQTHHVYVIKR 365

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL +VS+ Y++++FTAS+  Y DP+++ L D        RL+R  C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNIL-DPANTIIHHRLFRESCYTYEG-NYV 423

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K            N+S L   L EIII+DNSP SY  + ++AI +  W SD  D
Sbjct: 424 K------------NLSQLGRPLNEIIILDNSPASYIFHPQHAIPISSWFSDIHD 465

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 91/174 (52%), Gaps = 20/174 (11%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L P+  ++   +K LVLDLDETL+HS  +     N+     V +   +  V    YV KR
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYL--PNADFNLPVNIDDQIHNV----YVIKR 385

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL KV K ++++IFTAS+  Y DP++D L D        RL+R  C   +G  YI
Sbjct: 386 PGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRL-DPKGKSIHHRLFREACYNYEG-NYI 443

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS +               L EIII+DNSP SY  + ++AI +  W SD  D
Sbjct: 444 KNLSQMGRP------------LSEIIILDNSPASYIFHPQHAIPISSWFSDSHD 485

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 96/174 (55%), Gaps = 19/174 (10%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P    +   +K L+LDLDETL+HS  +   + +     I+ ++     +  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPD----FILPIEIEDGQIHNVYVI-KR 355

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL +V KWY+++IFTAS+  YA+P++D L D   +  + RL+R  C       Y 
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLL-DKDHNLINHRLFRDAC-----YNY- 408

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                  E + +KN+S +   L +III+DNSP SY  + ++AI +  W SD  D
Sbjct: 409 -------ENNFIKNLSQIGRPLHDIIILDNSPASYIFHPQHAIPISSWFSDTHD 455

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 97/174 (55%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P  + +  ++K L+LDLDETL+HS S    HS +     VE+   V  V    YV KR
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHS-SFKYMHS-ADFVLPVEIDDQVHNV----YVIKR 269

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL++VS+ Y++++FTAS+  YA+P++D L+ +       RL+R  C   +G  YI
Sbjct: 270 PGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 326

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L E II+DNSP SY  + ++A+ +  W SD  D
Sbjct: 327 KNLSQIGRP------------LSETIILDNSPASYIFHPQHAVPISSWFSDTHD 368

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 98/180 (54%), Gaps = 28/180 (15%)

Query: 209 LFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLY 268
           L P KL+P       ++K L+LDLDETL+HS  +    ++      VE+   V  V    
Sbjct: 204 LLPPKLLP-----FQQKKCLILDLDETLVHSSFKYLHTADFVLP--VEIDDQVHNV---- 252

Query: 269 YVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDK-FSQRLYRTDCILR 327
           YV KRP  D FL +VS+ Y++++FTAS+  YA+P++D L+   P++    RL+R  C   
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLD---PNRTIHHRLFREACYNY 309

Query: 328 DGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +G  YIK+LS I               L E II+DNSP SY  + ++A+ +  W SD  D
Sbjct: 310 EG-NYIKNLSQIGRP------------LSETIILDNSPASYIFHPQHAVPISSWFSDTHD 356

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 95/174 (54%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P  + +  ++K L+LDLDETL+HS  +    ++      VE+   V  V    YV KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL +VS+ Y++++FTAS+  YA+P++D L+ +       RL+R  C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L E II+DNSP SY  + ++A+ +  W SD  D
Sbjct: 322 KNLSQIGRP------------LSETIILDNSPASYIFHPQHAVPISSWFSDSHD 363

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 96/177 (54%), Gaps = 23/177 (12%)

Query: 212 KKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHI-VEVKFSVSGVSTLYYV 270
           + L+P    Q  RRK LVLDLDETL+HS  +   + +++   I VE+   V  V    YV
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFK---YLHTADFVIPVEIDNQVHNV----YV 361

Query: 271 HKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGV 330
            KRP  D FL +V + Y++++FTAS+  Y DP++D L+    +    RL+R  C   +G 
Sbjct: 362 IKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKH--NVVHHRLFRDSCYNYEG- 418

Query: 331 GYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
            YIK+LS I               L ++II+DNSP SY  +  +AI +  W SD  D
Sbjct: 419 NYIKNLSQIGRP------------LSDLIILDNSPASYIFHPHHAIPISSWFSDAHD 463

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 95.9 bits (237), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 90/164 (54%), Gaps = 23/164 (14%)

Query: 225 RKKLVLDLDETLIHSMSRGTTHSNSSQGHI-VEVKFSVSGVSTLYYVHKRPYCDFFLSKV 283
           +K LVLDLDETL+HS  +   +  ++   I VE+   V  V    YV KRP  D FL +V
Sbjct: 229 KKCLVLDLDETLVHSSFK---YLRTADFVIPVEIDDQVHNV----YVIKRPGVDEFLERV 281

