Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F009202.531ON35435414640.0
NCAS0F00910singletonON350652573e-24
NCAS0J00640na 1ON102612132e-20
KAFR0A018402.531ON414652109e-18
NDAI0B030808.116ON460572111e-17
ZYRO0E02684g8.116ON133521925e-17
KNAG0D022808.117ON435572047e-17
TPHA0A04530singletonON501582031e-16
SAKL0H20394g8.117ON359811973e-16
Kpol_1018.352.531ON517671968e-16
Suva_16.3358.116ON317831939e-16
NCAS0B046708.116ON266851909e-16
NDAI0C06260na 1ON582791961e-15
TDEL0F011708.116ON162521841e-15
KAFR0B019908.116ON410801931e-15
SAKL0H20416g8.116ON317611911e-15
NCAS0B05750singletonON505561932e-15
Skud_16.2988.116ON317581902e-15
Smik_16.2538.116ON317581892e-15
YPR013C8.116ON317581893e-15
CAGL0J01595g8.117ON344631893e-15
YPR015C8.117ON247541837e-15
KAFR0B020008.117ON303701857e-15
KAFR0C031408.117ON370541878e-15
Smik_16.2558.117ON247541829e-15
KNAG0D022908.116ON435521871e-14
Skud_16.3008.117ON249541821e-14
Suva_16.3388.117ON247541821e-14
Kpol_495.20singletonON486571861e-14
Ecym_1383na 2ON381691842e-14
NCAS0C042308.117ON338541832e-14
Kpol_541.398.116ON291561803e-14
SAKL0A09438g2.531ON441541833e-14
AEL077Wna 2ON336521814e-14
TBLA0E039308.116ON462541824e-14
KNAG0G011408.117ON519521825e-14
NDAI0B02080singletonON273661768e-14
TBLA0B064102.531ON449661799e-14
NCAS0B046608.117ON256581741e-13
SAKL0D15136gsingletonON271631732e-13
CAGL0L05786g8.116ON348521725e-13
KLLA0F11682g3.298ON374561719e-13
NDAI0B019408.116ON336541691e-12
KLLA0F20636gsingletonON285611644e-12
KLTH0D06798g2.531ON111741544e-12
KLLA0A04609gsingletonON423571647e-12
Kwal_26.80112.531ON190531579e-12
Ecym_8387na 3ON179551561e-11
SAKL0A10582gsingletonON288801601e-11
KLTH0H08800g8.117ON168681541e-11
Kwal_14.22068.117ON254581572e-11
CAGL0M01870g3.298ON315561574e-11
ADL040Wna 4ON330511575e-11
Ecym_8377na 4ON310511565e-11
ADL050Wna 3ON146511486e-11
KAFR0C003403.298ON394531576e-11
Kwal_27.104673.298ON302701548e-11
Kpol_1052.83.298ON386791541e-10
SAKL0A10648gsingletonON261741511e-10
TPHA0A039103.298ON351771522e-10
KNAG0J022503.296ON296571512e-10
SAKL0D02618g3.298ON321641512e-10
AGL207W3.298ON277721493e-10
ADL051Wna 5ON173681444e-10
KNAG0H010703.298ON322551494e-10
Ecym_26733.298ON301761477e-10
KLTH0C04884g3.298ON342561478e-10
Ecym_8389singletonON251821441e-09
NDAI0A075403.298ON370671461e-09
Ecym_8388na 5ON223511402e-09
TBLA0I020603.298ON833571462e-09
NCAS0I014603.298ON330531433e-09
TBLA0G032403.298ON511551425e-09
Ecym_4128na 6ON312511397e-09
Ecym_8011na 7ON276741387e-09
AGR186Cna 6ON287511389e-09
Ecym_26543.281ON257571371e-08
Kpol_1065.483.298ON364581391e-08
TPHA0A039803.281ON314591371e-08
KAFR0H012903.298ON330651372e-08
Skud_7.2494.80ON502711382e-08
ADR308Cna 7ON278511342e-08
NCAS0A018204.80ON455731353e-08
Smik_7.2514.80ON505711354e-08
YGL035C (MIG1)4.80ON504711354e-08
Suva_7.2404.80ON515711345e-08
Ecym_8379na 8ON305701325e-08
KNAG0E016003.518ON338551318e-08
AGR031W3.281ON140571241e-07
ZYRO0C13508g3.281ON189591251e-07
NDAI0D037504.80ON493701302e-07
Kpol_1026.84.80ON412721292e-07
KAFR0F036004.80ON335751282e-07
TDEL0F026904.80ON350711282e-07
ADL042Wna 8ON281701272e-07
Kpol_1050.193.518ON221551252e-07
ZYRO0E08426g3.518ON171551232e-07
KNAG0B005903.518ON439551283e-07
CAGL0A01628g4.80ON424771274e-07
KNAG0I020702.162ON572531274e-07
SAKL0F01980g3.518ON385741255e-07
NCAS0F037403.518ON288681245e-07
KLLA0F18524g3.281ON357571256e-07
Skud_5.1373.518ON394631256e-07
KLLA0F22319gsingletonON203461216e-07
Kpol_505.152.162ON510571256e-07
NCAS0A106503.281ON293621236e-07
NCAS0B069602.162ON839551257e-07
Suva_2.2003.281ON232731218e-07
KNAG0D037104.80ON459551231e-06
TDEL0F045108.326ON743611231e-06
Kpol_1036.708.326ON674761231e-06
TBLA0A089104.80ON390551221e-06
NCAS0C032408.326ON620791231e-06
KAFR0F041503.518ON416581221e-06
YOR113W (AZF1)2.162ON914531222e-06
YDR043C (NRG1)3.281ON231731182e-06
Suva_8.1662.162ON948531222e-06
Skud_15.2762.162ON917531222e-06
SAKL0H20988g4.80ON548751212e-06
TPHA0M011803.281ON350571202e-06
Skud_4.2973.281ON231731182e-06
AGL071C2.533ON396521202e-06
CAGL0E01331g8.326ON689731212e-06
NDAI0B042902.162ON1064521212e-06
Smik_4.2813.281ON231761172e-06
Kpol_1052.183.281ON357571202e-06
Smik_15.2912.162ON909531212e-06
KNAG0G024708.326ON736591212e-06
CAGL0L03916g2.162ON642521213e-06
NCAS0I015603.281ON266571183e-06
CAGL0C02519g3.518ON318641193e-06
Kpol_1072.582.162ON794541203e-06
KAFR0C004903.281ON224591173e-06
ZYRO0G09438g4.80ON329591183e-06
NDAI0I029003.518ON524551193e-06
KLTH0G01826g3.518ON307561184e-06
Ecym_72552.533ON544521194e-06
TDEL0D058603.518ON330611184e-06
Kwal_47.190453.518ON266561174e-06
KAFR0A010903.281ON249711164e-06
KAFR0B045802.162ON729551194e-06
TPHA0B029102.162ON717541195e-06
KLLA0F26961g2.598ON694721195e-06
Suva_7.523.518ON400691175e-06
KLLA0F23782g2.162ON782511185e-06
SAKL0A09482g2.533ON388701175e-06
NDAI0G058001.326ON836721186e-06
TPHA0G008202.303ON532791176e-06
KAFR0A008001.326ON753701177e-06
TDEL0D034303.281ON175591127e-06
SAKL0D03146g3.281ON157581117e-06
KLTH0H09196g4.80ON460551167e-06
YGL209W (MIG2)3.518ON382551168e-06
NDAI0A056503.281ON330571158e-06
TBLA0B012802.162ON823631178e-06
KAFR0H032402.303ON519801168e-06
Klac_YGOB_Anc_3.5183.518ON239591138e-06
TBLA0C048803.518ON339531159e-06
CAGL0L07480g3.281ON314611159e-06
TDEL0B052502.162ON714541169e-06
KAFR0I023703.518ON391551151e-05
Suva_10.2248.326ON764591161e-05
Skud_7.593.518ON383551151e-05
Kwal_27.114602.303ON531771151e-05
NDAI0B060203.518ON426701151e-05
TPHA0C008008.326ON680581161e-05
NCAS0A091601.326ON773721161e-05
KLLA0E11023g4.80ON474601151e-05
TPHA0A058203.518ON276671131e-05
ZYRO0B02002g2.533ON294511131e-05
Kpol_1050.116singletonON329551141e-05
YER028C (MIG3)3.518ON394661141e-05
KLTH0C07172g3.281ON265741131e-05
KLTH0E09724g2.162ON768521151e-05
Kwal_47.178882.162ON786521151e-05
SAKL0B11330g2.598ON499711141e-05
Ecym_54242.162ON775521151e-05
Kpol_1003.502.303ON614671141e-05
Smik_7.543.518ON382551141e-05
ZYRO0B16148g2.162ON930531151e-05
ADL198W2.303ON547661142e-05
TBLA0G022302.533ON216511102e-05
CAGL0K12078g3.281ON463571132e-05
ACR264W2.162ON769521142e-05
YDR146C (SWI5)8.326ON709731142e-05
SAKL0E07216g2.303ON548661142e-05
KNAG0H034802.162ON796521142e-05
NCAS0B036008.326ON635711132e-05
KLTH0G10802g2.303ON526661132e-05
KNAG0C058102.533ON554521132e-05
TBLA0A039608.326ON850731132e-05
NCAS0E006103.518ON401601122e-05
ZYRO0F10428g8.326ON813751132e-05
KAFR0B057408.326ON619781122e-05
TBLA0I032803.518ON330671113e-05
KNAG0H011803.281ON254751103e-05
CAGL0K09372g3.518ON396631113e-05
KAFR0C04550singletonON467521113e-05
SAKL0E10714g2.162ON819521123e-05
NDAI0A074703.281ON263591093e-05
KNAG0A051708.326ON645591113e-05
CAGL0L06072g8.144ON300791104e-05
Suva_2.3078.326ON691591114e-05
NDAI0G025608.326ON794761114e-05
Kpol_344.48.326ON756751114e-05
TBLA0B060502.303ON762771114e-05
KLLA0E08713g2.303ON596671105e-05
TPHA0F018102.162ON425721105e-05
AFR471C4.80ON389551095e-05
Suva_4.3053.281ON220731075e-05
Ecym_33412.303ON560661105e-05
Kwal_27.109253.281ON264571085e-05
TBLA0I019703.281ON288511085e-05
Smik_5.1513.518ON388551095e-05
Kpol_1065.153.281ON220561066e-05
Suva_13.2462.533ON419691096e-05
YLR131C (ACE2)8.326ON770761096e-05
Ecym_62951.326ON663711096e-05
Suva_6.1321.326ON878641106e-05
Kwal_26.83512.598ON698751096e-05
NCAS0A129102.598ON822581096e-05
Smik_12.1948.326ON769591097e-05
Skud_4.4058.326ON707501097e-05
TPHA0D034003.518ON338521087e-05
CAGL0M04323g8.326ON703851088e-05
KLLA0A10373gna 9ON206641058e-05
Kwal_14.22784.80ON463551088e-05
Suva_5.1243.518ON406661071e-04
TBLA0F003708.144ON687651071e-04
KNAG0J008703.281ON280611051e-04
KAFR0H022408.326ON623591071e-04
KLLA0D16456g8.326ON854501071e-04
KNAG0G012808.144ON472801061e-04
Smik_13.2492.533ON473651061e-04
Smik_4.3908.326ON708731061e-04
Skud_12.2008.326ON767591062e-04
KNAG0H019302.303ON618591052e-04
TBLA0G019202.598ON523551052e-04
KNAG0E026101.326ON746531052e-04
CAGL0J05060g1.326ON713551052e-04
KAFR0J003402.533ON218581022e-04
TBLA0H012608.326ON572591052e-04
Smik_10.1841.326ON885551052e-04
CAGL0M06831g2.303ON645511052e-04
TDEL0D019501.326ON755541052e-04
Ecym_14154.80ON504551042e-04
KLTH0G12254g8.326ON746591052e-04
TPHA0K017704.80ON518551043e-04
Kpol_1031.428.144ON359731033e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00920
         (354 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531    568   0.0  
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}              103   3e-24
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       87   2e-20
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    86   9e-18
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    86   1e-17
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    79   5e-17
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               83   7e-17
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             83   1e-16
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    80   3e-16
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    80   8e-16
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    79   9e-16
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                78   9e-16
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             80   1e-15
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    75   1e-15
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    79   1e-15
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    78   1e-15
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    79   2e-15
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    78   2e-15
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    77   2e-15
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    77   3e-15
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    77   3e-15
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    75   7e-15
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    76   7e-15
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               77   8e-15
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    75   9e-15
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    77   1e-14
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    75   1e-14
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    75   1e-14
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    76   1e-14
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    75   2e-14
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               75   2e-14
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    74   3e-14
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    75   3e-14
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    74   4e-14
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    75   4e-14
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    75   5e-14
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                72   8e-14
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    74   9e-14
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                72   1e-13
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    71   2e-13
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    71   5e-13
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    70   9e-13
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    70   1e-12
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    68   4e-12
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    64   4e-12
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    68   7e-12
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    65   9e-12
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    65   1e-11
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    66   1e-11
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    64   1e-11
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    65   2e-11
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    65   4e-11
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    65   5e-11
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    65   5e-11
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    62   6e-11
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    65   6e-11
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    64   8e-11
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    64   1e-10
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    63   1e-10
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    63   2e-10
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               63   2e-10
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    63   2e-10
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    62   3e-10
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    60   4e-10
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    62   4e-10
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    61   7e-10
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    61   8e-10
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    60   1e-09
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    61   1e-09
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    59   2e-09
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     61   2e-09
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    60   3e-09
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     59   5e-09
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    58   7e-09
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    58   7e-09
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    58   9e-09
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    57   1e-08
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    58   1e-08
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    57   1e-08
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    57   2e-08
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    58   2e-08
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    56   2e-08
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      57   3e-08
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    57   4e-08
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    57   4e-08
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    56   5e-08
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    55   5e-08
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    55   8e-08
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    52   1e-07
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    53   1e-07
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      55   2e-07
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    54   2e-07
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    54   2e-07
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    54   2e-07
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    54   2e-07
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    53   2e-07
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    52   2e-07
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    54   3e-07
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    54   4e-07
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    54   4e-07
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    53   5e-07
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    52   5e-07
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    53   6e-07
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    53   6e-07
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    51   6e-07
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    53   6e-07
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    52   6e-07
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    53   7e-07
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    51   8e-07
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    52   1e-06
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    52   1e-06
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    52   1e-06
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    52   1e-06
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     52   1e-06
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    52   1e-06
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    52   2e-06
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    50   2e-06
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    52   2e-06
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    52   2e-06
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    51   2e-06
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    51   2e-06
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    50   2e-06
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    51   2e-06
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    51   2e-06
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    51   2e-06
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    50   2e-06
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    51   2e-06
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    51   2e-06
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    51   2e-06
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    51   3e-06
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      50   3e-06
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    50   3e-06
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    51   3e-06
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    50   3e-06
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    50   3e-06
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    50   3e-06
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    50   4e-06
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    50   4e-06
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    50   4e-06
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    50   4e-06
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    49   4e-06
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    50   4e-06
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    50   5e-06
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    50   5e-06
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    50   5e-06
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    50   5e-06
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    50   5e-06
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    50   6e-06
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    50   6e-06
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    50   7e-06
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    48   7e-06
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    47   7e-06
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    49   7e-06
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    49   8e-06
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    49   8e-06
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    50   8e-06
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    49   8e-06
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    48   8e-06
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    49   9e-06
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    49   9e-06
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    49   9e-06
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    49   1e-05
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    49   1e-05
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    49   1e-05
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    49   1e-05
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    49   1e-05
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    49   1e-05
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    49   1e-05
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    49   1e-05
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    48   1e-05
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    48   1e-05
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    49   1e-05
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    49   1e-05
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    48   1e-05
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    49   1e-05
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    49   1e-05
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    49   1e-05
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    49   1e-05
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    49   1e-05
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    49   1e-05
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    49   1e-05
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    49   2e-05
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    47   2e-05
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    48   2e-05
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    49   2e-05
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    49   2e-05
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    49   2e-05
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    49   2e-05
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    48   2e-05
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    48   2e-05
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    48   2e-05
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    48   2e-05
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     48   2e-05
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    48   2e-05
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    48   2e-05
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    47   3e-05
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    47   3e-05
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    47   3e-05
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               47   3e-05
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    48   3e-05
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    47   3e-05
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    47   3e-05
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    47   4e-05
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    47   4e-05
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     47   4e-05
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    47   4e-05
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    47   4e-05
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    47   5e-05
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    47   5e-05
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    47   5e-05
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    46   5e-05
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    47   5e-05
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    46   5e-05
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    46   5e-05
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    47   5e-05
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    45   6e-05
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    47   6e-05
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    47   6e-05
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    47   6e-05
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    47   6e-05
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    47   6e-05
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    47   6e-05
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    47   7e-05
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    47   7e-05
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    46   7e-05
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    46   8e-05
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    45   8e-05
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    46   8e-05
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    46   1e-04
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    46   1e-04
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    45   1e-04
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    46   1e-04
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    46   1e-04
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    45   1e-04
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    45   1e-04
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    45   1e-04
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    45   2e-04
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    45   2e-04
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    45   2e-04
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    45   2e-04
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    45   2e-04
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       44   2e-04
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    45   2e-04
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    45   2e-04
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    45   2e-04
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    45   2e-04
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    45   2e-04
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    45   2e-04
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    45   3e-04
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    44   3e-04
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    44   3e-04
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    44   3e-04
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    45   3e-04
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    44   3e-04
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    44   3e-04
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    44   3e-04
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    44   3e-04
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    44   3e-04
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    44   4e-04
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    44   4e-04
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    44   4e-04
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    43   4e-04
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     44   4e-04
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    44   4e-04
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    44   4e-04
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    44   5e-04
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    44   5e-04
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    44   5e-04
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    44   5e-04
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    44   5e-04
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    44   6e-04
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    44   6e-04
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    44   6e-04
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    44   6e-04
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    43   7e-04
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    42   7e-04
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    44   7e-04
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    44   7e-04
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    43   7e-04
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    43   8e-04
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    43   8e-04
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    43   8e-04
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    43   0.001
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    42   0.001
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    43   0.001
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    43   0.001
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    42   0.001
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    43   0.001
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    42   0.001
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    42   0.001
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    42   0.002
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    42   0.002
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    42   0.002
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    42   0.002
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    42   0.002
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    42   0.002
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    42   0.002
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    42   0.002
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    42   0.002
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    42   0.002
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    42   0.002
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    42   0.002
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    42   0.002
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    42   0.002
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    42   0.002
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    42   0.002
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    42   0.003
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    41   0.003
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    41   0.003
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    41   0.003
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    41   0.003
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     42   0.003
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    41   0.003
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    41   0.004
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    40   0.004
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    41   0.004
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    41   0.004
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    40   0.004
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    41   0.004
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    40   0.005
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    41   0.005
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    40   0.005
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    40   0.006
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    40   0.006
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    40   0.006
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    40   0.006
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    40   0.006
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    40   0.006
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    40   0.008
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    40   0.009
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    40   0.009
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    40   0.009
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    40   0.009
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    40   0.009
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    40   0.009
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    40   0.009
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    40   0.010
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    40   0.010
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    39   0.013
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    39   0.014
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    39   0.014
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    39   0.014
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    39   0.018
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     39   0.022
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    38   0.026
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    38   0.029
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      38   0.029
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    38   0.029
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    39   0.030
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    38   0.036
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    38   0.037
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    37   0.038
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    38   0.047
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    37   0.049
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    37   0.050
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    38   0.051
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    37   0.053
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    37   0.057
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    37   0.059
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    37   0.066
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    37   0.071
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    37   0.072
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    37   0.077
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    37   0.080
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    35   0.090
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    37   0.094
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    36   0.096
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    37   0.098
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    37   0.10 
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     36   0.10 
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    36   0.11 
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    36   0.11 
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    36   0.12 
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    36   0.13 
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    36   0.13 
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    36   0.15 
KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} simi...    36   0.16 
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    35   0.20 
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    35   0.22 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    35   0.24 
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    35   0.24 
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    35   0.25 
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    35   0.26 
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    35   0.27 
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    35   0.28 
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    35   0.29 
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    34   0.31 
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    35   0.31 
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    35   0.32 
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    35   0.32 
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    35   0.33 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    35   0.34 
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    35   0.35 
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    34   0.36 
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    35   0.37 
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    35   0.37 
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    35   0.38 
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    33   0.38 
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      34   0.39 
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    35   0.39 
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     34   0.40 
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    34   0.43 
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    34   0.48 
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    34   0.49 
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    34   0.49 
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    34   0.49 
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    34   0.51 
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    34   0.52 
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    34   0.53 
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    34   0.53 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    34   0.55 
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    34   0.55 
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    34   0.58 
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    34   0.58 
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    33   0.59 
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    34   0.60 
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    34   0.61 
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      33   0.65 
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    33   0.66 
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    33   0.72 
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    33   0.77 
Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375...    33   0.79 
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    33   0.82 
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    33   0.82 
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    34   0.83 
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    33   0.88 
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    33   0.90 
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    33   0.91 
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    33   0.93 
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    33   1.0  
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    33   1.0  
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    33   1.0  
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    33   1.1  
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      33   1.1  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    32   1.1  
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    33   1.1  
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                33   1.2  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    33   1.2  
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    33   1.3  
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    33   1.3  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    33   1.3  
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    33   1.4  
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    33   1.6  
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    33   1.6  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    33   1.6  
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    33   1.7  
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    33   1.8  
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    32   1.8  
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    33   1.8  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    33   1.8  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    32   1.8  
KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON} Anc_4...    32   1.8  
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    32   1.9  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    32   1.9  
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    32   1.9  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    32   2.0  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    32   2.1  
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    32   2.1  
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    32   2.1  
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    32   2.2  
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    32   2.2  
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    32   2.3  
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    32   2.3  
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    32   2.3  
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    32   2.4  
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    31   2.7  
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    32   2.9  
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     32   2.9  
Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375...    32   3.2  
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    31   3.4  
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    32   3.4  
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    32   3.5  
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    32   3.6  
TDEL0F01070 Chr6 complement(190506..194921) [4416 bp, 1471 aa] {...    32   3.7  
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    32   3.9  
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    32   4.1  
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    28   4.2  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    31   4.7  
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    31   4.8  
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    31   4.9  
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    31   5.0  
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    31   5.2  
YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}  STP3Zinc-...    31   5.3  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    31   5.4  
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    31   5.8  
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    31   6.0  
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    31   6.0  
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    31   6.0  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    31   6.2  
SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {...    30   6.6  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    30   6.8  
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    30   7.4  
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    30   7.6  
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    31   7.6  
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    30   7.8  
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    30   8.0  
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  30   8.1  
Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375...    30   8.8  
TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {O...    30   9.4  

