Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F009002.533ON52552518340.0
NDAI0H014002.533ON5411514132e-43
KNAG0C058102.533ON5541363799e-39
KAFR0A018602.533ON4901323461e-34
Smik_13.2492.533ON4731323327e-33
Kpol_1018.332.533ON5891353304e-32
ZYRO0B02002g2.533ON2941323141e-31
YMR070W (MOT3)2.533ON4901423222e-31
CAGL0K03003g2.533ON6471313244e-31
Skud_13.2262.533ON4751443187e-31
TDEL0A030702.533ON2391423047e-31
NDAI0K018602.533ON7301373157e-30
NCAS0A048002.533ON5111393109e-30
SAKL0A09482g2.533ON3881513005e-29
TBLA0G022302.533ON2161382852e-28
Suva_13.2462.533ON419682874e-27
TPHA0G035102.533ON3871352838e-27
KLTH0D06842g2.533ON5061562772e-25
Kwal_26.80212.533ON5071412711e-24
KLLA0E18547g2.533ON4311322654e-24
Ecym_72552.533ON5441372514e-22
AGL071C2.533ON3961402475e-22
TBLA0I014802.533ON513732499e-22
KAFR0J003402.533ON218672219e-20
KNAG0A070402.533ON3521611943e-15
TPHA0C041902.533ON417531821e-13
NCAS0A129102.598ON822571626e-11
NCAS0H030802.598ON730661473e-09
Suva_13.2062.598ON709541473e-09
Skud_13.1932.598ON704601465e-09
ZYRO0F01012g2.598ON584701447e-09
YMR037C (MSN2)2.598ON704801448e-09
NDAI0C005602.598ON972571441e-08
Smik_13.2072.598ON703801431e-08
KLLA0F26961g2.598ON694681421e-08
TBLA0H028302.598ON746531421e-08
KAFR0B025508.234ON890711422e-08
SAKL0H12958g8.425ON1129621412e-08
Kpol_185.32.598ON647611403e-08
Kwal_26.83512.598ON698671393e-08
CAGL0F05995g2.598ON597501384e-08
SAKL0B11330g2.598ON499561365e-08
Suva_5.3038.234ON797771377e-08
NDAI0B013402.598ON769571377e-08
Suva_13.704.351ON777781368e-08
TPHA0A019408.234ON912581369e-08
TPHA0C025802.598ON365501331e-07
TBLA0B061604.351ON1384591351e-07
TDEL0B069102.598ON437721331e-07
Kpol_1032.528.234ON824581341e-07
ABR089C2.598ON571571331e-07
Ecym_23012.598ON767571342e-07
Skud_11.1672.598ON628811332e-07
YKL062W (MSN4)2.598ON630541332e-07
Smik_11.1862.598ON641541322e-07
TBLA0F038308.234ON967581323e-07
AGR172W8.425ON1057611323e-07
KNAG0G012808.144ON472561313e-07
NCAS0B028408.425ON1152561323e-07
YER169W (RPH1)8.234ON796651313e-07
Suva_11.1642.598ON639541313e-07
KLTH0D08734g2.598ON677501313e-07
Smik_13.584.351ON1253531313e-07
KNAG0M003504.351ON1076651313e-07
YML081W (TDA9)4.351ON1251531313e-07
Skud_13.614.351ON1253531313e-07
NDAI0C048608.425ON1350591314e-07
TDEL0A013008.234ON837581304e-07
KLLA0F13046g8.425ON1379721304e-07
CAGL0L06072g8.144ON300611274e-07
Kpol_1013.212.598ON494501294e-07
Suva_2.3838.425ON1319561304e-07
YDR216W (ADR1)8.425ON1323561304e-07
Smik_4.4638.425ON1324561305e-07
KNAG0G018708.234ON875531305e-07
Skud_4.4788.425ON1323561305e-07
ZYRO0B11770g8.234ON867581295e-07
Kpol_529.138.425ON1410721305e-07
Skud_5.3088.234ON802651296e-07
KNAG0H005502.598ON620541296e-07
NCAS0C040708.144ON289671266e-07
KAFR0F020702.598ON370791276e-07
Smik_5.3418.234ON798651286e-07
NDAI0B022508.234ON1156691297e-07
TBLA0G019202.598ON523501279e-07
KAFR0B068104.351ON1155531289e-07
KNAG0M023102.598ON660631271e-06
NCAS0A062504.351ON1341611271e-06
KAFR0A023202.598ON443571251e-06
TBLA0F003708.144ON687641261e-06
CAGL0E04884g8.425ON1489561271e-06
KLLA0C17710g8.234ON821591261e-06
TPHA0N014602.598ON519511251e-06
Kwal_47.166214.351ON1178531261e-06
ZYRO0A09416g8.425ON1346561261e-06
CAGL0M13189g2.598ON541501251e-06
Smik_4.3378.234ON894531261e-06
KLTH0D18062g4.351ON1128531261e-06
YDR096W (GIS1)8.234ON894531261e-06
TPHA0C021608.425ON1375531262e-06
ZYRO0B14894g4.351ON1119691252e-06
Suva_2.2558.234ON894531252e-06
SAKL0G18062g4.351ON1238531252e-06
CAGL0E04312g5.586ON688721252e-06
Skud_4.3548.234ON916531252e-06
CAGL0L11880g8.234ON980531252e-06
NDAI0C06260na 1ON582601242e-06
SAKL0H17842g8.234ON814781252e-06
Skud_4.2973.281ON231671202e-06
Kpol_1052.183.281ON357511222e-06
YDR043C (NRG1)3.281ON231671192e-06
KAFR0B063608.425ON627731232e-06
TPHA0B003804.351ON1310471243e-06
Skud_8.555.586ON535771223e-06
KLTH0E09922g8.425ON1119561233e-06
TBLA0E047704.351ON1655521233e-06
KLLA0B04477g4.351ON1332661233e-06
KNAG0A044608.425ON1290631233e-06
TDEL0D006704.351ON1199521233e-06
TDEL0F055008.425ON1207561234e-06
NDAI0G034208.144ON484561214e-06
AER159C4.351ON1191531234e-06
Kpol_1001.14.351ON1341471234e-06
CAGL0M00594g4.351ON1020721224e-06
KNAG0B033505.586ON600821214e-06
SAKL0H24816g8.144ON410501204e-06
CAGL0M01870g3.298ON315571194e-06
KLTH0G14454g8.234ON832561214e-06
Suva_2.2003.281ON232671175e-06
Kpol_423.153.518ON392621205e-06
TPHA0D034003.518ON338521195e-06
KNAG0H011803.281ON254581185e-06
Kwal_56.234538.234ON828561215e-06
Smik_4.2813.281ON231671175e-06
KNAG0B005903.518ON439721205e-06
KLLA0C17072g8.144ON474501206e-06
KAFR0A067205.586ON235831176e-06
NDAI0J028504.351ON1537661216e-06
NCAS0B046008.144ON547501197e-06
SAKL0F01980g3.518ON385581187e-06
KLTH0E06688g8.144ON397501187e-06
NCAS0B048408.234ON864531199e-06
ACL057W8.144ON520501189e-06
NCAS0H028905.586ON532701181e-05
TBLA0H006608.425ON1311571191e-05
Skud_10.3514.351ON1327531191e-05
NDAI0D032404.351ON1362531191e-05
KNAG0H030108.234ON784651181e-05
TDEL0A045305.586ON484911171e-05
Suva_12.2184.351ON1270531181e-05
Kwal_47.172418.144ON403501161e-05
Smik_10.4204.351ON1348531181e-05
Ecym_35208.234ON819561181e-05
KNAG0B067104.351ON1053551181e-05
Ecym_14045.586ON562921171e-05
Ecym_84038.144ON573501171e-05
YJR127C (RSF2)4.351ON1380531181e-05
KAFR0A023808.234ON900651171e-05
KLLA0E08713g2.303ON596561162e-05
KLLA0F18524g3.281ON357621152e-05
CAGL0K12078g3.281ON463511152e-05
CAGL0K02145g8.144ON317481142e-05
ZYRO0G19140g8.144ON557501152e-05
SAKL0H20988g4.80ON548521152e-05
AGR117C8.234ON799561152e-05
Smik_8.635.586ON542761152e-05
KLTH0H09196g4.80ON460521142e-05
Suva_7.523.518ON400581143e-05
NDAI0C006905.586ON650681153e-05
Kwal_27.109253.281ON264611123e-05
Smik_4.7425.586ON528711143e-05
CAGL0K06413g5.586ON359681133e-05
TBLA0G032403.298ON511581133e-05
SAKL0D03146g3.281ON157511074e-05
KAFR0A010903.281ON249591114e-05
TDEL0F026904.80ON350521124e-05
YHR006W (STP2)5.586ON541691134e-05
CAGL0H04213g4.351ON1321471144e-05
TBLA0B060502.303ON762561134e-05
CAGL0A01628g4.80ON424611124e-05
ZYRO0D13992g5.586ON587661134e-05
YDR463W (STP1)5.586ON519641134e-05
Kpol_1031.428.144ON359511125e-05
YGL209W (MIG2)3.518ON382581125e-05
Suva_8.625.586ON545691125e-05
KNAG0D021208.144ON402501125e-05
Skud_4.7395.586ON514641125e-05
SAKL0G06292g5.586ON517701125e-05
KLTH0G05104g5.586ON538731125e-05
Kpol_1050.193.518ON221561095e-05
ADR308Cna 2ON278561105e-05
YPL230W (USV1)6.256ON391721115e-05
KAFR0E042704.351ON1255531136e-05
KLTH0G10802g2.303ON526561126e-05
TDEL0D034303.281ON175511066e-05
TBLA0E04210singletonON454781116e-05
KAFR0B021608.144ON453501116e-05
Kpol_1023.635.586ON556791116e-05
Smik_6.4356.256ON386831106e-05
Skud_16.486.256ON398721116e-05
Kwal_26.80112.531ON190511077e-05
Skud_7.593.518ON383581107e-05
Smik_7.543.518ON382581107e-05
Kpol_1023.1004.351ON916511127e-05
Smik_5.2768.144ON442501107e-05
Suva_5.2518.144ON449501107e-05
Suva_16.766.256ON392671107e-05
KLLA0F10109g5.586ON623641118e-05
KLTH0G01826g3.518ON307571098e-05
KAFR0C003403.298ON394571108e-05
KLLA0F20636gsingletonON285511088e-05
Kwal_14.22784.80ON463521108e-05
ADL042Wna 3ON281681089e-05
KAFR0C057105.586ON442681091e-04
Kpol_541.398.116ON291671081e-04
KAFR0C029808.144ON225561061e-04
Skud_5.2488.144ON442501091e-04
KNAG0C060305.586ON314771081e-04
Ecym_8379na 3ON305551081e-04
TBLA0I032803.518ON330661081e-04
TPHA0D010508.144ON439501091e-04
TDEL0B046708.144ON312501081e-04
Ecym_14154.80ON504551091e-04
YER130C8.144ON443501091e-04
KNAG0H019302.303ON618561091e-04
NCAS0A106503.281ON293511071e-04
KLLA0E11023g4.80ON474551091e-04
NDAI0D037504.80ON493521081e-04
KAFR0F012106.256ON311631071e-04
NDAI0F014006.256ON394551081e-04
SAKL0E07216g2.303ON548561091e-04
KAFR0F041503.518ON416571081e-04
Suva_2.6395.586ON516791081e-04
Ecym_8011na 2ON276561062e-04
NDAI0A075403.298ON370601072e-04
TBLA0C048803.518ON339511072e-04
AFR531Wna 4ON274681062e-04
NCAS0I014603.298ON330601062e-04
KLTH0C07172g3.281ON265571052e-04
NDAI0I029003.518ON524571072e-04
Ecym_26733.298ON301521062e-04
NDAI0H011105.586ON454641072e-04
NCAS0I015603.281ON266571052e-04
TPHA0A039803.281ON314571052e-04
AGL207W3.298ON277681052e-04
TPHA0A039103.298ON351521062e-04
Kwal_47.190453.518ON266511052e-04
KAFR0F036004.80ON335521052e-04
Kpol_1052.83.298ON386561062e-04
Ecym_4128na 5ON312581052e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00900
         (525 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   711   0.0  
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   163   2e-43
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   150   9e-39
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   137   1e-34
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   132   7e-33
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   131   4e-32
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   125   1e-31
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   128   2e-31
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   129   4e-31
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   127   7e-31
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   121   7e-31
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   125   7e-30
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   124   9e-30
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   120   5e-29
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   114   2e-28
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   115   4e-27
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   113   8e-27
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   111   2e-25