Query: 284 SKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEAS 343
            K Y++++FTAS+  Y DP++D L+         RL+R  C   DG  YIK+LS I    
Sbjct: 282 GKLYEVVVFTASVSRYGDPLLDILDPR--GAVHHRLFRDSCYNYDG-NYIKNLSQIGRP- 337

Query: 344 GMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                      L ++II+DNSP SY ++ ++AI +  W SD  D
Sbjct: 338 -----------LSDLIILDNSPASYILHPQHAIPISSWFSDAHD 370

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 99/187 (52%), Gaps = 25/187 (13%)

Query: 204 RMGKFLFP--KKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSV 261
           + G++  P  K L+P     T  +K L+LDLDETL+HS  +    ++      VE+   V
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQV 278

Query: 262 SGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDK-FSQRLY 320
             V    YV KRP  + FL +V K +++++FTAS+  Y DP++D L+    DK    RL+
Sbjct: 279 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD---ADKVIHHRLF 331

Query: 321 RTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEG 380
           R  C   +G  YIK+LS I               L +III+DNSP SY  + ++AI +  
Sbjct: 332 REACYNYEG-NYIKNLSQIGRP------------LSDIIILDNSPASYIFHPQHAIPISS 378

Query: 381 WISDPTD 387
           W SD  D
Sbjct: 379 WFSDTHD 385

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 95.9 bits (237), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 88/168 (52%), Gaps = 29/168 (17%)

Query: 224 RRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKF----SVSGVSTLYYVHKRPYCDFF 279
            +K LVLDLDETL+HS          S  +I    F    ++   +   YV KRP  D F
Sbjct: 306 NKKCLVLDLDETLVHS----------SFKYIDTADFVLPVTIDDQTHQVYVIKRPGVDEF 355

Query: 280 LSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVI 339
           L +V K +++++FTAS+  Y DP++D L+ S       RL+R  C + DG  Y+K+LS I
Sbjct: 356 LKRVGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKNLSQI 412

Query: 340 SEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                          L +III+DNSP SY  + ++AI +  W SD  D
Sbjct: 413 GRP------------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHD 448

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 93/178 (52%), Gaps = 25/178 (14%)

Query: 212 KKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLY--Y 269
           + L+P    +   +K LVLDLDETL+HS  +          H  +    V     ++  Y
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVY 259

Query: 270 VHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDG 329
           V KRP  D FL +V++ Y++++FTAS+  Y DP++D L+ S  +    RL+R  C   +G
Sbjct: 260 VIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYEG 317

Query: 330 VGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
             Y+K+L+ I               L EI+I+DNSP SY  + ++AI +  W SD  D
Sbjct: 318 -NYVKNLAQIGRP------------LSEIVILDNSPASYMFHPQHAIPISSWFSDTHD 362

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 95/174 (54%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P  + +  ++K L+LDLDETL+HS  +    ++      VE+   V  V    YV KR
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYMHTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FLS+V + Y++++FTAS+  YA+P++D L+ +       RL+R  C   +G  YI
Sbjct: 265 PGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L E II+DNSP SY  + ++A+ +  W SD  D
Sbjct: 322 KNLSQIGRP------------LSETIILDNSPASYIFHPQHAVPISSWFSDTHD 363

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 92/165 (55%), Gaps = 25/165 (15%)

Query: 225 RKKLVLDLDETLIHSMSRGTTHSNSSQGHI-VEVKFSVSGVSTLYYVHKRPYCDFFLSKV 283
           RK LVLDLDETL+HS  +   + N +   + V++   V  V    YV KRP  D FL  V
Sbjct: 282 RKCLVLDLDETLVHSSFK---YLNIADFVLPVDIDNQVQNV----YVSKRPGVDEFLKIV 334

Query: 284 SKWYDLIIFTASMKEYADPVIDWLEDSLPDKF-SQRLYRTDCILRDGVGYIKDLSVISEA 342
              Y++I+FTAS+  Y +P++D L+   P K+   RL+R  C + +G  Y+K+LS I   
Sbjct: 335 GDLYEVIVFTASVSRYGNPLMDILD---PHKYIHHRLFRDSCYVYEG-NYVKNLSQIGRP 390

Query: 343 SGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                       LG+III+DNSP SY  + ++AI +  W SD  D
Sbjct: 391 ------------LGDIIILDNSPASYIFHPQHAIPISSWFSDSHD 423

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 92/174 (52%), Gaps = 20/174 (11%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P        RK LVLDLDETL+HS  +  + ++      ++ +F         YV KR
Sbjct: 168 LLPPIQQSLQNRKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQFQN------VYVIKR 221

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL   SK ++++IFTAS+++Y +P++D L DS  D    RL+R  C   +G  YI
Sbjct: 222 PGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDIL-DSTNDLVHHRLFRDACYNYNG-NYI 279

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                       KN++ L   L +III+DNSP SY  +  +AI +  W SD  D
Sbjct: 280 ------------KNLAQLGRPLSDIIILDNSPTSYLFHPNHAIPISSWFSDAHD 321