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/354 (82%), Positives = 293/354 (82%)

Query: 1   MLSQEKPDSTAKGNSSDPNTSMVLSLKTSASNDTVALTNQSNDRIRHTRKRTLPSFNEGF 60
           MLSQEKPDSTAKGNSSDPNTSMVLSLKTSASNDTVALTNQSNDRIRHTRKRTLPSFNEGF
Sbjct: 1   MLSQEKPDSTAKGNSSDPNTSMVLSLKTSASNDTVALTNQSNDRIRHTRKRTLPSFNEGF 60

Query: 61  SNILPERETNTNVSLQKMERQAITNYIHVNPAQYPNQSVPMQQIARSKINFRNTNQMNYS 120
           SNILPERETNTNVSLQKMERQAITNYIHVNPAQYPNQSVPMQQIARSKINFRNTNQMNYS
Sbjct: 61  SNILPERETNTNVSLQKMERQAITNYIHVNPAQYPNQSVPMQQIARSKINFRNTNQMNYS 120

Query: 121 TXXXXXXXXXXXXILQTTSLPLVPCIFVPNVPYMPSKHSIATANYYPIPQFIHSNNEIKI 180
           T            ILQTTSLPLVPCIFVPNVPYMPSKHSIATANYYPIPQFIHSNNEIKI
Sbjct: 121 TNQFPPPSNQNQNILQTTSLPLVPCIFVPNVPYMPSKHSIATANYYPIPQFIHSNNEIKI 180

Query: 181 XXXXXXXXXXXXXXXXTIITNDIPKAPINSPSLMELPLXXXXXXXXXXXXXXXXERYLQH 240
                           TIITNDIPKAPINSPSLMELPL                ERYLQH
Sbjct: 181 PPPLPQLPSQFPNQQPTIITNDIPKAPINSPSLMELPLPPQNKPKPKNYYNDYYERYLQH 240

Query: 241 IKRRRVNRRXXXXXXXXXXXXXXXXXTALPEVQNDEPTTPKSTSRPSREKKPARIHKCPI 300
           IKRRRVNRR                 TALPEVQNDEPTTPKSTSRPSREKKPARIHKCPI
Sbjct: 241 IKRRRVNRRDHPQPQPQSKPDPSPDSTALPEVQNDEPTTPKSTSRPSREKKPARIHKCPI 300

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354
           CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ
Sbjct: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score =  103 bits (257), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 55/65 (84%)

Query: 288 REKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKS 347
           ++++  ++H C +C K +TRSTSLR+H+LIHTG +P+KC+WPNC  SSSVKSNITRH+KS
Sbjct: 277 KKRRGHKLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKS 336

Query: 348 HLKSQ 352
           HLK Q
Sbjct: 337 HLKGQ 341

>NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON} 
          Length = 102

 Score = 86.7 bits (213), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 51/61 (83%), Gaps = 2/61 (3%)

Query: 290 KKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           ++P+R  +CPIC KIVTRS+SL++H+L+HTG++P+KC W NC  + +VKSN+ RHYK HL
Sbjct: 36  RRPSR--QCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHL 93

Query: 350 K 350
           K
Sbjct: 94  K 94

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%)

Query: 290 KKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           KK  + ++CPIC K VTRS+SL  H+ +HTG++PY C WP C  + +VKSN+ RHYK HL
Sbjct: 329 KKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388

Query: 350 KSQNQ 354
           K + +
Sbjct: 389 KKEKE 393

>NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {ON}
           Anc_8.116
          Length = 460

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R  +CPIC KIVTR  SL++H+LIH+G +PYKC WP C+   +VKSN+ RHYK HLK
Sbjct: 386 RRRQCPICGKIVTRVNSLQTHMLIHSGYRPYKCKWPACEKMFNVKSNMNRHYKIHLK 442

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 78.6 bits (192), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 41/52 (78%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +CP+C KI +R ++L++H LIHTG+ P+KCTW NC  S +VKSN+ RH KSH
Sbjct: 67  QCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLKSH 118

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 83.2 bits (204), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R  +CP+C KI +R ++L++H  IHTG+ P+KCTWPNC  S +VKSN+ RH K+H K
Sbjct: 350 RTKQCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMKAHAK 406

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 45/58 (77%)

Query: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           IH+CPIC+++ TRS SL +H+L+HT +KP+KC W +C  + S+KSN++RH K H+  Q
Sbjct: 425 IHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIHIHKQ 482

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query: 270 PEVQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWP 329
           P +Q+    TPK+ S  +  +K    ++C IC K+ +R ++LR+H+L+HTG KPY C WP
Sbjct: 259 PVIQSYISPTPKTQSSATPNEKNLARNQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWP 318

Query: 330 NCDTSSSVKSNITRHYKSHLK 350
            C+ S +VKSN+ RHYK+H K
Sbjct: 319 GCNRSFNVKSNMIRHYKNHEK 339

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 80.1 bits (196), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 1/67 (1%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P++EKK    ++CP+C K V+R++SL SH+ IHT  +PYKC W  C+ + +VKSN+ RH 
Sbjct: 449 PNKEKKQVS-YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT 507

Query: 346 KSHLKSQ 352
           K H+K Q
Sbjct: 508 KLHIKKQ 514

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 79.0 bits (193), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 54/83 (65%), Gaps = 6/83 (7%)