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   108   1e-24
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   106   4e-24
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   101   4e-22
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   100   5e-22
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   100   9e-22
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       90   9e-20
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    79   3e-15
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    75   1e-13
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    67   6e-11
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    61   3e-09
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    61   3e-09
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    61   5e-09
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    60   7e-09
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    60   8e-09
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     60   1e-08
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    60   1e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    59   1e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    59   1e-08
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    59   2e-08
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    59   2e-08
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    59   3e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    58   3e-08
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    58   4e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    57   5e-08
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    57   7e-08
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     57   7e-08
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    57   8e-08
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    57   9e-08
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    56   1e-07
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    57   1e-07
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    56   1e-07
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    56   1e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    56   1e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    56   2e-07
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    56   2e-07
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    56   2e-07
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    55   2e-07
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    55   3e-07
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    55   3e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    55   3e-07
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    55   3e-07
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    55   3e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    55   3e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    55   3e-07
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    55   3e-07
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    55   3e-07
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    55   3e-07
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    55   3e-07
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    55   4e-07
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    55   4e-07
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    55   4e-07
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    54   4e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    54   4e-07
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    55   4e-07
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    55   4e-07
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    55   5e-07
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    55   5e-07
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    55   5e-07
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    54   5e-07
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    55   5e-07
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    54   6e-07
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    54   6e-07
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      53   6e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    54   6e-07
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    54   6e-07
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    54   7e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    54   9e-07
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    54   9e-07
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    54   1e-06
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    54   1e-06
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    53   1e-06
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    53   1e-06
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    54   1e-06
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    53   1e-06
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    53   1e-06
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    53   1e-06
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    53   1e-06
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    53   1e-06
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    53   1e-06
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    53   1e-06
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    53   1e-06
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    53   2e-06
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    53   2e-06
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    53   2e-06
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    53   2e-06
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    53   2e-06
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    53   2e-06
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    53   2e-06
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             52   2e-06
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    53   2e-06
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    51   2e-06
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    52   2e-06
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    50   2e-06
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    52   2e-06
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    52   3e-06
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    52   3e-06
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    52   3e-06
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    52   3e-06
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    52   3e-06
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    52   3e-06
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    52   3e-06
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    52   4e-06
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    51   4e-06
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    52   4e-06
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    52   4e-06
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    52   4e-06
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    51   4e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    51   4e-06
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    50   4e-06
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    51   4e-06
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    50   5e-06
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    51   5e-06
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    50   5e-06
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    50   5e-06
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    51   5e-06
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    50   5e-06
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    51   5e-06
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    51   6e-06
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    50   6e-06
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    51   6e-06
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    50   7e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    50   7e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    50   7e-06
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     50   9e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    50   9e-06
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    50   1e-05
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    50   1e-05
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    50   1e-05
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    50   1e-05
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    50   1e-05
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    50   1e-05
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    50   1e-05
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    49   1e-05
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    50   1e-05
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    50   1e-05
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    50   1e-05
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    50   1e-05
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    50   1e-05
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    50   1e-05
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    50   1e-05