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 90/174 (51%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P    Q   +K LVLDLDETL+HS  +    ++      V +   V  V    YV KR
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLP--VNIDDQVHNV----YVIKR 282

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL +V + Y++++FTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 283 PGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYNYEG-NYI 339

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L EIII+DNSP SY  + ++AI V  W SD  D
Sbjct: 340 KNLSQIGRP------------LSEIIILDNSPASYIFHPQHAIPVSSWFSDSHD 381

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 87/165 (52%), Gaps = 25/165 (15%)

Query: 225 RKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLY--YVHKRPYCDFFLSK 282
           +K LVLDLDETL+HS  +          H  +    V     ++  YV KRP  D FL +
Sbjct: 277 KKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVIKRPGVDEFLQR 328

Query: 283 VSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEA 342
           V + Y++++FTAS+  Y DP++D L+ S  +    RL+R  C   +G  YIK+LS I   
Sbjct: 329 VGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQIGRP 385

Query: 343 SGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                       L EIII+DNSP SY  + ++AI +  W SD  D
Sbjct: 386 ------------LSEIIILDNSPPSYIFHPQHAIPISSWFSDSHD 418

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 98/187 (52%), Gaps = 25/187 (13%)

Query: 204 RMGKFLFP--KKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSV 261
           + G++  P    L+P     T  +K L+LDLDETL+HS  +    ++      VE+   V
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQV 291

Query: 262 SGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDK-FSQRLY 320
             V    YV KRP  + FL +V K +++++FTAS+  Y DP++D L+    DK    RL+
Sbjct: 292 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD---TDKVIHHRLF 344

Query: 321 RTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEG 380
           R  C   +G  YIK+LS I               L +III+DNSP SY  + ++AI +  
Sbjct: 345 REACYNYEG-NYIKNLSQIGRP------------LSDIIILDNSPASYIFHPQHAIPISS 391

Query: 381 WISDPTD 387
           W SD  D
Sbjct: 392 WFSDTHD 398

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 92/174 (52%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P    Q + +K LVLDLDETL+HS  +    ++      VE+   V  V    YV KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVI--PVEIDNQVHNV----YVIKR 281

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL  V + Y++++FTAS+  Y DP++D L+ +       RL+R  C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQN--HCIHHRLFRDSCYNYDG-NYI 338

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L ++II+DNSP SY  + ++AI +  W SD  D
Sbjct: 339 KNLSQIGRP------------LSDLIILDNSPASYIFHPQHAIPISSWFSDVHD 380

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 96/178 (53%), Gaps = 22/178 (12%)

Query: 210 FPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYY 269
           F   L PR    +N+ K LVLDLDETL+HS  +    ++      VE++  +  V    Y
Sbjct: 214 FKTLLSPRKPEFSNK-KCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----Y 266

Query: 270 VHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDG 329
           V KRP  D FL +V + Y++++FTAS+  Y DP+++ L+ S  +    RL+R  C   +G
Sbjct: 267 VIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG 324

Query: 330 VGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
             YIK+L+ I               L +III+DNSP SY  + ++AI +  W SD  D
Sbjct: 325 -NYIKNLAQIGRP------------LSDIIILDNSPASYMFHPQHAIPISSWFSDTHD 369

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 93.2 bits (230), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 92/175 (52%), Gaps = 23/175 (13%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P      + RK LVLDLDETL+HS  +    ++      V++   +  V    YV KR
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 353

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDK-FSQRLYRTDCILRDGVGY 332
           P  D FL +V K Y++++FTAS+  Y DP++D L+    DK    RL+R  C   +G  Y
Sbjct: 354 PGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD---KDKSIHHRLFREACYNYEG-NY 409

Query: 333 IKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           IK+LS I               L  III+DNSP SY  + ++AI +  W SD  D
Sbjct: 410 IKNLSQIGRP------------LSNIIILDNSPASYIFHPQHAIPISSWFSDTHD 452

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 92.4 bits (228), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 92/174 (52%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P     T  +K L+LDLDETL+HS  +    ++      VE+   V  V    YV KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  + FL +V K +++++FTAS+  Y DP++D L+ +       RL+R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN--KVIHHRLFREACYNYEG-NYI 344

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L +III+DNSP SY  + ++AI +  W SD  D
Sbjct: 345 KNLSQIGRP------------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHD 386

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 89/164 (54%), Gaps = 23/164 (14%)

Query: 225 RKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVS 284
           +K L+LDLDETL+HS  +    ++      VE+   V  V    YV KRP  + FL +V 
Sbjct: 245 KKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKRPGVEEFLERVG 298

Query: 285 KWYDLIIFTASMKEYADPVIDWLEDSLPDK-FSQRLYRTDCILRDGVGYIKDLSVISEAS 343
           K +++++FTAS+  Y DP++D L+    DK    RL+R  C   +G  YIK+LS I    
Sbjct: 299 KLFEVVVFTASVSRYGDPLLDILD---TDKVIHHRLFREACYNYEG-NYIKNLSQIGRP- 353