Query: 278 TTPKSTSRPSREKKPARI------HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNC 331
           TT  S++  S  K  +RI       +CP+C KI +R ++L++H LIHTG+ P+KCTW  C
Sbjct: 230 TTSNSSAAFSDWKNGSRISSAKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGC 289

Query: 332 DTSSSVKSNITRHYKSHLKSQNQ 354
             S +VKSN+ RH KSH + +N+
Sbjct: 290 SKSFNVKSNMLRHLKSHERKRNK 312

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 77.8 bits (190), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 56/85 (65%), Gaps = 6/85 (7%)

Query: 272 VQNDEPTTPKSTSRPSREKKPARI------HKCPICDKIVTRSTSLRSHLLIHTGEKPYK 325
           +Q+ +P   K++S+   +K+  R        +CP C KI +R ++L++H LIHTG+ P+K
Sbjct: 170 LQDVKPIINKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFK 229

Query: 326 CTWPNCDTSSSVKSNITRHYKSHLK 350
           CTW NC+ + +VKSN+ RH K+H K
Sbjct: 230 CTWGNCNKAFNVKSNMLRHLKAHEK 254

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (64%), Gaps = 4/79 (5%)

Query: 274 NDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDT 333
           ND+    + + R  R K      +C IC K VTR+++L++H+L+HTG++P++C W  C  
Sbjct: 473 NDDDVGEEKSGRVRRRKS----RQCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHK 528

Query: 334 SSSVKSNITRHYKSHLKSQ 352
             +VKSN+ RHYK HLK Q
Sbjct: 529 RFNVKSNMNRHYKLHLKKQ 547

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 41/52 (78%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +CP+C K+ +R ++L++H LIHTG+ P+KC+W NC  S +VKSN+ RH KSH
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLKSH 153

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 55/80 (68%), Gaps = 9/80 (11%)

Query: 278 TTPKSTSRPSREKKPARIH---------KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTW 328
           T+ K++++ +R+KK   ++         +CP+C KI +R ++L++H LIHTG+ P+KCTW
Sbjct: 313 TSKKNSTKSNRDKKNYTVNFTSAVKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTW 372

Query: 329 PNCDTSSSVKSNITRHYKSH 348
            +C  S +VKSN+ RH KSH
Sbjct: 373 EDCSKSFNVKSNMLRHLKSH 392

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 293 ARIHK-CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKS 351
           AR+ + CPIC K+ +R ++L++H LIHTG  P+KC W NC+ S +VKSN+ RHYKSH ++
Sbjct: 254 ARLKRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYKSHERN 313

Query: 352 Q 352
           +
Sbjct: 314 E 314

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 43/56 (76%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           R  +C +C K+VTR++SL++H+LIHTG +P+ CTWP C  + +VKSN+ RH K HL
Sbjct: 445 RKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHL 500

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354
           +CP+C KI +R ++L++H LIHTG+ P+KCTW  C  S +VKSN+ RH KSH + +N+
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354
           +CP+C KI +R ++L++H LIHTG+ P+KCTW  C  S +VKSN+ RH KSH + +N+
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354
           +CP+C KI +R ++L++H LIHTG+ P+KCTW  C  S +VKSN+ RH KSH + +N+
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 47/63 (74%), Gaps = 1/63 (1%)

Query: 289 EKKPARIHK-CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKS 347
           +K   R+ K CP+C KI +R ++L++H+LIHTG+ P+KCTW +C  + +VKSN+ RH KS
Sbjct: 276 KKATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKS 335

Query: 348 HLK 350
           H K
Sbjct: 336 HEK 338

>YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON}
           Putative protein of unknown function; overexpression
           causes a cell cycle delay or arrest
          Length = 247

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 43/54 (79%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +CPIC K+ +R ++LR+H LIHTG+ P+KCTW +C+ S +VKSN+ RH ++H K
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 75.9 bits (185), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 5/70 (7%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSN 340
           K  SR  R++K     KCP+C K+ +R ++L++H LIHTG+ P+KCTW  C  + +VKSN
Sbjct: 221 KHLSREIRQRK-----KCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSN 275

Query: 341 ITRHYKSHLK 350
           + RH KSH K
Sbjct: 276 MLRHVKSHEK 285

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 41/54 (75%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +CP+C KI +R ++L++H LIHTG+ P+KC W  C  S +VKSN+ RH+KSH K
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFKSHEK 352

>Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 74.7 bits (182), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 43/54 (79%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +CPIC K+ +R ++LR+H LIHTG+ P+KCTW +C+ S +VKSN+ RH ++H K
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 41/52 (78%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +CP+C K+ +R ++L++H LIHTG+ P+KCTW +C  S +VKSN+ RH KSH
Sbjct: 371 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLKSH 422

>Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {ON}
           YPR015C (REAL)
          Length = 249

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 43/54 (79%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +CPIC K+ +R ++LR+H LIHTG+ P+KCTW +C+ S +VKSN+ RH ++H K
Sbjct: 188 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 241

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 42/54 (77%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +CPIC K+ +R ++LR+H LIHTG+ P+KCTW +C  S +VKSN+ RH ++H K
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLRTHQK 239

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (71%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           ++C +C K VTR+ SL +H+LIHT  +PYKC W NC  + +VKSN+ RH K HLK Q
Sbjct: 424 YECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKIHLKKQ 480

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (69%), Gaps = 1/69 (1%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P++ +K  R ++CP+C K+  R +SLR+H+ IHTG +P+ C WP C+   +VKSN+ RHY
Sbjct: 287 PNKRRKCVR-NQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHY 345

Query: 346 KSHLKSQNQ 354
           + H   +N+
Sbjct: 346 RLHQVQENK 354

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 42/54 (77%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +CP+C KI +R ++L++H LIHTG+ P++C W +C+ S +VKSN+ RH KSH K
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           +C IC KI +R  +L++HLLIHTG+ P+KC W NC  S +VKSN+ RH KSH + Q
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRKQ 205

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 43/54 (79%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +C  C K+ +RS+SL++H L+HTG++P+KC WP+C+ + +VKSN+ RHY+ H K
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +CP+C K+  R +SLR+H+ IHTG +P+ C WP C+   +VKSN+ RHY+ H
Sbjct: 275 QCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLH 326

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 41/54 (75%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +CP+C K+ +R ++L++H LIHTG+ PYKC W NC  S +VKSN+ RH K+H K
Sbjct: 356 QCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRHLKNHEK 409

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 40/52 (76%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +CP+C KI +R ++L++H +IHTG+ P+KC W  C+ S +VKSN+ RH KSH
Sbjct: 456 QCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLKSH 507

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 72.4 bits (176), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 46/66 (69%), Gaps = 1/66 (1%)

Query: 290 KKPARIHK-CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           K   R+ K C +C K+ +R ++L++H LIHTG+ P+KC+W  C  + +VKSN+ RH KSH
Sbjct: 202 KAKVRLRKQCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMKSH 261

Query: 349 LKSQNQ 354
            + +N+
Sbjct: 262 ERRRNK 267

>TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON}
           Anc_2.531
          Length = 449

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 1/66 (1%)

Query: 289 EKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           ++K AR H+C IC K++TRS+SL++H+ +HT  +P+KC W NC  + +VKSN+ RH K H
Sbjct: 375 KRKVAR-HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433

Query: 349 LKSQNQ 354
           L+ Q +
Sbjct: 434 LRRQAK 439

>NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON} 
          Length = 256

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 43/58 (74%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354
           +CP+C K+ +R ++L++H LIHTG+ P+KCT+  C  S +VKSN+ RH K H + +N+
Sbjct: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P R+K+ +  + CP C K   R + LR+H++IH G  P+ C WPNC    +VKSN+ RHY
Sbjct: 206 PPRKKRVSYTYCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHY 265

Query: 346 KSH 348
           +SH
Sbjct: 266 RSH 268

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 70.9 bits (172), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +CP+C K+ +R ++L++H LIHTG+ P+KC W +C  + +VKSN+ RH K H
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKS 351
           ++C  C K   R +SL +H+ IHTG+KPYKC +PNC    + KSN+ RHYK HLK+
Sbjct: 304 YRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKT 359

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +C IC KI +R ++L++H LIH+G+ P+KC W  C  + +VKSN+ RH+K H K
Sbjct: 256 QCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFKCHEK 309

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 67.8 bits (164), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 40/61 (65%)

Query: 288 REKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKS 347
           + K   +   C  C K  TR ++LR+H+L+H+G+KP++CTW  C+   +VKSN+ RH K 
Sbjct: 224 KGKANGKADICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

Query: 348 H 348
           H
Sbjct: 284 H 284

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 1/74 (1%)

Query: 275 DEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTS 334
             P  P +   P+   K  R ++C  C K+ TRS++L+SH+L+HTG++P+ C   +C  S
Sbjct: 29  SAPQRPSAVPTPAEAPKLLR-YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKS 87

Query: 335 SSVKSNITRHYKSH 348
            +VKSN+ RH+K+H
Sbjct: 88  FNVKSNMNRHFKTH 101

>KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C
          Length = 423

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 41/57 (71%)

Query: 292 PARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P + ++C IC +I +R ++L++HL IHTG+KPYKC   NC    +VKSN+ RHYK H
Sbjct: 337 PLKKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRH 393

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 41/53 (77%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           ++C +C KI +RS++L++HLL HTG +P++C + +C  + +VKSN+ RH K+H
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 38/55 (69%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           CP+C K  TR TSL +HLLIH   +PY+C +P+C  + +VKSN+ RH K H K +
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQE 165

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 273 QNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCD 332
           Q+  P  P  +  P+R   P   H CP C K   R ++L++H +IH G  PY CTW  C 
Sbjct: 198 QHSGPLCPVVSEAPAR---PKLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCS 254

Query: 333 TSSSVKSNITRHYKSHLKSQ 352
              +VK N+ RHY+ H K +
Sbjct: 255 KRFNVKGNLLRHYRIHTKKK 274

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P+R    A +H+C +C K  +R + L +H LIHTG +P+ C  P+C    +VKSN+ RH 
Sbjct: 101 PARAPPSATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHK 160

Query: 346 KSHLKSQN 353
           K H K ++
Sbjct: 161 KIHDKPRD 168

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (63%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           H+C IC K  +R + L +H LIHTG +PY C  PNC    +VKSN+ RH K H K ++
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 36/56 (64%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           C +C K   R +SL +H+ IHTGEKPY C + NC  S + KSN+ RHYK H K  N
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFKLSN 230

>ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR013C
          Length = 330

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (72%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C +C +  TR ++L++H+LIHTGE P++C+WP C    +V+SN+ RH  SH
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSH 310

>Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON}
           similar to Ashbya gossypii ADL040W
          Length = 310

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (70%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C +C +  TR ++L++H+LIHTGE P++C WP C    +V+SN+ RH  SH
Sbjct: 230 CTVCGRHCTRPSTLKTHMLIHTGELPFECNWPGCRKRFNVRSNMKRHLNSH 280

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 35/51 (68%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           CP+C K  TR TSL +HLLIH   +PY C + NC+ S +VKSN+ RH + H
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 35/53 (66%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C +C K   R +SL +H+ IHTG KPY+C + NC  S + KSN+ RHYK H K
Sbjct: 280 CKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKLHFK 332

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 5/70 (7%)

Query: 287 SREKKPARI-----HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
           S E +P R+     + C  C K+  R +SL +H   HTG+KPY C + NCD   + +SN+
Sbjct: 184 SEELQPPRLRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNM 243

Query: 342 TRHYKSHLKS 351
           TRHYK H K+
Sbjct: 244 TRHYKLHFKT 253

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 272 VQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNC 331
           V N   TT  ST     + K    + C IC K   R +SL +H+ IHTG KP+ C + NC
Sbjct: 285 VTNVSNTTSTSTGGNIEKIK----YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNC 340

Query: 332 DTSSSVKSNITRHYKSHLK 350
             S + KSN+ RHYK H K
Sbjct: 341 TKSFNAKSNMLRHYKLHFK 359

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 278 TTPKSTSRPSRE---KKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTS 334
           T  ++T+ P+     KK    + CP C+K+  R ++LR+H +IH G+ PY C  P C   
Sbjct: 178 TRAETTAGPAGAAMRKKKEHGYSCPECEKVFGRPSALRTHSIIHIGKSPYICQLPGCAKR 237

Query: 335 SSVKSNITRHYKSH 348
            +VKSN+ RH KSH
Sbjct: 238 FNVKSNLLRHVKSH 251

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 275 DEPTTPKSTSRPSREKKPARI-HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDT 333
           ++PT P S  R        +I + C IC K   R +SL +H+ IHTG+KPY+C   +C  
Sbjct: 248 EQPTGPLSRKRHYSTGCIDKIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSK 307

Query: 334 SSSVKSNITRHYKSHLK 350
           + + KSN+ RHYK H K
Sbjct: 308 AFNAKSNMLRHYKLHFK 324

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 35/57 (61%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R  KC +C K   R +SL +H  IHTG KPY C + NC  S + KSN+ RHYK H K
Sbjct: 206 RKFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHFK 262

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 288 REKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKS 347
           R+K P   ++CP C K   R +SL +H+ IHTG+KP+ C + NC  + + KSN+ RH+K 
Sbjct: 229 RQKFPK--YECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHHKL 286

Query: 348 HLKS 351
           H K+
Sbjct: 287 HFKT 290

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 280 PKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKS 339
           P   S P + K P R + C  C K   R++SLR+H  IHTG++P+ C + NC  S + +S
Sbjct: 168 PPRLSPPVQNKAPQR-YVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARS 226

Query: 340 NITRHYKSHLKS 351
           N+ RH+K H ++
Sbjct: 227 NMLRHHKLHFRT 238

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 40/68 (58%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSN 340
           K  S P+          C IC K  TR TSL++H+LIHT  KPY+C +  C+ + +VKSN
Sbjct: 101 KGVSDPANSVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSN 160

Query: 341 ITRHYKSH 348
           + RH + H
Sbjct: 161 LYRHERIH 168

>KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON}
           Anc_3.298
          Length = 322