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    49   2e-05
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    49   2e-05
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    49   2e-05
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    49   2e-05
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    49   2e-05
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    49   2e-05
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    49   2e-05
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    49   2e-05
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    49   2e-05
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    49   3e-05
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    49   3e-05
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    48   3e-05
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    49   3e-05
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    48   3e-05
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     48   3e-05
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    46   4e-05
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    47   4e-05
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    48   4e-05
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    48   4e-05
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    49   4e-05
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    48   4e-05
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    48   4e-05
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    48   4e-05
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    48   4e-05
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    48   5e-05
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    48   5e-05
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    48   5e-05
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    48   5e-05
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    48   5e-05
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    48   5e-05
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    48   5e-05
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    47   5e-05
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    47   5e-05
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    47   5e-05
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    48   6e-05
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    48   6e-05
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    45   6e-05
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             47   6e-05
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    47   6e-05
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    47   6e-05
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    47   6e-05
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    47   6e-05
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    46   7e-05
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    47   7e-05
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    47   7e-05
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    48   7e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    47   7e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    47   7e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    47   7e-05
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    47   8e-05
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    47   8e-05
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    47   8e-05
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    46   8e-05
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    47   8e-05
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    46   9e-05
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    47   1e-04
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    46   1e-04
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    45   1e-04
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    47   1e-04
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    46   1e-04
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    46   1e-04
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    46   1e-04
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    47   1e-04
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    46   1e-04
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    47   1e-04
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    47   1e-04
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    47   1e-04
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    46   1e-04
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    47   1e-04
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      46   1e-04
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    46   1e-04
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     46   1e-04
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    47   1e-04
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    46   1e-04
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    46   1e-04
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    45   2e-04
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    46   2e-04
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    46   2e-04
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    45   2e-04
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    45   2e-04
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    45   2e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    46   2e-04
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    45   2e-04
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     46   2e-04
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      45   2e-04
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    45   2e-04
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    45   2e-04
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    45   2e-04
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    45   2e-04
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    45   2e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    45   2e-04
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    45   2e-04
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    45   2e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    45   3e-04
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    45   3e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    45   3e-04
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    45   3e-04
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     45   3e-04
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    45   3e-04
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    44   3e-04
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    45   3e-04
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    45   3e-04
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    45   4e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    45   4e-04
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    43   4e-04
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     45   4e-04
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    45   4e-04
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      44   4e-04
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    45   4e-04
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    44   4e-04
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    45   4e-04
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    44   4e-04
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    45   4e-04
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    45   4e-04
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    45   5e-04
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    44   5e-04
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    45   5e-04
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    45   5e-04
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    44   5e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    45   6e-04
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    44   6e-04
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    44   6e-04
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    44   6e-04
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    42   6e-04
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    44   7e-04
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    44   7e-04
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    44   7e-04
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    44   7e-04
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      44   7e-04
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     44   7e-04
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    44   8e-04
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    42   8e-04
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    44   8e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    44   8e-04
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               44   9e-04
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    44   9e-04
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    44   0.001
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    44   0.001
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    43   0.001