Query: 344 GMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                      L EIII+DNSP SY  + ++AI +  W SD  D
Sbjct: 354 -----------LSEIIILDNSPASYIFHPQHAIPISSWFSDTHD 386

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 87/174 (50%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P      + +K LVLDLDETL+HS  +        +G    +   +       YV KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYL------KGADFVLPVDIDDQIHNVYVMKR 354

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL KV   ++++IFTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH--KSVHHRLFREACYNYEG-NYI 411

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L EIII+DNSP SY  + ++AI +  W SD  D
Sbjct: 412 KNLSQIGRP------------LSEIIILDNSPASYIFHPQHAIPISSWFSDTHD 453

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 92/174 (52%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P      +R+K LVLDLDETL+HS  +    ++      V++   +  V    YV KR
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 355

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL +V + +++++FTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 356 PGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKG--KSIHHRLFREACYNYEG-NYI 412

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K            N+S L   L +III+DNSP SY  + ++AI +  W SD  D
Sbjct: 413 K------------NLSQLGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHD 454

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 92/165 (55%), Gaps = 25/165 (15%)

Query: 225 RKKLVLDLDETLIHSMSRGTTHSNSSQGHI-VEVKFSVSGVSTLYYVHKRPYCDFFLSKV 283
           +K LVLDLDETL+HS  +   +  ++   I VE+   V  V    YV KRP  D FL ++
Sbjct: 244 KKCLVLDLDETLVHSSFK---YLRTADFVIPVEIDNQVHNV----YVIKRPGVDEFLRRI 296

Query: 284 SKWYDLIIFTASMKEYADPVIDWLEDSLPDK-FSQRLYRTDCILRDGVGYIKDLSVISEA 342
           ++ Y++++FTAS+  Y DP++D L+    DK    RL+R  C   +G  YIK+LS I   
Sbjct: 297 TELYEVVVFTASVSRYGDPLLDILD---KDKTIHHRLFRDSCYNYEG-NYIKNLSQIGRP 352

Query: 343 SGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                       L ++II+DNSP SY  + ++AI +  W SD  D
Sbjct: 353 ------------LSDMIILDNSPASYIFHPQHAIPISSWFSDAHD 385

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 88/165 (53%), Gaps = 21/165 (12%)

Query: 223 NRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSK 282
           N +K LVLDLDETL+HS  +    ++      VE+   +  V    YV KRP  D FL  
Sbjct: 238 NGKKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQIHNV----YVIKRPGVDEFLKL 291

Query: 283 VSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEA 342
           V + Y++++FTAS+  Y DP++D L+ +       RL+R  C   DG  YIK+LS I   
Sbjct: 292 VGQLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NYIKNLSQIGRP 348

Query: 343 SGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                       L ++II+DNSP SY  + ++AI +  W SD  D
Sbjct: 349 ------------LSDLIILDNSPASYIFHPQHAIPISSWFSDVHD 381

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 90/174 (51%), Gaps = 21/174 (12%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKR 273
           L+P      N +K LVLDLDETL+HS  +    ++      V++   +  V    YV KR
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFKYLRTADFVL--PVDIDDQIHNV----YVIKR 325

Query: 274 PYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYI 333
           P  D FL +V   Y++++FTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 326 PGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKH--KTIHHRLFRESCYNYEG-NYI 382

Query: 334 KDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           K+LS I               L +III+DNSP SY  + ++AI +  W SD  D
Sbjct: 383 KNLSQIGRP------------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHD 424

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 89/164 (54%), Gaps = 23/164 (14%)

Query: 225 RKKLVLDLDETLIHSMSRGTTHSNSSQGHI-VEVKFSVSGVSTLYYVHKRPYCDFFLSKV 283
           +K L+LDLDETL+HS  +  T   S+   I V++   +  V    YV KRP  D FL  V
Sbjct: 518 KKCLILDLDETLVHSSFKYLT---SADFVIPVDIDEQIHNV----YVIKRPGVDQFLETV 570

Query: 284 SKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEAS 343
           SK +++++FTAS+  Y DP++D L+         RL+R  C   +G  YIK+LS I    
Sbjct: 571 SKIFEVVVFTASVSRYGDPLLDVLDKHRC--IHHRLFREACYDYEG-NYIKNLSQIGRP- 626

Query: 344 GMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                      L E+II+DNSP SY  + ++AI +  W SD  D
Sbjct: 627 -----------LSELIILDNSPASYIFHPQHAIPISSWFSDTHD 659

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (53%), Gaps = 23/175 (13%)

Query: 214 LIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHI-VEVKFSVSGVSTLYYVHK 272
           L+P    +   RK LVLDLDETL+HS  +   + +++   I VE+   V  V    YV K
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFK---YLHTADFVIPVEIDNQVHNV----YVIK 349