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           + C IC K   R +SL +HL  HTG+KPY C   +C    + +SN+TRHYK+H K
Sbjct: 237 YGCSICGKRFARPSSLNTHLNTHTGDKPYTCPHGSCSKVFNARSNMTRHYKTHFK 291

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 279 TPKSTSRPSREKKPARIHK--CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSS 336
           T + TS  S     + +H+  C  C K   R++SLR+H  IHTG++P+ C + NC  S +
Sbjct: 188 TGRRTSVLSSNNVASNLHRYICSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFN 247

Query: 337 VKSNITRHYKSHLKSQ 352
            +SN+ RH+K H K+ 
Sbjct: 248 ARSNMLRHHKLHFKTD 263

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           C  C K   R +SL +H   HTG+KP+ C + NCD   + +SN+TRHYK H K++ 
Sbjct: 240 CASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRHYKLHFKTEG 295

>Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to
           Ashbya gossypii ADL050W
          Length = 251

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 10/82 (12%)

Query: 277 PTTPKSTSRPSREKKPARIHK----------CPICDKIVTRSTSLRSHLLIHTGEKPYKC 326
           P+ P  T++P R +  ++             CPIC K  TR  S+  H+++HT  KPY C
Sbjct: 126 PSKPALTAQPCRRRGNSQSGSLNGNISSEKTCPICYKTFTRKISVNIHMVVHTNLKPYAC 185

Query: 327 TWPNCDTSSSVKSNITRHYKSH 348
            +P C    +VK N+ RH K H
Sbjct: 186 DYPGCKKKFNVKGNLQRHSKCH 207

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 284 SRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITR 343
           S PS  ++ A+ + C  C+K   R +SL +H+ IHTG KPY C +  C  S + KSN+ R
Sbjct: 247 SGPSISEEIAK-YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLR 305

Query: 344 HYKSHLK 350
           HYK H K
Sbjct: 306 HYKLHFK 312

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C IC K  TR TSL++H+LIHT  KPY+C++  C+ + +VKSN+ RH + H
Sbjct: 161 CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERIH 211

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           KC  C K   R +SL++HL IHTG +P+KC    CD S + +SN+ RHYK H K  N
Sbjct: 715 KCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKLHFKIGN 771

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C +C K   R +SLR+H  I +G +PYKC + NC  S + KSN+ RHYK H +
Sbjct: 241 CDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFR 293

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           + C IC K   R +SL++H+ IHTG KPY C + NC    + KSN+ RH+K H +
Sbjct: 415 YHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLHYR 469

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           CP+C K  TR ++L+ HLLIHT  KP+KC++  C+   +VKSN+ RH + H
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CEKEFNVKSNLNRHERIH 221

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 277 PTTPKSTSRPSREKKPARIHK--CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTS 334
           P +P  TS       P  I K  C +C +   R ++L++H+L HTG++P+ C  P C+ S
Sbjct: 192 PISPGMTSGTIEHSSPDGIRKNVCKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKS 251

Query: 335 SSVKSNITRHYKSH 348
            +V+SN+ RH + H
Sbjct: 252 FNVRSNMLRHERLH 265

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           CP+C K  TR ++L+ HLLIHT  KP+KC++  CD   +VKSN+ RH + H
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIH 217

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 33/57 (57%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R H+C  CDK  T S  L  H  IHTGEK ++C +P C    S   N  +HY++HLK
Sbjct: 191 RKHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRHDNCLQHYRTHLK 247

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (56%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           + C +C K   R +SL +H  IHTG KPY C    C  + + KSN+ RHYK H +  N
Sbjct: 276 YSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKLHFRISN 333

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 32/59 (54%)

Query: 292 PARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           P + + C +C K +T S  L  H  IHTGEK Y C    CD   S   N  +HYK+HLK
Sbjct: 252 PKKKYICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGCDQKFSRHDNCKQHYKTHLK 310

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P ++    + + C +C K   R +SL +H  IHTG+KP+ C    C  + + +SN+ RHY
Sbjct: 223 PGKDGLYRKKYCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHY 282

Query: 346 KSHLK 350
           K+H K
Sbjct: 283 KAHFK 287

>Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON}
           YGL035C (REAL)
          Length = 502

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSN 340
           KS S+ + + +  R H CPIC +   R      H+ IHTGEKP+ C +P C    S    
Sbjct: 23  KSKSKTAAKSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDE 82

Query: 341 ITRHYKSHLKS 351
           +TRH + H  S
Sbjct: 83  LTRHRRIHTNS 93

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C +C +   R ++L++H+L HTG++P+ C  P C  S +V+SN+ RH + H
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLH 256

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%)

Query: 280 PKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKS 339
           P+  SR +++    R H CPIC +   R      H+  HTGEKP++C +P C    S   
Sbjct: 52  PRPRSRANKDGDAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSD 111

Query: 340 NITRHYKSHLKSQ 352
            +TRH + H   Q
Sbjct: 112 ELTRHKRIHTNPQ 124

>Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON}
           YGL035C (REAL)
          Length = 505

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSN 340
           KS S+ + + +  R H CPIC +   R      H+ IHTGEKP+ C +P C    S    
Sbjct: 23  KSKSKTTAKSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDE 82

Query: 341 ITRHYKSHLKS 351
           +TRH + H  S
Sbjct: 83  LTRHRRIHTNS 93

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSN 340
           KS S+ + + +  R H CPIC +   R      H+ IHTGEKP+ C +P C    S    
Sbjct: 23  KSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDE 82

Query: 341 ITRHYKSHLKS 351
           +TRH + H  S
Sbjct: 83  LTRHRRIHTNS 93

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 37/71 (52%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSN 340
           +S S+ + + +  R H CPIC +   R      H+ IHTGEKP+ C +P C    S    
Sbjct: 23  QSKSKTAMKSEAPRPHACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDE 82

Query: 341 ITRHYKSHLKS 351
           +TRH + H  S
Sbjct: 83  LTRHRRIHTNS 93

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVK 338
           T K   R S  +K   I  C IC K   R ++LR+H+++H  +KPYKC   +C    +VK
Sbjct: 234 THKCPKRCSSYRKSGSI--CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVK 291

Query: 339 SNITRHYKSH 348
           SN+ RH + H
Sbjct: 292 SNMLRHMRKH 301

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 32/55 (58%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  KCP+C +   R    + H+  HTGEKPYKC++P+C  S S    + RH K H
Sbjct: 15  RPFKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKIH 69

>AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR043C (NRG1) and
           YBR066C (NRG2)
          Length = 140

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 30/57 (52%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R H C  C K  T S  L  H  IHTGEK + C +P C    S   N  +HY++HLK
Sbjct: 78  RKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           R H C IC K  T S  L  H  IHTGEK ++C +  CD   S   N  +HY++H+K +
Sbjct: 108 RRHVCRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRAHVKRE 166

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 34/70 (48%)

Query: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVK 338
           +PK  SR S+     R H CP+C +   R      HL  HTGEKP  C +P C    S  
Sbjct: 26  SPKPRSRSSKGPDAPRPHVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRS 85

Query: 339 SNITRHYKSH 348
             +TRH + H
Sbjct: 86  DELTRHKRIH 95

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%)

Query: 277 PTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSS 336
           PT   + +  ++ K+  R H CPIC++   R      H+  HTGEKP++C +P C    S
Sbjct: 20  PTAATANNTVAKPKEKPRPHVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFS 79

Query: 337 VKSNITRHYKSH 348
               +TRH + H
Sbjct: 80  RSDELTRHRRIH 91

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           T  K++ + S   +  R H CPIC +   R      H+  HTGEKP+ C +P C    S 
Sbjct: 3   TQKKTSQKKSNSDEAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSR 62

Query: 338 KSNITRHYKSHLKSQ 352
              +TRH + H  +Q
Sbjct: 63  SDELTRHRRIHTNTQ 77

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           T PK T R S +  P R H CPIC +   R      HL  HTGEKP+ C +P C    S 
Sbjct: 13  TEPKKT-RNSGKDAP-RPHVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSR 70

Query: 338 KSNITRHYKSH 348
              +TRH + H
Sbjct: 71  SDELTRHRRIH 81

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVK 338
           T K+  R S  KK   +  C IC K   R ++LR+H+++H  +KPY C    C    +VK
Sbjct: 210 TRKNPYRGSAYKKNGSV--CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267

Query: 339 SNITRHYKSH 348
           SN+ RH + H
Sbjct: 268 SNMLRHMRKH 277

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R + C +C++   R    + HL IHTGEKPYKC + NC    S    + RH K H
Sbjct: 17  RPYLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVH 71

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  +C IC++   R    + H+  HTGEKP+KC++P C  S S    + RH ++H
Sbjct: 12  RPFRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRTH 66

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R +KC IC +   R    + HL  HTGEKP+KC +P C    S    + RH ++H
Sbjct: 18  RPYKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLRTH 72

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 34/77 (44%)

Query: 272 VQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNC 331
           V N   T     S+  +     R H CPIC +   R      H+  HTGEKP+ C +P C
Sbjct: 19  VTNGSSTPNSGKSKAGKGDDAPRPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGC 78

Query: 332 DTSSSVKSNITRHYKSH 348
               S    +TRH + H
Sbjct: 79  VKRFSRSDELTRHRRIH 95

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           H+C IC K+  + T L  HL  H G+KPYKCTW  C    +   N+  H + H
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTW--CGKGFTQGGNLKTHVRLH 438

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +KC  C K  T+  +L++H+ +HTGEKP+ C +  C    S K N+T H  +H K
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEF--CSKRFSRKGNLTAHLVTHEK 468

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 22/47 (46%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           C  C K  +R  +L +HL+ H   +P+ C    C  + +   N+  H
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSH 492

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 282 STSRPSREKK---PA----RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTS 334
           +T+ P R KK   PA    R +KC +C+K   R    R H+  HTGEKP+ CT+P C   
Sbjct: 4   TTAEPMRHKKMEYPADNDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKR 63

Query: 335 SSVKSNITRHYKSH 348
            S    + RH + H
Sbjct: 64  FSRSDELKRHLRIH 77

>NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON}
           Anc_3.518
          Length = 288

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 282 STSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
           ST  P   ++P R   CPIC +   R    + H+  HTGEKP+ CT+ +C  S S    +
Sbjct: 6   STFAPDNFQRPFR---CPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDEL 62

Query: 342 TRHYKSHL 349
            RH + HL
Sbjct: 63  KRHIRIHL 70

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R + C IC +  T S  L  H  IHTGEK ++C +P C+   S   N  +HY++H K
Sbjct: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 289 EKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +++P R   C IC +   R    + H+  HTGEKPYKC+  NC  S S    + RH+++H
Sbjct: 13  DRRPFR---CEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHFRTH 69

Query: 349 LKS 351
            ++
Sbjct: 70  TRT 72

>KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa]
           {ON} some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 203

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 35/46 (76%)

Query: 303 KIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           K  +R ++L++H+++H+  KP+KCT+ +C+ S +VKSN+ RH K H
Sbjct: 153 KEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKH 198

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R HKC  CDK  +++ +L +H  +HTGE+PY+C    C+   S K N+T H  +H K
Sbjct: 375 RQHKCAYCDKRFSQTGNLNTHQRLHTGERPYECHI--CNKRFSRKGNLTAHVITHKK 429

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           R ++C IC+K  +R  +L +H++ H   KPY C    C+   +   N+  H
Sbjct: 403 RPYECHICNKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVH 453

>NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {ON}
           Anc_3.281
          Length = 293

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%)

Query: 289 EKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           E +  R + C +C K  T S  L  H  IHTGEK + C++P C    S   N  +HY++H
Sbjct: 221 ELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTH 280

Query: 349 LK 350
            K
Sbjct: 281 FK 282

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           ++C  C K  T+  +LR+H  +HTGEKPY+C    CD   S K N+  H  +H K
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQK 595

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 282 STSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
              +P    + ++ HKCP C ++  +ST L  H+  H G KPY+C +  C    +   N+
Sbjct: 501 GVEKPKTLHEGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNL 558

Query: 342 TRHYKSH 348
             H + H
Sbjct: 559 RTHQRLH 565

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           ++C +CDK  +R  +L +HLL H   KP+ C   NC+ S +   N+  H
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 37/73 (50%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           T PK+T     + +  R + C IC +  T S  L  H  IHTGEK + C +  C    S 
Sbjct: 157 TDPKNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSR 216

Query: 338 KSNITRHYKSHLK 350
             N  +HY++HLK
Sbjct: 217 HDNCLQHYRTHLK 229

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R H CP+C +   R      H+  HTGEKP+ C +P C    S    +TRH + H
Sbjct: 41  RPHVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRIH 95

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           P RI +C  P C+K+  R  ++RSH+  H  ++PY C +  CD +     ++ RH KSH 
Sbjct: 567 PDRIFECMYPNCNKVFKRRYNIRSHIQTHLEDRPYVCDFEGCDKAFVRNHDLVRHKKSHA 626

Query: 350 K 350
           +
Sbjct: 627 E 627

>Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa]
           {ON} complement(192400..194424) [2025 nt, 675 aa]
          Length = 674

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 276 EPTT-PKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCD 332
           +PTT P+ +     ++ P +  +C  P CDK   R  ++RSH+  H  ++PYKC +  CD
Sbjct: 465 KPTTLPRGSIDIYVKEMPDKKFQCLYPKCDKTFKRRYNIRSHIQTHLEDRPYKCDFEGCD 524

Query: 333 TSSSVKSNITRHYKSH 348
            +     ++ RH KSH
Sbjct: 525 KAFVRNHDLIRHKKSH 540

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 303 KIVTRSTSL-RSHLLIHTGEKP---YKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           KI  + T+L R  + I+  E P   ++C +P CD +   + NI  H ++HL+ +
Sbjct: 461 KITRKPTTLPRGSIDIYVKEMPDKKFQCLYPKCDKTFKRRYNIRSHIQTHLEDR 514

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R H CP+C++   R      H+  HTGEKP+ C +P C    S    +TRH + H
Sbjct: 70  RPHVCPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRHKRIH 124

>NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326
          Length = 620

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 272 VQNDEPTTPKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWP 329
           + N   T P+ T     ++ P ++ +C    C KI  R  ++RSH+  H  +KPY C +P
Sbjct: 456 ITNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNVRSHIQTHLEDKPYACDFP 515

Query: 330 NCDTSSSVKSNITRHYKSH 348
            C+ +     ++ RH KSH
Sbjct: 516 GCEKAFVRNHDLVRHKKSH 534

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKS 351
           R  KC IC +   R      H++ HTGEKP++C++P C    S    + RH K+H  S
Sbjct: 16  RPFKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAKTHTSS 73

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C  C K  T+  +LR+H  +HTGEKPY C    CD   S K N+  H  +H K
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           + C ICDK  +R  +L +HL+ H   KP+ C   NC+ + +   N+  H
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           T P++T     + +  R + C IC +  T S  L  H  IHTGEK + C +  C    S 
Sbjct: 156 TDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSR 215

Query: 338 KSNITRHYKSHLK 350
             N  +HY++HLK
Sbjct: 216 HDNCLQHYRTHLK 228

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C  C K  T+  +LR+H  +HTGEKPY C    CD   S K N+  H  +H K
Sbjct: 654 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 704

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           + C ICDK  +R  +L +HL+ H   KP+ C   NCD + +   N+  H
Sbjct: 680 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAH 728

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C  C K  T+  +LR+H  +HTGEKPY C    CD   S K N+  H  +H K
Sbjct: 624 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 674

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           + C ICDK  +R  +L +HL+ H   KP+ C   NC+ + +   N+  H
Sbjct: 650 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 698

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 274 NDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDT 333
            D  +T K    P+      R + CPIC +   R      H+  HTGEKP+ C +P C  
Sbjct: 12  GDSASTRKKKRSPNSGPDSPRPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGK 71

Query: 334 SSSVKSNITRHYKSH 348
             S    +TRH + H
Sbjct: 72  RFSRSDELTRHTRIH 86

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 32/57 (56%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R H+C IC K  T +  L  H  IHTGEK +KC    C+   S   N  +HY++HLK
Sbjct: 266 RKHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHRGCNLWFSRNDNSLQHYQTHLK 322

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           T P++T     + +  R + C IC +  T S  L  H  IHTGEK + C +  C    S 
Sbjct: 156 TDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSR 215

Query: 338 KSNITRHYKSHLK 350
             N  +HY++HLK
Sbjct: 216 HDNCLQHYRTHLK 228

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           IHKC  C+K   R + L+ HLL H+  KPY C W  C +    K N+++H K
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 233

>CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some
           similarities with uniprot|P08153 Saccharomyces
           cerevisiae YDR146c SWI5 or uniprot|P21192 Saccharomyces
           cerevisiae YLR131c ACE2
          Length = 689

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           T P+ +     ++ P R+++C  P C K   R  ++RSH+  H  ++PY+C +  CD + 
Sbjct: 538 TLPRGSIDVYVKELPDRMYECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAF 597

Query: 336 SVKSNITRHYKSH 348
               ++ RH K+H
Sbjct: 598 VRNHDLVRHKKTH 610

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H  +HTGEKPY+C    CD   S K N+  H  +H
Sbjct: 629 QCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEI--CDKRFSRKGNLAAHKLTH 678

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 282 STSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
              +P    + ++ H+CP C ++ ++ST L  H+  H G KP++C +  C    +   N+
Sbjct: 586 GVEKPKVVHEGSKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNF--CGKRFTQGGNL 643

Query: 342 TRHYKSH 348
             H + H
Sbjct: 644 RTHQRLH 650

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKS 351
           ++C ICDK  +R  +L +H L H   KP+ C   NC+ + +   N+  H  K HL++
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQT 712

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           T P++T     + +  R + C IC +  T S  L  H  IHTGEK + C +  C    S 
Sbjct: 156 TDPRNTLSDEEDLELRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSR 215

Query: 338 KSNITRHYKSHLKSQN 353
             N  +HY++HLK ++
Sbjct: 216 HDNCLQHYRTHLKKEH 231

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R + C +C K +T S  L  H  IHTGEK + C +  C+   S   N  +HY++HLK
Sbjct: 299 RKYICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGCNQRFSRHDNCIQHYRTHLK 355

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C  C K  T+  +LR+H  +HTGEKPY C    CD   S K N+  H  +H K
Sbjct: 613 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 663

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           + C ICDK  +R  +L +HL+ H   KP+ C   NC+ + +   N+  H
Sbjct: 639 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 687

>KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {ON}
           Anc_8.326 YLR131C
          Length = 736

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P R+  C  P CDK   R  ++RSH+  H  ++PY C +P C+ +     ++ RH K H
Sbjct: 555 PDRMFACLYPNCDKTFKRRYNVRSHIQTHLQDRPYTCDYPGCEKAFVRNHDLVRHKKGH 613

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 292 PARIHKCPICDKIVTRSTSL-RSHLLIHTGEKP---YKCTWPNCDTSSSVKSNITRHYKS 347
           P   H  PI  +I  + T+L R  +  +  E P   + C +PNCD +   + N+  H ++
Sbjct: 525 PVEPHTGPI--RITRKPTTLPRGCIDQYVKELPDRMFACLYPNCDKTFKRRYNVRSHIQT 582

Query: 348 HLKSQ 352
           HL+ +
Sbjct: 583 HLQDR 587

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T++ +LR+H  +HTGE+P+KC    CD + + + N+T H  +H
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKCD--KCDKTFARRGNLTAHEFTH 558

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           ++C  C K+ ++ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 22/51 (43%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           R  KC  CDK   R  +L +H   H   KPY C   NC    S   N+  H
Sbjct: 534 RPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R H C IC    T S  L  H  IHTGEK + C +  C+   S   N  +HY++HLK
Sbjct: 208 RKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLK 264

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P   K+P R   C IC +   R    + H   HTGEKP+KC +P+C  S S    + RH 
Sbjct: 13  PDNFKRPFR---CEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHS 69

Query: 346 KSHL 349
           ++H+
Sbjct: 70  RTHM 73

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +C  C K  T+  +LR+H  +HTGE+PY C    C    S K N+  H+ +H K
Sbjct: 537 QCEYCGKRFTQGGNLRTHQRLHTGERPYSCEL--CGKKFSRKGNLAAHFLTHQK 588

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           H+CP C +  T+ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHQRLH 558

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           R + C +C K  +R  +L +H L H   KPY C    C+ S +   N+  H
Sbjct: 562 RPYSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAH 612

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           R H C +C    T S  L  H  IHTGEK Y C +  C    S   N  +H+K+HL+ +
Sbjct: 156 RKHVCKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHKTHLRKK 214

>ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 329

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 29/59 (49%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           R H CPIC +   R      H+  HTGEKP+ C + NC    S    +TRH + H   Q
Sbjct: 15  RPHVCPICHRAFHRLEHQTRHMRTHTGEKPHVCDFKNCGKRFSRSDELTRHRRIHTNPQ 73

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  KC +C +   R    + H+  HTGEKP+ C +P C  S S    + RH ++H
Sbjct: 16  RPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLRTH 70

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           R  KC +C K   R    R H+  HTGEKP+ C +P C    S    + RH ++H+
Sbjct: 11  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRTHM 66

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           IHKC  C+K   R + L+ HLL H+  KPY C W  C +    K N+++H K
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 334

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           R  KC +C +   R    + H+  HTGEKP++CT+ +C  S S    + RH ++H  S  
Sbjct: 15  RPFKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLRTHAGSSQ 74

Query: 354 Q 354
           +
Sbjct: 75  R 75

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           R  KC +C K   R    R H+  HTGEKP+ C +P C    S    + RH ++H+
Sbjct: 12  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHM 67

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSN 340
           K   R S E++  R + C  C K  T S  L  H  IHTGEK ++C +  C    S + N
Sbjct: 159 KKMLRESLEQR--RKYICKTCSKGFTTSGHLARHNRIHTGEKNHECPFEGCQQRFSRQDN 216

Query: 341 ITRHYKSHLKS 351
             +HY++H KS
Sbjct: 217 CLQHYRTHFKS 227

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           ++C  C K  T+  +LR+H  +HTGEKPY+C    C    S K N+  H  +H K
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQCEL--CGKRFSRKGNLAAHVLTHKK 573

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKS 351
           ++C +C K  +R  +L +H+L H   KP+ C   NC+ S +   N+  H  K HL++
Sbjct: 549 YQCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKGHQNKFHLET 605

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           H+C  C +  T+ T L  H+  H G KPY+C +  C    +   N+  H + H
Sbjct: 493 HECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQY--CGKKFTQGGNLRTHERLH 543

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +C  C K  T+  +LR+H  +HTGEKPY C    C    S K N+  H  +H K
Sbjct: 438 QCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEM--CGKRFSRKGNLAAHALTHQK 489

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           H+CP C +  T+ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 409 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEF--CGKRFTQGGNLRTHQRLH 459

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKS 351
           + C +C K  +R  +L +H L H   KPY C   NC+ S +   N+  H  + HLK+
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLKT 521

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 6/72 (8%)

Query: 280 PKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTWPNCDTSSSVK 338
           PKSTS    E+KP    KC  C+K   RS  L+ H+  +H+ E+P+ C +  CD   S  
Sbjct: 608 PKSTSPMDEEEKP---FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRS 662

Query: 339 SNITRHYKSHLK 350
            N+++H K+H K
Sbjct: 663 DNLSQHLKTHKK 674

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 281 KSTSRP-SREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKS 339
           K TS P   E +P R   C  C++   R    + HL  HTGEKP+ C +P C  S S   
Sbjct: 4   KQTSFPVDNENRPFR---CDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSD 60

Query: 340 NITRHYKSH 348
            + RH ++H
Sbjct: 61  ELKRHMRTH 69

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C  C K  T+  +LR+H+ +HTGEKPY+C    C    S K N+  H  +H
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECE--RCGRKFSRKGNLAAHKLTH 601

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 291 KPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           K  +  +CP C K  T+ST L  H+  H G KP+ C +  C    +   N+  H + H
Sbjct: 518 KGVKQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQNQ 354
           ++C  C +  +R  +L +H L H   KP++C   +C+ + +   N+  H  + HL++ N+
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQTLNR 638

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 280 PKSTSRPSREKKPA---RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSS 336
           P +  +P + + PA     H+C +CDK   R + L+ HLL H+  KP+ C W  C +   
Sbjct: 239 PPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHK 296

Query: 337 VKSNITRHYK 346
            K N+ +H K
Sbjct: 297 RKDNLLQHMK 306

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 5/72 (6%)

Query: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVK 338
           T K   R    +KP +   C +CDK  T ++SL+ H+  HTGEKP KC    C  + +  
Sbjct: 752 TLKQHQRTHTGEKPFQ---CHLCDKRFTIASSLKIHIRTHTGEKPLKCKI--CGKAFNES 806

Query: 339 SNITRHYKSHLK 350
           SN+++H K+H K
Sbjct: 807 SNLSKHIKTHFK 818

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           KCP+C+K  +   +L+ H   HTGEKP++C    CD   ++ S++  H ++H
Sbjct: 739 KCPVCNKCFSNLETLKQHQRTHTGEKPFQCHL--CDKRFTIASSLKIHIRTH 788

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 297 KC--PICDKIVTRSTSLRSHL---LIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           KC   +CD++      L +HL    +  G+  Y+C W  C    + +  + RH K H
Sbjct: 676 KCEWGLCDQVFNSKEDLNTHLENDHLLKGQSQYQCHWHGCSKKFTQRQKMVRHLKVH 732

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C K  T+   +  HL +H+G KP KC  P C+   S    + +H ++H
Sbjct: 715 CSKKFTQRQKMVRHLKVHSGYKPCKC--PVCNKCFSNLETLKQHQRTH 760

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 270 PEVQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWP 329
           P  + + P     T+R    KK   I+ C IC+K  TR  +LRSHL  HT E+P+ CT  
Sbjct: 394 PLEEGETPQNLSGTTRRRNSKKNPSIYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTV- 452

Query: 330 NCDTSSSVKSNITRHYKSH 348
            C  + + + +  RH   H
Sbjct: 453 -CGKAFAREHDRKRHEDLH 470

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVK 338
           T K  SR    +KP    KC +CDK  + STSL+ H+  HTGEKP +C    C    +  
Sbjct: 654 TLKQHSRVHSGEKPF---KCHLCDKSFSVSTSLKIHIRTHTGEKPLECKV--CGRRFNES 708

Query: 339 SNITRHYKSH 348
           SN+++H K+H
Sbjct: 709 SNLSKHMKTH 718

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +KC +C K  +   +L+ H  +H+GEKP+KC    CD S SV +++  H ++H
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHL--CDKSFSVSTSLKIHIRTH 690

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 3/51 (5%)

Query: 301 CDKIVTRSTSLRSHLL---IHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C+     S  L +HL    +  G+  Y C W  C+   S +  I RH K H
Sbjct: 584 CNLTFNSSEELNAHLESFHLTKGKSKYTCFWHGCNKEFSQRQKIVRHLKVH 634

>TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.281
           YBR066C
          Length = 175

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           R H C +C K  T S  L  H  IHTGEK + C    C+   S   N  +HY++HL+ +
Sbjct: 117 RRHVCKVCSKGFTTSGHLARHNRIHTGEKNHFCPLEGCNQRFSRHDNCIQHYRTHLRKK 175

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKS 351
           R + C IC +  T S  L  H  IHTGEK + C +  C    S   N  +HY++HLK+
Sbjct: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R + CPIC +   R      H+  HTGEKP+ C +P C    S    +TRH + H
Sbjct: 24  RPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRIH 78

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  +C  C +   R    + HL  HTGEKP+ C +P C  S S    + RH ++H
Sbjct: 15  RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3.281
          Length = 330

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R + C +C K  T S  L  H  IHTGEK + C +  C    S   N  +HY++H K
Sbjct: 268 RKYLCKVCSKGFTTSGHLARHNRIHTGEKSHACHFAGCTQKFSRHDNCLQHYRTHFK 324