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    44   0.001
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    44   0.001
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    44   0.001
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    44   0.001
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    42   0.001
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    43   0.001
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    43   0.001
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    43   0.001
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    43   0.001
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    42   0.001
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    42   0.001
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    43   0.001
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    44   0.001
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    42   0.001
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    42   0.001
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    43   0.002
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    43   0.002
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               43   0.002
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    42   0.002
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    42   0.002
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    43   0.002
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    43   0.002
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    43   0.002
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    43   0.002
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    43   0.002
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    42   0.002
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    43   0.002
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    43   0.002
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    41   0.002
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    43   0.002
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    43   0.002
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    42   0.002
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    42   0.002
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    43   0.002
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    42   0.002
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    43   0.002
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    42   0.003
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    42   0.003
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    42   0.003
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    42   0.003
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    42   0.003
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    42   0.003
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    41   0.003
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    42   0.003
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    42   0.003
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    42   0.003
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    42   0.003
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    42   0.004
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    42   0.004
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    42   0.004
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    42   0.004
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    41   0.004
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    42   0.004
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    42   0.004
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    42   0.004
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    42   0.004
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    41   0.004
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    42   0.004
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    42   0.004
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     41   0.005
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    42   0.005
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    42   0.005
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    41   0.005
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    42   0.005
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    42   0.005
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    42   0.005
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    41   0.005
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    41   0.005
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    40   0.006
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               41   0.006
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    41   0.006
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    41   0.006
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    41   0.006
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    41   0.006
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    40   0.007
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                40   0.007
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    40   0.007
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    41   0.007
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    41   0.007
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    40   0.007
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    40   0.007
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    41   0.007
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    40   0.007
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    41   0.007
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    41   0.007
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    40   0.007
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                40   0.007
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    40   0.008
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      40   0.008
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    41   0.008
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    40   0.008
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    40   0.008
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    41   0.008
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    41   0.008
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    40   0.008
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    41   0.008
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    39   0.009
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    40   0.009
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    40   0.010
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    40   0.010
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    39   0.010
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    40   0.011
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    39   0.012
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    39   0.012
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             40   0.013
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    40   0.013
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    40   0.013
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    39   0.014
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    40   0.014
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               39   0.015
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    40   0.018
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    39   0.018
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    40   0.020
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     40   0.020
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    40   0.020
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    40   0.020
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    39   0.021
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    40   0.022
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     39   0.023
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    39   0.023
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    39   0.025
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    39   0.026
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    39   0.027
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    39   0.027
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    39   0.028
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    39   0.029
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    39   0.029
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    39   0.029
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    39   0.030
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    38   0.030
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    39   0.031
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    39   0.031
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    39   0.032
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    39   0.032
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    38   0.033
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    39   0.033
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               39   0.033
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    37   0.034