Query: 273 RPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGY 332
           RP  D FL +V + +++++FTAS+  Y DP++D L+         RL+R  C   +G  Y
Sbjct: 350 RPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQY--KAVHHRLFRDSCYNYEG-NY 406

Query: 333 IKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           IK+LS I               L ++II+DNSP SY  + ++A+ +  W SD  D
Sbjct: 407 IKNLSQIGRP------------LSDLIILDNSPASYIFHPQHAVPISSWFSDAHD 449

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 86/163 (52%), Gaps = 20/163 (12%)

Query: 225 RKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVS 284
           +K LVLDLDETL+HS  +    ++      V +   +  V    YV KRP  + FL +V 
Sbjct: 302 KKCLVLDLDETLVHSSFKYLQTADFVLP--VNIDEQIHNV----YVIKRPGVEEFLKRVG 355

Query: 285 KWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASG 344
           + +++++FTAS+  Y DP++D L D        RL+R  C   +G  YIK+LS +     
Sbjct: 356 ELFEVVVFTASVARYGDPLLDIL-DPGRQLIHHRLFREACYNYEG-NYIKNLSQMGRP-- 411

Query: 345 MKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                     L EIII+DNSP SY  + ++AI +  W SD  D
Sbjct: 412 ----------LSEIIILDNSPASYIFHPQHAIPISSWFSDSHD 444

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP CD+FL  +S++Y++++F+++   YA+ + + L D +    S  L++  C+ +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKL-DPIHAFVSYNLFKEHCVYKDGV- 265

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKD            IS L   LG+++ ID  P +Y +  ENAI ++ W  +  D
Sbjct: 266 HIKD------------ISKLNRDLGKVVTIDTDPNTYKLQPENAIPMDPWTGEADD 309

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 76/153 (49%), Gaps = 27/153 (17%)

Query: 235 TLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTA 294
           TL+ ++     HS  SQ H              +   KRP  D+FL  +S++Y++++F++
Sbjct: 193 TLVITLEDFLVHSEWSQKHG-------------WRTAKRPGADYFLGYLSQYYEIVLFSS 239

Query: 295 SMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPS 354
           +   Y+D + + L D +    S  L++  C+ +DGV +IKDLS             L   
Sbjct: 240 NYMMYSDKIAEKL-DPIHAFVSYNLFKEHCVYKDGV-HIKDLS------------KLNRD 285

Query: 355 LGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           L ++IIID  P SY +  ENAI +E W  +  D
Sbjct: 286 LSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 318

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 64/116 (55%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP CD+FL  +S++Y++++F+++   Y+D + + L D +    S  L++  C+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKL-DPIHAFISYNLFKEHCVYKDGI- 278

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKD            IS +   +G++++ID  P  Y    ENAI  + W   P D
Sbjct: 279 HIKD------------ISKMNRDVGKVVMIDTDPNCYKSQPENAIPAKPWDGTPDD 322

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 64/110 (58%), Gaps = 14/110 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   YA+ V + + D +    +  LY+  C+ +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKM-DPIHAFVTYNLYKEHCLYKDGV- 273

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGW 381
           +IKDLS ++              LG+ +IID  P SY +  ENAI V+ W
Sbjct: 274 HIKDLSKLNR------------DLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 65/116 (56%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S+++++++F+++   Y+D + + L D +    S  L++  C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKL-DPIHAFVSYNLFKEHCVYKDGV- 274

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS             L   L ++IIID  P SY +  ENAI ++ W  +  D
Sbjct: 275 HIKDLS------------KLNRDLSKVIIIDTEPNSYKLQPENAIPMDPWNGEADD 318

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 66/116 (56%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S+++++++F+++   Y++ + + L D +    S  L++  C+ +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKL-DPIHAFVSYNLFKEHCVYKDGV- 279

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS ++              L ++IIID  P SY +  ENAI +E W  +  D
Sbjct: 280 HIKDLSKLNR------------DLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 323

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 65/116 (56%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   Y++ + + L D +    S  LY+  C+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKL-DPIHAFISYNLYKEHCVYKEG-D 283

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS ++              LG++II+D  P SY +  ENAI ++ W     D
Sbjct: 284 HIKDLSKLNR------------DLGKVIIVDTDPASYKLQPENAIPMQPWDGKADD 327

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 65/116 (56%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   Y+D V + L D +    +  L++  C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKL-DPIHAFITYNLFKEHCLYKDGV- 269

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS ++              LG+ +IID  P +Y +  ENAI ++ W     D
Sbjct: 270 HIKDLSKLNR------------DLGKTVIIDCDPNAYKLQPENAIPMKPWDGKADD 313

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 65/116 (56%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   Y + + + L D L    S  L++  C+ +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKL-DPLHAFISYSLFKEHCVYKDGV- 293

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS ++              + +++IID  P +Y +  ENAI +E W  +  D
Sbjct: 294 HIKDLSKLNR------------DVNKVLIIDTDPNNYKLQPENAIPMEPWKGEADD 337