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P+R +   + H+CP C +  ++ST L  H+  H G KPY+C +  C    +   N+  H 
Sbjct: 507 PTRSRTKKKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNF--CGKKFTQGGNLKTHQ 564

Query: 346 KSH 348
           + H
Sbjct: 565 RLH 567

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           ++C  C K  T+  +L++H  +HTGEKPY C    C+   S K N+T H  +H K
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKI--CNKRFSRKGNLTAHVLTHKK 597

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           + C IC+K  +R  +L +H+L H   KPY C   NC+ + +   N+  H
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAH 621

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 4/80 (5%)

Query: 269 LPEVQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTW 328
           L E  N+ P  P    R +  KK  +++ C +CDK  TR  +L+SHL  HT E+P+ CT 
Sbjct: 372 LEEENNEIP--PNLDIRKTNSKKNPQLYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTI 429

Query: 329 PNCDTSSSVKSNITRHYKSH 348
             C  + + + +  RH   H
Sbjct: 430 --CGKAFARQHDRKRHEDLH 447

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 31/81 (38%), Gaps = 15/81 (18%)

Query: 281 KSTSRPSREKKPARIH------KCPICDKIVTRSTSLRSHLLIHTGEKPYKCT------- 327
           K  +RP   K   R H       C IC K   R    + H  +H+G+K Y C        
Sbjct: 404 KKFTRPYNLKSHLRTHTNERPFACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGI 463

Query: 328 -WPNCDTSSSVKSNITRHYKS 347
            W  C    +    + RH+K+
Sbjct: 464 PW-GCGKKFARSDALGRHFKT 483

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 29/59 (49%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           R + C IC     R      H+  HTGEKP+ CT P C    S    + RH K+H KS+
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSR 68

>TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa]
           {ON} Anc_3.518 YGL209W
          Length = 339

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C IC +   R    + H+  HTGEKP+KC +P C  S S    + RH ++H +
Sbjct: 22  CEICHRGFHRLEHKKRHIRTHTGEKPHKCVFPGCIKSFSRSDELKRHLRTHTR 74

>CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {ON}
           some similarities with uniprot|P38082 Saccharomyces
           cerevisiae YBR066c NRG2 or uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 314

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 31/61 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           R H C IC    T S  L  H  IHTGEK + C    C+ S S   N  +HY++H K + 
Sbjct: 250 RKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKE 309

Query: 354 Q 354
           Q
Sbjct: 310 Q 310

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +C  C K  T+  +LR+H  +HTGEKPY+C    C    S K N+  H  +H K
Sbjct: 453 QCQYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CGKRFSRKGNLAAHVVTHQK 504

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           H+CP C +  T+ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 424 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQY--CGKRFTQGGNLRTHQRLH 474

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQNQ 354
           ++C +C K  +R  +L +H++ H   KP+ C    C+ + +   N+  H  + HL + N+
Sbjct: 480 YECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHLNTLNE 539

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  +C +C +   R    + H+  HTGEKP+ CT+P C+   S    + RH ++H
Sbjct: 15  RPFRCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDELKRHSRTH 69

>Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {ON}
           YLR131C (REAL)
          Length = 764

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P ++ +C  P C K+  R  ++RSH+  H  ++PY C +P+CD +     ++ RH  SH
Sbjct: 593 PDKLFECLYPNCSKVFKRRYNIRSHIQTHLQDRPYSCDFPSCDKAFVRNHDLIRHKISH 651

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  +C  C +   R    + HL  HTGEKP+ C +P C  S S    + RH ++H
Sbjct: 15  RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 275 DEPTTPKSTSRPSREK---KPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNC 331
           DE T+P + +   R K   K A ++ C +CDK  TR  +L+SHL  HT E+P+ C    C
Sbjct: 389 DEGTSPLNATGIIRRKSLQKNASVYACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--C 446

Query: 332 DTSSSVKSNITRHYKSH 348
             + + + +  RH   H
Sbjct: 447 GKAFARQHDRKRHEDLH 463

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 282 STSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
           ST     +++P R   C  C +   R    + H+  HTGEKP+ C +P+C    S +  +
Sbjct: 10  STFAADNDERPFR---CQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDEL 66

Query: 342 TRHYKSHLKS 351
            RH ++HL S
Sbjct: 67  KRHIRTHLGS 76

>TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.326
           YLR131C
          Length = 680

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 293 ARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
            ++ +C  P C K   R  ++RSH+  H  ++PYKC  P CD       ++ RH K H
Sbjct: 489 GKMFECLYPDCGKTFKRRYNVRSHIQTHLQDRPYKCDMPGCDKGFVRNHDLLRHKKCH 546

>NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON}
           Anc_1.326
          Length = 773

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVK 338
           T K   R    +KP    KC IC K    S+SL+ H+  HTGEKP  C    C  + +  
Sbjct: 681 TLKQHERTHSGEKPF---KCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNES 735

Query: 339 SNITRHYKSHLK 350
           SN+++H K+HLK
Sbjct: 736 SNLSKHMKTHLK 747

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 8/74 (10%)

Query: 281 KSTSRPSREKKPARIH------KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTS 334
           K  S+  R  +  R+H      +C IC K  +   +L+ H   H+GEKP+KC    C   
Sbjct: 646 KIFSQRQRLVRHMRVHSGYKPFQCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKR 703

Query: 335 SSVKSNITRHYKSH 348
            ++ S++  H ++H
Sbjct: 704 FAISSSLKIHIRTH 717

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C KI ++   L  H+ +H+G KP++C+   C    S +  + +H ++H
Sbjct: 644 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 689

>KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON}
           uniprot|P50898 Kluyveromyces lactis MIG1 Regulatory
           protein MIG1
          Length = 474

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 289 EKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +K   R + CPIC +   R      H+  HTGE+P+ C +P C    S    +TRH + H
Sbjct: 19  DKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {ON}
           Anc_3.518 YGL209W
          Length = 276

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 287 SREKKP----ARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNIT 342
           S+EK P     R   C  C +   R    + HL IHTGEKPYKC +  C  S S    + 
Sbjct: 24  SKEKFPNDNSERPFFCESCGRGFYRLEHKKRHLKIHTGEKPYKCKFEQCIKSFSRSDELR 83

Query: 343 RHYKSHL 349
           RH K H+
Sbjct: 84  RHSKIHI 90

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           H CP+CDK   R + LR HLL H+ E+ + C W  C +    K N+ +H K
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240

>Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa]
           {ON} complement(264361..265350) [990 nt, 330 aa]
          Length = 329

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R + C +C K +T S  L  H  IHTGEK + C +  C+   S + N ++HY++H
Sbjct: 261 RKYYCRVCGKGLTTSGHLSRHYRIHTGEKKHCCPFEGCNQRFSRRDNCSQHYQTH 315

>YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}
           MIG3Probable transcriptional repressor involved in
           response to toxic agents such as hydroxyurea that
           inhibit ribonucleotide reductase; phosphorylation by
           Snf1p or the Mec1p pathway inactivates Mig3p, allowing
           induction of damage response genes
          Length = 394

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P  +++P R   C IC +   R    + H   HTGEKP+KCT   C  S S    + RH 
Sbjct: 10  PDNDQRPFR---CEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHL 66

Query: 346 KSHLKS 351
           ++H K 
Sbjct: 67  RTHTKG 72

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 282 STSRPS--REKKPA---RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSS 336
           +TSRP+  R + P    R + C  C K  T S  L  H  IHTGEK + C  P C    S
Sbjct: 183 TTSRPTGKRARSPIEQRRRYVCKTCVKGFTTSGHLARHNRIHTGEKNHVCPHPGCGQRFS 242

Query: 337 VKSNITRHYKSHLK 350
              N  +HYK+HL+
Sbjct: 243 RHDNCVQHYKTHLR 256

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H+ +HTGEKPY+C    C    S K N+  H  +H
Sbjct: 515 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTH 564

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 291 KPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           + A+ H+CP C K  T+ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 481 RGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 536

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQNQ 354
           ++C  C +  +R  +L +H L H   KP+ C    C+ S +   N+  H  + HL++ N+
Sbjct: 542 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQTLNE 601

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H+ +HTGEKPY+C    C    S K N+  H  +H
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTH 581

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 293 ARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           A+ H+CP C K  T+ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 500 AKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQNQ 354
           ++C  C +  +R  +L +H L H   KP+ C    C+ S +   N+  H  + HL++ N+
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQTLNE 618

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 6/71 (8%)

Query: 281 KSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTWPNCDTSSSVKS 339
           KSTS    E+KP    KC  C K   RS  L+ H+  +H+ E+P+ C++  CD   S   
Sbjct: 430 KSTSPAEEEEKP---FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSD 484

Query: 340 NITRHYKSHLK 350
           N+++H K+H K
Sbjct: 485 NLSQHLKTHKK 495

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H+ +HTGE+PY+C    C    S K N+  H  +H
Sbjct: 520 QCEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTH 569

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           H+CP C K  T+ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 541

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQ 352
           R ++C  C K  +R  +L +H+L H   KP++C   +C+ S +   N+  H  + HL++ 
Sbjct: 545 RPYECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQTL 604

Query: 353 NQ 354
           N+
Sbjct: 605 NR 606

>Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON}
           (114648..116492) [1845 nt, 615 aa]
          Length = 614

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 282 STSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
           ST R   +K P+ I+ CP+CDK  TR  +L+SH   HT E+P+ C+   C  + + + + 
Sbjct: 480 STRRKFSQKNPS-IYACPVCDKKFTRPYNLKSHKRTHTNERPFSCSQ--CGKTFAREHDR 536

Query: 342 TRHYKSH 348
            RH   H
Sbjct: 537 KRHEDLH 543

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  +C  C +   R    + HL  HTGEKP+ C +P C  S S    + RH ++H
Sbjct: 15  RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C  C K  T+  +LR+H  +HTGEKPY+C    C    S K N+  H  +H K
Sbjct: 592 CECCGKRFTQGGNLRTHQRLHTGEKPYECEL--CGKRFSRKGNLAAHIVTHQK 642

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQNQ 354
           ++C +C K  +R  +L +H++ H   KP+ C    C+ + +   N+  H  + HL + N+
Sbjct: 618 YECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHLNTLNE 677

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 283 TSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNIT 342
           T R S +K PA I+ C +CDK  TR  +L+SHL  HT E+P+ C+   C  + + + +  
Sbjct: 414 TRRKSLQKNPA-IYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRK 470

Query: 343 RHYKSH 348
           RH   H
Sbjct: 471 RHEDLH 476

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           HKCP C+K   R + L+ H+L H+ E+ Y C W  C +    K N+ +H K
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPW--CISRHKRKDNLLQHMK 161

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R + C +C K  T S  L  H  IHTGEK + C +  C    +   N  +HYK+HLK
Sbjct: 400 RKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLK 456

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H+ +HTGE+PY+C    C    S K N+  H  +H
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTH 565

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           HKCP C K  T+ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQ 352
           R ++C  C K  +R  +L +H+L H   KP++C   +C+ S +   N+  H  + HL++ 
Sbjct: 541 RPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQTL 600

Query: 353 NQ 354
           N+
Sbjct: 601 NR 602

>YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}
           SWI5Transcription factor that recruits the Mediator and
           Swi/Snf complexes; activates transcription of genes
           expressed at the M/G1 phase boundary and in G1 phase;
           required for expression of the HO gene controlling
           mating type switching; localization to the nucleus
           occurs during G1 and appears to be regulated by
           phosphorylation by Cdc28p kinase
          Length = 709

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           T P+ +     ++ P +  +C  P C K   R  ++RSH+  H  ++PY C  P CD + 
Sbjct: 532 TLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAF 591

Query: 336 SVKSNITRHYKSH 348
               ++ RH KSH
Sbjct: 592 VRNHDLIRHKKSH 604

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 283 TSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNIT 342
           T R + +K PA I+ C +CDK  TR  +L+SHL  HT E+P+ C    C  + + + +  
Sbjct: 412 TKRKTSQKNPA-IYACELCDKKFTRPYNLKSHLRTHTDERPFACNV--CGKAFARQHDRK 468

Query: 343 RHYKSH 348
           RH   H
Sbjct: 469 RHEDLH 474

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H  +HTGEKPY C   +C    S K N+  H  +H
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYACQ--HCSKRFSRKGNLAAHQLTH 550

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 272 VQNDEPTTPKSTSRPSREKKPARI-------HKCPICDKIVTRSTSLRSHLLIHTGEKPY 324
           + N+   +P S+  P+ E  PA+        H+CP C     ++T L  H+  H G KP+
Sbjct: 442 LDNESMASPMSSQSPN-ESFPAQTPQQQQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPF 500

Query: 325 KCTWPNCDTSSSVKSNITRHYKSH 348
           +C +  C    +   N+  H + H
Sbjct: 501 ECQF--CGKRFTQGGNLRTHQRLH 522

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           + C  C K  +R  +L +H L H   KP+ C   NC  + +   N+  H
Sbjct: 528 YACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNH 576

>NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {ON}
           Anc_8.326
          Length = 635

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 280 PKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           P S  R  +E  P +  +C  P C K   R  + RSH+  H  ++PY C +PNCD +   
Sbjct: 474 PGSIDRYVKEL-PDKTFECLYPNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVR 532

Query: 338 KSNITRHYKSH 348
             ++ RH K H
Sbjct: 533 NHDLVRHKKVH 543

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 283 TSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNIT 342
           T R S +K PA ++ C +CDK  TR  +L+SHL  HT E+P+ C    C  + + + +  
Sbjct: 396 TRRKSIQKNPA-VYACELCDKKFTRPYNLKSHLRTHTDERPFACAI--CGKAFARQHDRK 452

Query: 343 RHYKSH 348
           RH   H
Sbjct: 453 RHEDLH 458

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 9/63 (14%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCT--------WPNCDTSSSVKSNITRHY 345
           R   C IC K   R    + H  +HTG+K Y C         W  C    +    + RH+
Sbjct: 434 RPFACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQW-GCGKKFARSDALGRHF 492