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    39   0.035
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    39   0.035
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               39   0.036
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    39   0.036
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                38   0.038
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    38   0.039
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    38   0.039
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     39   0.039
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    39   0.043
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    38   0.044
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    38   0.045
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    38   0.045
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    38   0.045
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    39   0.046
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    39   0.047
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    39   0.048
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    39   0.049
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    37   0.050
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    38   0.051
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    38   0.051
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    38   0.056
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    38   0.061
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    38   0.061
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    37   0.062
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    38   0.065
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    38   0.067
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    36   0.069
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    38   0.072
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      37   0.074
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    38   0.080
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    37   0.082
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    37   0.082
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                37   0.082
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    38   0.084
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    37   0.086
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    38   0.087
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    37   0.089
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    37   0.095
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    37   0.096
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    37   0.10 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    37   0.11 
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    37   0.11 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    37   0.11 
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    37   0.12 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    37   0.12 
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    37   0.13 
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    37   0.14 
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    37   0.14 
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    37   0.14 
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    37   0.15 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.17 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    36   0.18 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    36   0.18 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    36   0.19 
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    36   0.20 
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    36   0.21 
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    34   0.22 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    36   0.23 
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    36   0.25 
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    35   0.26 
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    36   0.26 
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    35   0.29 
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    36   0.30 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    35   0.33 
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    35   0.33 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    35   0.34 
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    35   0.34 
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    35   0.35 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    35   0.38 
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                35   0.38 
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    34   0.39 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                35   0.40 
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    35   0.43 
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    35   0.45 
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    34   0.46 
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    35   0.47 
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    34   0.48 
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    35   0.49 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    35   0.52 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    35   0.54 
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    35   0.60 
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    35   0.62 
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  34   0.68 
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  34   0.71 
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    33   0.72 
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    34   0.78 
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    34   0.82 
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    33   0.83 
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    34   0.85 
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    34   0.86 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    34   0.93 
SAKL0B04664g Chr2 complement(410577..411857) [1281 bp, 426 aa] {...    34   0.96 
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       32   0.97 
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    34   1.1  
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    33   1.1  
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    33   1.2  
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    33   1.2  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    34   1.3  
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    33   1.3  
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    33   1.3  
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    33   1.4  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    34   1.4  
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    33   1.4  
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    33   1.4  
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    33   1.6  
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    32   1.6  
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    33   1.6  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    33   1.6  
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    33   1.6  
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      33   1.6  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    32   1.8  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    33   1.8  
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    33   2.1  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    33   2.2  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    33   2.2  
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    31   2.4  
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    33   2.5  
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    32   2.6  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    32   2.8  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    32   2.9  
CAGL0B02651g Chr2 complement(253495..254064) [570 bp, 189 aa] {O...    32   3.1  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    32   3.1  
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    32   3.1  
TDEL0G02080 Chr7 complement(407217..407828) [612 bp, 203 aa] {ON...    32   3.1  
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    32   3.2  
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    32   3.3  
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    31   3.5  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    32   3.5  
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    32   3.6  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    32   3.8  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      31   4.3  
TPHA0B00710 Chr2 complement(160987..162735) [1749 bp, 582 aa] {O...    32   5.5  
ZYRO0D16786g Chr4 (1389362..1391914) [2553 bp, 850 aa] {ON} simi...    32   5.5  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    31   6.3  
KLTH0E02376g Chr5 complement(205420..207708) [2289 bp, 762 aa] {...    31   7.2  
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    30   8.4  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    31   9.3  