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 64/116 (55%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   Y+D V + L D +    +  L++  C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKL-DPIHAFITYNLFKEHCLYKDGV- 270

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS ++              LG+ II+D  P +Y +  ENAI +  W     D
Sbjct: 271 HIKDLSKLNR------------DLGKTIIVDCDPNAYKLQPENAIPMRPWDGKADD 314

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 64/116 (55%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  ++FL  +S++Y++++F+++   Y++   + L D +    S  L++  C+ +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKL-DPIHAFVSYNLFKEHCVYKDGV- 277

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS             L   L ++IIID  P SY +  ENAI ++ W  +  D
Sbjct: 278 HIKDLS------------KLKRDLSKVIIIDTDPNSYKLQPENAIPMDPWNGEADD 321

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 64/116 (55%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   Y + + + L D L    S  L++  C+ +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKL-DPLHAFISYNLFKEHCVYKDGV- 285

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS ++              + +++IID  P +Y +  ENAI V+ W     D
Sbjct: 286 HIKDLSKLNR------------DVNKVLIIDTEPNNYKLQPENAIPVKPWDGKADD 329

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 35/160 (21%)

Query: 228 LVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWY 287
           LVL L++ L+HS    T  S                    +   KRP  D+FL  +S++Y
Sbjct: 197 LVLSLEDLLVHS--EWTQQSG-------------------WRTAKRPGVDYFLGYLSQYY 235

Query: 288 DLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKN 347
           ++++F+++   YA+ + + L D +    +  L++  C+ +DGV +IKDLS ++       
Sbjct: 236 EIVLFSSNYMMYAEKIAEKL-DPIHAFITYNLFKEHCLYKDGV-HIKDLSKLNR------ 287

Query: 348 ISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                  LG+++IID    S+ +  ENAI +E W     D
Sbjct: 288 ------DLGKVLIIDTDENSFKLQPENAIYLEPWDGKADD 321

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 75/147 (51%), Gaps = 27/147 (18%)

Query: 235 TLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTA 294
           TL+ ++     HS  SQ H         G  T     KRP  D+FL  +S++Y++++F++
Sbjct: 197 TLVLTLEDLLVHSEWSQKH---------GWRTA----KRPGVDYFLGYLSQYYEIVLFSS 243

Query: 295 SMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPS 354
           +   Y+D + + L D +    S  L++  C+ +DGV +IKDLS ++              
Sbjct: 244 NYMMYSDRIAEKL-DPIHAFVSYNLFKEHCLYKDGV-HIKDLSKLNRDE----------- 290

Query: 355 LGEIIIIDNSPISYAMNVENAIQVEGW 381
             +++IID  P SY +  ENAI ++ W
Sbjct: 291 -KKVLIIDVDPNSYKLQPENAIPMKPW 316

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 63/116 (54%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   YA+ + + + D +    S  L++  C+ +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKM-DPIHAFISYNLFKEHCVYKDGV- 280

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDL            S L   L +++IID    SY +  ENAI ++ W     D
Sbjct: 281 HIKDL------------SKLNRDLKKVMIIDTDENSYKLQPENAIPMDPWDGKADD 324

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 63/116 (54%), Gaps = 14/116 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   Y++ + + L D +    S  LY+  C+ ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKL-DPIHAFVSYNLYKEHCVYKEGT- 274

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
           +IKDLS ++              L +++IID  P +Y    ENAI V+ W     D
Sbjct: 275 HIKDLSKLNR------------DLDKVLIIDCDPNNYKFQPENAIPVKPWNGQADD 318

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 62/110 (56%), Gaps = 14/110 (12%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           KRP  D+FL  +S++Y++++F+++   +++ + + L D +    +  L++  C+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKL-DPIHAFITYNLFKEHCVYKDGI- 284

Query: 332 YIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGW 381
           +IKDLS ++              LG+ IIID    ++ +  ENAI  E W
Sbjct: 285 HIKDLSHLNR------------DLGKTIIIDTDANAFKLQPENAIHAEPW 322

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 14/109 (12%)

Query: 273 RPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGY 332
           RP  D+ L  +S +Y+ ++F ++   Y+  V++ L D +    +  L++  C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKL-DPIRAFITYNLFKDHCVYKDGI-H 274

Query: 333 IKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGW 381
           IKDLS ++              LG+ +IID  P S  + +ENAI  E W
Sbjct: 275 IKDLSHLNR------------DLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 14/122 (11%)

Query: 266 TLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCI 325
           T +   KRP  D+FL  +S++Y++++F+++   Y++ + + L D L    S  L++  C+
Sbjct: 205 TGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKL-DPLHAFISYNLFKEHCV 263

Query: 326 LRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDP 385
            +D V +IKDLS ++              + +++I+D    SY +  ENA+ +  W   P
Sbjct: 264 YKDHV-HIKDLSKLNR------------DVRKVVIMDTDANSYKLQPENALPMAPWDGKP 310