Query: 346 KSH 348
           K+ 
Sbjct: 493 KTE 495

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           IHKC +C+K   R + L+ HLL H+ E+ Y C W  C +    K N+ +H K
Sbjct: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW--CLSRHKRKDNLLQHMK 484

>TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {ON}
           Anc_8.326 YLR131C
          Length = 850

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           T P+ +     ++ P ++ +C  P C KI  R  ++RSH+  H  ++PY C +  C+ + 
Sbjct: 652 TLPRGSIDKYVKELPDKLFECLYPKCHKIFKRRYNIRSHIQTHLEDRPYICDFDGCNKAF 711

Query: 336 SVKSNITRHYKSH 348
               ++ RH KSH
Sbjct: 712 VRNHDLVRHKKSH 724

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 289 EKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           E    R  +C  C +   R    + H+  HTGEKP+ C +P C    S    + RH ++H
Sbjct: 11  EDNDERPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {ON}
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 813

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKCPI--CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           T P+ +     ++ P ++ +C    C KI  R  ++RSH+  H  ++PY C +  CD + 
Sbjct: 609 TLPRGSIDKYVKELPDKLFECQYHGCGKIFKRRYNIRSHIQTHLEDRPYMCDFEGCDKAF 668

Query: 336 SVKSNITRHYKSHLK 350
               ++ RH KSH +
Sbjct: 669 VRNHDLVRHKKSHAE 683

>KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa]
           {ON} Anc_8.326 YLR131C
          Length = 619

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 276 EPTT-PKSTSRPSREKKPARIHKCPI--CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCD 332
           +PTT P+ +     ++ P +  +C    C K   R  ++RSH+  H  ++PY C +P CD
Sbjct: 447 KPTTLPRGSIDKYVKELPDKNFECLFENCGKTFKRRYNIRSHIQTHLEDRPYPCDFPGCD 506

Query: 333 TSSSVKSNITRHYKSHLK 350
            +     ++ RH KSH +
Sbjct: 507 KAFVRNHDLVRHKKSHFE 524

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 286 PSREKKPA----RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
           P+R   P+    R  KCP+C +   R+   + H+  HTGEKP+ C    C+ S S    +
Sbjct: 2   PTRRNFPSDNEERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDEL 61

Query: 342 TRHYKSH 348
            RH K H
Sbjct: 62  KRHMKVH 68

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 281 KSTSRPSREKKPA-----RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           K  +R SRE   A     R + C  C K  T S  L  H  IHTGEK + C +  C    
Sbjct: 165 KPLARNSREDLSATLEQRRKYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRF 224

Query: 336 SVKSNITRHYKSHLK 350
           S + N  +HY++H K
Sbjct: 225 SRQDNCLQHYRTHFK 239

>CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa]
           {ON} similar to uniprot|P53035 Saccharomyces cerevisiae
           YGL209w MIG2 C2H2 zinc-finger protein
          Length = 396

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           PS  K+  R  KC  C +   R    + H+  HTGEKP+ C++P C  S S    + RH 
Sbjct: 9   PSDNKE--RPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHN 66

Query: 346 KSH 348
           ++H
Sbjct: 67  RTH 69

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H  +HTGEKPY+C   +C    S K N+  H  +H
Sbjct: 331 QCQFCGKKFTQGGNLRTHQRLHTGEKPYQCE--SCGRRFSRKGNLAAHILTH 380

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           H+CP C ++ ++ST L  H+  H G KP++C +  C    +   N+  H + H
Sbjct: 302 HECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQF--CGKKFTQGGNLRTHQRLH 352

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRH 344
           ++C  C +  +R  +L +H+L H   KP+ C   NCD S +   N+  H
Sbjct: 358 YQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAH 406

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +C  C K  T+  +LR+H  +HTGEKPY C    C    S K N+  H  +H
Sbjct: 569 QCEYCGKRFTQGGNLRTHTRLHTGEKPYSCE--KCGKRFSRKGNLAAHMLTH 618

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 289 EKKPARI---HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           EK  AR    H+CP C K  T+ST L  H+  H G KP++C +  C    +   N+  H 
Sbjct: 530 EKPKARGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHT 587

Query: 346 KSH 348
           + H
Sbjct: 588 RLH 590

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY-KSHLKSQNQ 354
           + C  C K  +R  +L +H+L H   KPY C    C  S +   N+  H  + HL++ NQ
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQTLNQ 655

>NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {ON}
           
          Length = 263

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           R H C  C    T S  L  H  IHTGEK + C +  C+   S   N  +HY++HLK +
Sbjct: 204 RSHICKTCSMGFTTSGHLSRHNRIHTGEKNHSCPYKGCNQKFSRHDNCLQHYRTHLKKK 262

>KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.326
           YLR131C
          Length = 645

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P +  +C  P C K+  R  ++RSH+  H  ++PY C +P C  +     ++ RH KSH
Sbjct: 508 PDKSFECLYPECKKLFKRRYNIRSHIQTHLEDRPYTCDFPGCTKAFVRNHDLVRHKKSH 566

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 272 VQNDEPTTPKSTSR-PSREKKPARIHKCPICDKIVTRSTSLRSHL-LIHTGEKPYKCTWP 329
            QN+  + PK   R PS     A+I KC +C++   R   L+ H+  +H GE+PY C   
Sbjct: 193 TQNNRGSIPKIRGRKPSLLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI- 251

Query: 330 NCDTSSSVKSNITRHYKSH 348
            C  S S   N+ +H ++H
Sbjct: 252 -CLKSFSRSDNLNQHKRTH 269

>Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON}
           YDR146C (REAL)
          Length = 691

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P +  +C  P C K   R  ++RSH+  H  ++PY C  P CD +     ++ RH KSH
Sbjct: 528 PDKSFECLYPGCAKTFKRRYNIRSHIQTHLEDRPYSCDNPGCDKAFVRNHDLIRHKKSH 586

>NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326
          Length = 794

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 276 EPTT-PKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCD 332
           +PTT P  T     E+ P +   C  P CDKI  R  ++R+H+  H  ++PY+C +  C+
Sbjct: 640 KPTTLPPGTIDQYVEELPNKQFGCLYPNCDKIFKRRYNVRTHIQTHLEDRPYRCEFRGCE 699

Query: 333 TSSSVKSNITRHYKSH 348
            +     ++ RH K H
Sbjct: 700 KAFVRNHDLVRHKKLH 715

>Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON}
           complement(5351..7621) [2271 nt, 757 aa]
          Length = 756

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           T P+ T     ++   R ++C  P C KI  R  ++RSH+  H  ++PY C +  C+ S 
Sbjct: 562 TLPRGTIDIYVKELSERAYECLYPNCHKIFKRRYNIRSHIQTHLKDRPYICDFQECNKSF 621

Query: 336 SVKSNITRHYKSHLK 350
               ++ RH KSH K
Sbjct: 622 VRNHDLVRHKKSHSK 636

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 321 EKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQ 352
           E+ Y+C +PNC      + NI  H ++HLK +
Sbjct: 577 ERAYECLYPNCHKIFKRRYNIRSHIQTHLKDR 608

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 7/77 (9%)

Query: 272 VQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNC 331
           +QN   TT K  S    +K PA I+ C +CDK  TR  +L+SHL  HT E+P+ C+   C
Sbjct: 632 LQNLTGTTKKRLS----QKNPA-IYACELCDKKFTRPYNLKSHLRTHTNERPFICSI--C 684

Query: 332 DTSSSVKSNITRHYKSH 348
           + + + + +  RH   H
Sbjct: 685 NKAFARQHDRKRHEDLH 701

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 15/81 (18%)

Query: 281 KSTSRPSREKKPARIHK------CPICDKIVTRSTSLRSHLLIHTGEKPYKC-------- 326
           K  +RP   K   R H       C IC+K   R    + H  +HTG+K Y C        
Sbjct: 658 KKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGT 717

Query: 327 TWPNCDTSSSVKSNITRHYKS 347
           +W  C    +    + RH+K+
Sbjct: 718 SWG-CGKKFARSDALGRHFKT 737

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 282 STSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
           +T +   +K PA ++ C ICDK  TR  +L+SHL  HT E+PY C+   C  + +   + 
Sbjct: 456 TTKKKQAQKHPA-VYACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDK 512

Query: 342 TRHYKSH 348
            RH   H
Sbjct: 513 NRHEDLH 519

>TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.162
           YOR113W
          Length = 425

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 277 PTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSS 336
           P+T     + SR +  AR  +C  C K+  +++    H+  H G KP+KC +  C+   +
Sbjct: 232 PSTDAGMGKKSRRRSTARQTQCSFCLKVFNQASHFEVHIRSHIGYKPHKCRF--CNVCFT 289

Query: 337 VKSNITRHYKSH 348
              N+  H K H
Sbjct: 290 QSGNLKTHEKLH 301

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           HKC  C+   T+S +L++H  +HT EK ++C    C+   S K N+  H  +H
Sbjct: 279 HKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEI--CNKKFSRKGNLASHIATH 329

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 26/49 (53%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           +C IC+K  +R  +L SH+  H   + + C + +C  S +   N+  H+
Sbjct: 308 ECEICNKKFSRKGNLASHIATHNRLRLHICKFDHCKKSFTQLGNMKAHH 356

>AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL035C
           (MIG1)
          Length = 389

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R + CPIC +   R      H+  HTGEKP+ C +  C    S +  +TRH + H
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIH 74

>Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 34/73 (46%), Gaps = 7/73 (9%)

Query: 276 EPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           +PT P ST + +R       H C IC    T S  L  H  IHTGEK + C    C    
Sbjct: 140 KPTKPHSTGQRTR-------HFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRF 192

Query: 336 SVKSNITRHYKSH 348
           S   N  +HY++H
Sbjct: 193 SRHDNCNQHYRTH 205

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 283 TSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNIT 342
           T R S +K PA I+ C +C+K  TR  +L+SHL  HT E+P+ C    C  + + + +  
Sbjct: 426 TRRKSLQKNPA-IYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNM--CGKAFARQHDRK 482

Query: 343 RHYKSH 348
           RH   H
Sbjct: 483 RHEDLH 488

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 29/57 (50%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           R + C IC K  T S  L  H  IHTGEK + C    C    S   N  +HYK+HL+
Sbjct: 199 RRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLR 255

>TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON}
           Anc_3.281 YBR066C
          Length = 288

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 303 KIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           K +T S  L  H  IHTGEK ++C    C+   S   N  +HYK+HLK +N
Sbjct: 233 KTLTTSGHLARHYRIHTGEKNHRCPLEGCNQRFSRHDNCIQHYKTHLKKKN 283

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R  +C IC +   R    + H+  HTGEKP+KC++ +C  S S    + RH ++H
Sbjct: 15  RPFRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDELKRHLRTH 69

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           R  +C  C +  T S  L  H  IHTGEK + C +  C+   S   N  +HYK+HL
Sbjct: 159 RRFECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLRFSRNDNSLQHYKTHL 214

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
             P +   PS ++K   IH+C  C+K   R + L+ HLL H+ ++ + C W  C +    
Sbjct: 311 VAPNAMPAPSSDQK--YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKR 366

Query: 338 KSNITRHYK 346
           K N+ +H K
Sbjct: 367 KDNLLQHMK 375

>YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON}
           ACE2Transcription factor required for septum destruction
           after cytokinesis; phosphorylation by Cbk1p blocks
           nuclear exit of Ace2p during the M-to-G1 transition,
           causing its specific localization to daughter cell
           nuclei, and also increases Ace2p activity;
           phosphorylation by Cdc28p and Pho85p prevents nuclear
           import during cell cycle phases other than cytokinesis;
           part of the RAM network that regulates cellular polarity
           and morphogenesis
          Length = 770

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 276 EPTT-PKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCD 332
           +PTT P  T     ++ P ++ +C  P C+K+  R  ++RSH+  H  ++PY C +P C 
Sbjct: 582 KPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCT 641

Query: 333 TSSSVKSNITRHYKSH 348
            +     ++ RH  SH
Sbjct: 642 KAFVRNHDLIRHKISH 657

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSV 337
           +T    S+  R     R  KC  CDK  T S+SLR H+  HTGEKP  C    C    + 
Sbjct: 556 STEDILSQHIRTHSGERPFKCQFCDKRFTTSSSLRIHIRTHTGEKPLACNV--CGKRFNE 613

Query: 338 KSNITRHYKSH 348
            SN+++H K H
Sbjct: 614 SSNLSKHMKIH 624

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           KCP C K  +    L  H+  H+GE+P+KC +  CD   +  S++  H ++H
Sbjct: 547 KCPHCSKTFSTEDILSQHIRTHSGERPFKCQF--CDKRFTTSSSLRIHIRTH 596

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C K   +   L  H+ +HTG KP+KC  P+C  + S +  +++H ++H
Sbjct: 523 CTKHFAQRQKLLRHIKVHTGYKPFKC--PHCSKTFSTEDILSQHIRTH 568

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 6/84 (7%)

Query: 270 PEVQNDEPTTPKSTSRPSREKKPARIHKCPI--CDKIVTRSTSLRSHL-LIH--TGEKPY 324
           P+VQN         +   +EK+   I +C    C +       L  H+  IH  TG+  Y
Sbjct: 458 PQVQNCRHHCESRCTNAIKEKQGG-IFQCTWESCHQTCKSRQELNEHIEAIHVPTGQSSY 516

Query: 325 KCTWPNCDTSSSVKSNITRHYKSH 348
           +C W  C    + +  + RH K H
Sbjct: 517 QCRWDGCTKHFAQRQKLLRHIKVH 540

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 287 SREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           +R     + +KC ICDK    S+SL+ H+  HTGEKP +C    C    +  SN+++H K
Sbjct: 785 TRTHSGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIK 842

Query: 347 SHLK 350
           +H K
Sbjct: 843 THKK 846

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +KC  C +  +   +L  H   H+GEKPYKC    CD   ++ S++  H ++H
Sbjct: 766 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CDKKFAISSSLKIHIRTH 816