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/525 (70%), Positives = 370/525 (70%)

Query: 1   MSNWTAYXXXXXXXXXXXXXXXXXXXXXXXXMTAAQKDXXXXXXXXXXXXXXLLNPPQLQ 60
           MSNWTAY                        MTAAQKD              LLNPPQLQ
Sbjct: 1   MSNWTAYQDQKVKQEQEQEQEQEKQNQRQSQMTAAQKDTSTSTSTNTNGVSSLLNPPQLQ 60

Query: 61  SEKLSLPINTTDQMXXXXXXXXKNDSLGTIPLPQTSKYNPIYHQPSSYMMNESDMRRNYY 120
           SEKLSLPINTTDQM        KNDSLGTIPLPQTSKYNPIYHQPSSYMMNESDMRRNYY
Sbjct: 61  SEKLSLPINTTDQMHSHSHSHSKNDSLGTIPLPQTSKYNPIYHQPSSYMMNESDMRRNYY 120

Query: 121 PTXXXXXXXXXXXXXVTGSQAQTNTSPFLYHWNTGRSDENXXXXXXMLQSLPTTSNPYGV 180
           PT             VTGSQAQTNTSPFLYHWNTGRSDEN      MLQSLPTTSNPYGV
Sbjct: 121 PTPQQQQPPPQQQQQVTGSQAQTNTSPFLYHWNTGRSDENQQQQQQMLQSLPTTSNPYGV 180