Query: 386 TD 387
            D
Sbjct: 311 DD 312

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 75/160 (46%), Gaps = 35/160 (21%)

Query: 228 LVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWY 287
           LVL L++ L+HS     T  N                   +   KRP  D+FL  +S++Y
Sbjct: 168 LVLSLEDLLVHS---EWTQKNG------------------WRTAKRPGVDYFLGYLSQYY 206

Query: 288 DLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKN 347
           ++++F+++   Y++ + + L D +    S  L++  C+ + G  +IKDLS ++       
Sbjct: 207 EIVLFSSNYMMYSEKIAEKL-DPIHAFISYNLFKEHCVYKKG-KHIKDLSKLNR------ 258

Query: 348 ISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387
                  + ++IIID    +Y +  ENAI ++ W     D
Sbjct: 259 ------DVNKVIIIDTDKNNYKLQPENAIPMKPWSGTADD 292

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 22/95 (23%)

Query: 228 LVLDLDETLIHSMSRGTTH------SNSSQGHIVEVK-FSVSGVSTL------------- 267
           LV+DLD+T+IH     T H      SN +   +  VK FS+     L             
Sbjct: 168 LVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRK 227

Query: 268 --YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYA 300
             YYV  RP    F  K++  ++L I+T + + YA
Sbjct: 228 CQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 293 TASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGY 332
           TA +K + + V   L++  P+  SQR+Y+ DC L   +G+
Sbjct: 101 TAKLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGF 140

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 23/129 (17%)

Query: 217 RSIVQTNRRKKLVLDLDETLIHSMSRGTTHS------NSSQGHIVEVK-FSVSGVSTL-- 267
           R+ ++  ++  LV+DLD+T+IH     T         N +   + +VK FS+     L  
Sbjct: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219

Query: 268 -------------YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDK 314
                        YYV  RP    FL K++  +++ I+T + + YA  +   + D   D 
Sbjct: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKII-DPNGDL 278

Query: 315 FSQRLYRTD 323
           F  R+   D
Sbjct: 279 FGDRILSRD 287

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 27/128 (21%)

Query: 220 VQTNRRKKLVLDLDETLIHSMSRGTTH------SNSSQGHIVEVK-FSVSGVSTL----- 267
           ++  ++  LV+DLD+T+IH     T        SN +   + +VK FS+     L     
Sbjct: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221

Query: 268 ----------YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDK--F 315
                     YYV  RP    F  K++  Y++ I+T + + YA  +   ++   PDK  F
Sbjct: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIID---PDKSLF 278

Query: 316 SQRLYRTD 323
             R+   D
Sbjct: 279 GDRILSRD 286

>YAL019W Chr1 (114919..118314) [3396 bp, 1131 aa] {ON}
           FUN30Conserved member of the Snf2p family with
           ATP-dependent chromatin remodeling activity; has a role
           in silencing; potential Cdc28p substrate; authentic,
           non-tagged protein is detected in purified mitochondria
           in high-throughput studies
          Length = 1131

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 11/92 (11%)

Query: 264 VSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTD 323
           +ST     ++P   FF  K      L+    S+K+Y    I+WL     +K S       
Sbjct: 544 ISTTSRNGRKPIVKFFKGKPR----LLSPEISLKDYQQTGINWLNLLYQNKMS------- 592

Query: 324 CILRDGVGYIKDLSVISEASGMKNISALPPSL 355
           CIL D +G  K   VIS  + +K I+   P L
Sbjct: 593 CILADDMGLGKTCQVISFFAYLKQINEPGPHL 624

>Smik_1.48 Chr1 (97867..101241) [3375 bp, 1124 aa] {ON} YAL019W
           (REAL)
          Length = 1124

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 11/101 (10%)

Query: 255 VEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDK 314
           V V+ +    ST     ++P   FF  K      L+    S+K+Y    I+WL     +K
Sbjct: 530 VAVRKNRHVASTTNRNGRKPIVKFFKGKPR----LLSSEISLKDYQQTGINWLNLLYQNK 585

Query: 315 FSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSL 355
            S       CIL D +G  K   VIS  + +K I+   P L
Sbjct: 586 MS-------CILADDMGLGKTCQVISFFAYLKQINEPGPHL 619

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 46/104 (44%), Gaps = 24/104 (23%)

Query: 224 RRKKLVL--DLDETLIHSMSRGTTH------SNSSQGHIVEVK-FSVSGVSTL------- 267
           R KKL+L  DLD+T+IH     T        +N +   + +VK F +     L       
Sbjct: 161 REKKLILVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGP 220

Query: 268 --------YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPV 303
                   YYV  RP    F  +VSK Y++ I+T + + YA  +
Sbjct: 221 KPPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEI 264

>Skud_1.42 Chr1 (90362..93742) [3381 bp, 1126 aa] {ON} YAL019W
           (REAL)
          Length = 1126

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 11/92 (11%)