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 301 CDKIVTRSTSLRSHLL-IHT--GEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C+K  T +  L +HL  +H   G+  Y+C W +C  +   +  + RH K H K
Sbjct: 710 CNKQFTNAQELNNHLESVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 762

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 277 PTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTWPNCDTSS 335
           P   KS+S    E+KP    KC  C K   RS  L+ H+  +H+ E+P+ C++  CD   
Sbjct: 625 PRNSKSSSPVEEEEKP---FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKF 679

Query: 336 SVKSNITRHYKSHLK 350
           S   N+++H K+H K
Sbjct: 680 SRSDNLSQHLKTHKK 694

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +  KC  C K   RS  L+ H+  +H+ E+P+ C  P CD   S   N+ +H K+H K
Sbjct: 763 KTFKCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKK 818

>Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {ON}
           YLR131C (REAL)
          Length = 769

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P ++ +C  P C K+  R  ++RSH+  H  ++PY C +P C  +     ++ RH  SH
Sbjct: 598 PDKLFECLYPNCSKVFKRRYNIRSHIQTHLQDRPYACDFPGCAKAFVRNHDLIRHKISH 656

>Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON}
           YDR146C (REAL)
          Length = 707

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 299 PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P C K   R  ++RSH+  H  ++PY C  P CD +     ++ RH KSH
Sbjct: 553 PGCAKTFKRRYNIRSHIQTHLEDRPYSCDCPGCDKAFVRNHDLIRHKKSH 602

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349
           C IC K   R    + H+  HTGEKP+ CT+  C    S    + RH K H+
Sbjct: 15  CDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKIHV 66

>CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa]
           {ON} similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
           YDR146c SWI5
          Length = 703

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 270 PEVQNDEPTT--PKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYK 325
           P  Q  +PTT  P    R  +E  P +  +C  P C K   R  +++SH+  H  +KPYK
Sbjct: 496 PSRQRKKPTTLPPGYIDRYVKEL-PDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYK 554

Query: 326 CTWPNCDTSSSVKSNITRHYKSHLK 350
           C +  C  +     ++ RH K+H K
Sbjct: 555 CDFEGCTKAFVRNHDLARHKKTHDK 579

>KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {ON}
           some similarities with uniprot|P32805 Saccharomyces
           cerevisiae YGL254W FZF1 Transcription factor involved in
           sulfite metabolism sole identified regulatory target is
           SSU1 overexpression suppresses sulfite-sensitivity of
           many unrelated mutants due to hyperactivation of SSU1
           contains five zinc fingers
          Length = 206

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 289 EKKPARIHKCPI--CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           EK+P R + CPI  C K  +R   LR H+  HT EKP+ C  P CD +    S++  H  
Sbjct: 2   EKRPKR-YVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHML 60

Query: 347 SHLK 350
           SH K
Sbjct: 61  SHSK 64

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 10/84 (11%)

Query: 278 TTPKSTSRPSREKKPARIH------KCP--ICDKIVTRSTSLRSHLLIHTGEKPYKCTWP 329
           +  K  SRP   ++  R H       CP   CDK   R + LR H+L H+  KPY C+  
Sbjct: 14  SCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSKVKPYNCSV- 72

Query: 330 NCDTSSSVKSNITRHYKSHLKSQN 353
            C    + K    RH ++H ++Q+
Sbjct: 73  -CGKGFATKQQFQRHQQTHTQNQD 95

>Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {ON}
           YGL035C (MIG1) - 1:1 [contig 227] FULL
          Length = 463

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R + CPIC +   R      H+  HTGEKP+ C +  C    S    +TRH + H
Sbjct: 21  RPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON}
           YER028C (REAL)
          Length = 406

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345
           P  +++P    KC  C +   R    + H+  HTGEKP+ C++  C  S S    + RH 
Sbjct: 10  PDNDRRP---FKCEFCSRGFHRLEHKKRHVRTHTGEKPHACSFRGCPKSFSRSDELKRHL 66

Query: 346 KSHLKS 351
           ++H K+
Sbjct: 67  RTHKKT 72

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 285 RPSREKKPARIHKCPICDKIVTRSTSLRSH-LLIHTGEKPYKCTWPNCDTSSSVKSNITR 343
           +PS    P++I  CP C++   R   L+ H   +H GEKP+ C    C+   S   N+ +
Sbjct: 623 KPSPFNDPSKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHI--CNKKFSRSDNLAQ 680

Query: 344 HYKSH 348
           H K+H
Sbjct: 681 HIKTH 685

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQN 353
           R  +C  C    T S  L  H  IHTGEK Y C   +C    S   N  +HY++HLK + 
Sbjct: 210 RKFQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQRFSRHDNCIQHYRTHLKKKQ 269

Query: 354 Q 354
           +
Sbjct: 270 R 270

>KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.326
           YLR131C
          Length = 623

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P ++ +C    C K+  R  ++RSH+  H  ++PY C + NC+ +     ++ RH KSH
Sbjct: 455 PDKLFECLYKDCHKLFKRRYNIRSHIQTHLEDRPYICDYENCNKAFVRNHDLVRHKKSH 513

>KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]
           {ON} weakly similar to uniprot|P21192 Saccharomyces
           cerevisiae YLR131C ACE2 Transcription factor that
           activates expression of early G1-specific genes
           localizes to daughter cell nuclei after cytokinesis and
           delays G1 progression in daughters localization is
           regulated by phosphorylation potential Cdc28p substrate
          Length = 854

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           C K   R  + R+H+  H  ++PYKC +P C  +     ++ RH KSHL+
Sbjct: 700 CQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLE 749

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 271 EVQNDEPTTPKSTSR-PSREKKPARIHKCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTW 328
           EV N+  + PK+  R PS    P++   C  C +   R   L+ H+L +H GEK + C  
Sbjct: 374 EVLNNGNSIPKTRGRKPSLVDDPSKQFGCKYCPRKFKRQEHLKRHILSLHVGEKRFGC-- 431

Query: 329 PNCDTSSSVKSNITRHYKSH 348
           P C  + S   N+ +H K+H
Sbjct: 432 PICGKNFSRSDNLNQHIKTH 451

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 282 STSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNI 341
           S + PS + K   IH+C  C+K   R + L+ HLL H+ ++ + C W  C +    K N+
Sbjct: 326 SVTAPSSDHK--YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNL 381

Query: 342 TRHYK 346
            +H K
Sbjct: 382 LQHMK 386

>Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON}
           YDR146C (REAL)
          Length = 708

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 278 TTPKSTSRPSREKKPARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSS 335
           T P+ +     ++ P +  +C  P C K   R  ++RSH+  H  ++PY C  P C+ + 
Sbjct: 531 TLPRGSIDRYVKEMPDKTFECLYPECTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCNKAF 590

Query: 336 SVKSNITRHYKSH 348
               ++ RH KSH
Sbjct: 591 VRNHDLIRHKKSH 603

>Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {ON}
           YLR131C (REAL)
          Length = 767

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P ++ +C  P C K+  R  ++RSH+  H  ++PY C +P C  +     ++ RH  SH
Sbjct: 596 PDKLFECLYPNCRKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISH 654

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 290 KKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           K PA I+ C +CDK  TR  +L+SHL  HT E+P+ C+   C  + + + +  RH   H
Sbjct: 494 KNPA-IYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSI--CGKAFARQHDRKRHEDLH 549

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 31/82 (37%), Gaps = 15/82 (18%)

Query: 281 KSTSRPSREKKPARIHK------CPICDKIVTRSTSLRSHLLIHTGEKPYKCT------- 327
           K  +RP   K   R H       C IC K   R    + H  +H+G+K Y C        
Sbjct: 506 KKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGT 565

Query: 328 -WPNCDTSSSVKSNITRHYKSH 348
            W  C    +    + RH+K+ 
Sbjct: 566 KW-GCGKKFARSDALGRHFKTE 586

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 297 KCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           KC  C+K   RS  L+ H+  +H+ E+P+ CT+  CD   S   N+++H K+H K
Sbjct: 467 KCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTF--CDKRFSRSDNLSQHLKTHKK 519

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +KCP C K  +   +L+ HL IH+GEKPY C    C    ++ S++  H ++H
Sbjct: 641 YKCPQCQKCFSSDETLKQHLRIHSGEKPYHCD--ICGKRFAISSSLKIHVRTH 691

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 37/81 (45%), Gaps = 8/81 (9%)

Query: 277 PTTPKSTSRPSREKKPARIHK------CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPN 330
           P   K  S     K+  RIH       C IC K    S+SL+ H+  HTGEKP +C    
Sbjct: 644 PQCQKCFSSDETLKQHLRIHSGEKPYHCDICGKRFAISSSLKIHVRTHTGEKPLQCA--V 701

Query: 331 CDTSSSVKSNITRHYKSHLKS 351
           C       SN+ +H K+H K 
Sbjct: 702 CGKRFIESSNLNKHMKTHEKG 722

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C K  T+   +  HL +HT  KPYKC  P C    S    + +H + H
Sbjct: 618 CGKTFTQRQKIARHLKVHTRYKPYKC--PQCQKCFSSDETLKQHLRIH 663

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           ++C IC K    S SL+ H+  HTGEKP KC    C    +  SN+++H K+H+K
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMK 677

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKC 326
           ++CP C K  +   +L  H  +H+GEKPY+C
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYEC 627

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C+K  ++   L  HL +H+  KPY+C  P C    S +  + +H + H
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVH 619

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 37/92 (40%), Gaps = 12/92 (13%)

Query: 271 EVQNDEPTTPKSTSRPSREKK------PARIHKC---PICDKIVTRSTSLRSHL---LIH 318
           ++ N   T  ++  R SR KK      P     C     C++    +  L  HL    + 
Sbjct: 502 DLNNSNSTRTRARQRVSRSKKLPEPTKPDETEFCCKWAGCNERFKSAGDLNDHLEEMHLT 561

Query: 319 TGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
            G+  Y C W  C+ + S +  + RH K H K
Sbjct: 562 KGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 289 EKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346
           E +   +++C +C+KI  R   LR H L HT ++ + C W  C +    + N+ +H K
Sbjct: 112 EDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167

>TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.326
           YLR131C
          Length = 572

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P R+ +C  P C KI  R  ++RSH+  H  ++PY C    C  +     ++ RH K+H
Sbjct: 418 PDRLFECIYPGCHKIFKRRYNIRSHIQTHLEDRPYVCDHEGCTKAFVRNHDLLRHKKTH 476

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +KC IC+K  + S+SL+ H+  HTGEKP +C    C    +  SN+++H K+H K
Sbjct: 799 YKCDICNKKFSISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHKK 851

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +KC  C +  +   +L  H   H+GEKPYKC    C+   S+ S++  H ++H
Sbjct: 771 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCDI--CNKKFSISSSLKIHIRTH 821

>CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakly
           similar to uniprot|P53968 Saccharomyces cerevisiae
           YNL027w CRZ1
          Length = 645

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 298 CPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C +C K+ +R  +L+SHL  HT EKPY+C+   C  + + + +  RH   H
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLH 571

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 277 PTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKC-------TWP 329
           P   KS  R   ++KP   ++C IC K   R    + H  +HTG+K Y C       T+ 
Sbjct: 533 PYNLKSHLRTHTDEKP---YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFW 589

Query: 330 NCDTSSSVKSNITRHYKS 347
            C    +    + RH+K+
Sbjct: 590 GCGKKFARSDALGRHFKT 607

>TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {ON}
           Anc_1.326 YJL056C
          Length = 755

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350
           +C IC K    S+SL+ H+  HTGEKP +C    C    S  SN+ +H KSH K
Sbjct: 676 ECRICGKRFAVSSSLKIHIRTHTGEKPLQCKI--CGRRFSESSNLNKHMKSHQK 727

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 301 CDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           CDK   +   L  HL +H+G KPYKC   +C    S +  +T+H ++H
Sbjct: 624 CDKRFAQRQKLVRHLKVHSGYKPYKCQ--DCGKCFSSEDTLTQHKRTH 669

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           +KC  C K  +   +L  H   H+GEKP++C    C    +V S++  H ++H
Sbjct: 647 YKCQDCGKCFSSEDTLTQHKRTHSGEKPFECRI--CGKRFAVSSSLKIHIRTH 697

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 301 CDKIVTRSTSLRSHLL---IHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           C ++   + +L +HL    +  G+  Y C W  CD   + +  + RH K H
Sbjct: 591 CTEVFDSAAALTTHLEALHLEKGKSEYHCHWHGCDKRFAQRQKLVRHLKVH 641

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R + CPIC +   R      H+  HTGEKP+ C +  C    S +  + RH + H
Sbjct: 20  RPYVCPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRRIH 74

>KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weakly
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 746

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 292 PARIHKC--PICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           P +  +C  P C K   R  ++RSH+  H  ++PY C +P+C+ +     ++ RH K+H
Sbjct: 579 PDKTFECLHPDCGKNFRRRYNIRSHIQTHLEDRPYICDFPDCNKAFVRNHDLIRHKKTH 637

>TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4.80
           YGL035C
          Length = 518

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%)

Query: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSH 348
           R H C  C +   R      H+  HTGEKP+ C +  C    S    +TRH + H
Sbjct: 67  RPHVCGTCGRAFHRLEHQTRHMRTHTGEKPHACDFQGCTKRFSRSDELTRHKRIH 121

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 278 TTPKSTSR-PSREKKPARIHKCPICDKIVTRSTSLRSHLL-IHTGEKPYKCTWPNCDTSS 335
           T PK+  R PS    P ++  C  CD+   R   L+ H+  +H GEKP+ C    C+   
Sbjct: 284 TLPKTRGRKPSPILDPLKLFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHI--CEKKF 341

Query: 336 SVKSNITRHYKSH 348
           S   N+ +H K+H
Sbjct: 342 SRSDNLNQHIKTH 354

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.126    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,454,827
Number of extensions: 1287598
Number of successful extensions: 5285
Number of sequences better than 10.0: 579
Number of HSP's gapped: 5282
Number of HSP's successfully gapped: 761
Length of query: 354
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 243
Effective length of database: 40,753,473
Effective search space: 9903093939
Effective search space used: 9903093939
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)