Query: 264 VSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTD 323
            ST     ++P   FF  K      L+    S+K+Y    I+WL     +K S       
Sbjct: 540 TSTTSRSGRKPIVKFFKGKPR----LLSPDISLKDYQQTGINWLNLLYQNKMS------- 588

Query: 324 CILRDGVGYIKDLSVISEASGMKNISALPPSL 355
           CIL D +G  K   VIS  + +K I+   P L
Sbjct: 589 CILADDMGLGKTCQVISFFAYLKQINEPSPHL 620

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 34  NNNEKIKSHSKATTNNDEDYSTPMADSSSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFP 93
           N++EK+ S S++  N+DE +  P   ++SS     S A+   ++    S        FF 
Sbjct: 147 NDDEKVSSESRSYKNDDEVFKKPQISATSSQNATTSAAIRKLNKTRPVS--------FFD 198

Query: 94  KFLIVKPL 101
           K+L+ K L
Sbjct: 199 KYLLGKEL 206

>Suva_1.48 Chr1 (91216..94602) [3387 bp, 1128 aa] {ON} YAL019W
           (REAL)
          Length = 1128

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 11/84 (13%)

Query: 272 KRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVG 331
           ++P   FF  K      L+    S+K+Y    I+WL     +K S       CIL D +G
Sbjct: 551 RKPIVKFFKGKPR----LLSSEISLKDYQQTGINWLNLLYHNKMS-------CILADDMG 599

Query: 332 YIKDLSVISEASGMKNISALPPSL 355
             K   VIS  + +K I+   P L
Sbjct: 600 LGKTCQVISFFAYLKQINEPGPHL 623

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 47/118 (39%), Gaps = 23/118 (19%)

Query: 228 LVLDLDETLIHS--------MSRGTTHSN-SSQGHIVEVKFSVSGVSTL----------- 267
           LV+DLD+T+IH           R  T+ N  +   + E       +  L           
Sbjct: 214 LVVDLDQTVIHCGVDPTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARK 273

Query: 268 --YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTD 323
             YYV  RP    F  KV+  +++ I+T + + YA  +   + D   D F  R+   D
Sbjct: 274 CWYYVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKII-DPTGDLFGNRILSRD 330

>ZYRO0E00396g Chr5 complement(21090..22190) [1101 bp, 366 aa] {ON}
           conserved hypothetical protein
          Length = 366

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 320 YRTDCILRDGVGYIKD---LSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAI 376
           YR D     GVG  KD   L+ + +AS  K+   +    GE I +DN P S  +NV   +
Sbjct: 194 YRNDVEAVQGVGPHKDSDFLTFVYQASDHKDTLQVQNFKGEWISVDNIPGSLVVNVGQTL 253

Query: 377 QV 378
           + 
Sbjct: 254 EA 255

>TPHA0H02660 Chr8 complement(622277..625420) [3144 bp, 1047 aa] {ON}
           Anc_7.80 YAL019W
          Length = 1047

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 11/86 (12%)

Query: 270 VHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDG 329
           +  R    FF+ K      L+    ++K+Y    I+WL     +K S       CIL D 
Sbjct: 468 IKARKLIKFFMGKPK----LLAEDITLKDYQQAGINWLNLMYHNKMS-------CILADD 516

Query: 330 VGYIKDLSVISEASGMKNISALPPSL 355
           +G  K   VIS  + +K I+   P L
Sbjct: 517 MGLGKTCQVISFMAYLKQINEPGPHL 542

>Kwal_14.2352 s14 complement(721226..724063) [2838 bp, 945 aa] {ON}
           YJL084C - Hypothetical ORF [contig 225] FULL
          Length = 945

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 9/55 (16%)

Query: 4   LSYISSHLASPIHYLKKK--EPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTP 56
           LS ISS LA PIH L+K   EP     EQ P        SHS + T ++ D   P
Sbjct: 597 LSPISSPLARPIHMLRKPSFEPPPFDAEQPP-------PSHSMSRTQSESDGHAP 644

>KLLA0F26829g Chr6 (2477782..2478405) [624 bp, 207 aa] {ON} similar
           to uniprot|P35723 Saccharomyces cerevisiae YKL065C YET1
           Endoplasmic reticulum transmembrane protein homolog of
           human BAP31 protein
          Length = 207

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 104 LWFIVTFP--LYLLERGMKHRTLLK---------NKLDENSQKNAERVPTTSPELTVIDE 152
           L+F +  P  L LL R +K+ TL++         NK DE  +  A+     SP+LT + +
Sbjct: 107 LYFTICIPVLLNLLTRLVKYETLIRELNSVPAVENKQDEKDKNKAKEKEVASPQLTALQK 166

Query: 153 TTE 155
             E
Sbjct: 167 ELE 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,473,861
Number of extensions: 1877218
Number of successful extensions: 10715
Number of sequences better than 10.0: 96
Number of HSP's gapped: 10834
Number of HSP's successfully gapped: 100
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)