Query: 181 QYNVLAPDTLQMYSMGQVPSNMGAYIPYQTAQQYQSVPWVIQYDPYSTGXXXXXXXNASI 240
           QYNVLAPDTLQMYSMGQVPSNMGAYIPYQTAQQYQSVPWVIQYDPYSTG       NASI
Sbjct: 181 QYNVLAPDTLQMYSMGQVPSNMGAYIPYQTAQQYQSVPWVIQYDPYSTGPPPPPPPNASI 240

Query: 241 TNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNILPQPVYSQTIKSSLKNSFNGDTNNATT 300
           TN                             NILPQPVYSQTIKSSLKNSFNGDTNNATT
Sbjct: 241 TNSPPYQQSYPSQQPQQSQPQQYQRPVSVSPNILPQPVYSQTIKSSLKNSFNGDTNNATT 300

Query: 301 TTSISQPFKRSDAMASIGTXXXXXXXXXXXSRDKNLXXXXXXXXXXXXXXXXXXXXXXXX 360
           TTSISQPFKRSDAMASIGT           SRDKNL                        
Sbjct: 301 TTSISQPFKRSDAMASIGTNIQQNNNNINNSRDKNLPPISSITTTVPTTASTTTATTPPS 360

Query: 361 XIREPHSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW 420
            IREPHSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW
Sbjct: 361 VIREPHSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW 420

Query: 421 CLSRHKRRDNLLQHMKLKHSKNLINELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQ 480
           CLSRHKRRDNLLQHMKLKHSKNLINELKFRNVIFDW                  GGMPPQ
Sbjct: 421 CLSRHKRRDNLLQHMKLKHSKNLINELKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQ 480

Query: 481 IHGANEPFNINSEFTIRTLVTNGVVNKEDVKRVLNQLVDENENEP 525
           IHGANEPFNINSEFTIRTLVTNGVVNKEDVKRVLNQLVDENENEP
Sbjct: 481 IHGANEPFNINSEFTIRTLVTNGVVNKEDVKRVLNQLVDENENEP 525

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  163 bits (413), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 379 GTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           G FD E+  Y C IC K FKRRSWLKRHLLSHSSERHY CPWCLSRHKRRDNLLQHMKLK
Sbjct: 391 GEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLK 450

Query: 439 HSKNLINELKFRNVIFDWXXXXXXX--XXXXXXXXXXXGGMPPQIHG----ANEPFNINS 492
           H  NLINELK RN I                        GM   + G    A       +
Sbjct: 451 HPNNLINELKLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYET 510

Query: 493 EFTIRTLVTNGVVNKEDVKRVLNQLVDENEN 523
             TI+ L++ G++NKEDVKR+LN L+DE  N
Sbjct: 511 GITIKDLISEGLINKEDVKRLLNILIDEYNN 541

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  150 bits (379), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 69/136 (50%), Positives = 90/136 (66%), Gaps = 16/136 (11%)

Query: 385 NAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLI 444
           N ++ CH+C K+FKRRSWLKRHLLSHS+ERHY CPWCLSRHKR+DNLLQHMKLKHS  L+
Sbjct: 433 NFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLL 492

Query: 445 NELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNGV 504
           +ELK  NV F+W                    MP  + G         + +I+ L+  G+
Sbjct: 493 DELKNANVSFNWGTYDGQNSTDS---------MPKTLSGY-------PDSSIKKLLYRGI 536

Query: 505 VNKEDVKRVLNQLVDE 520
           +NK+DVKRVLN++++ 
Sbjct: 537 LNKDDVKRVLNKIIER 552

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  137 bits (346), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 85/132 (64%), Gaps = 25/132 (18%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ CH+C K+F+R+SWLKRHLLSHS+ER + CPWCLSRHKR+DNLLQHMKLKHS  L+ E
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411

Query: 447 LKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNGVVN 506
           LK  N +F                          ++G N    +N    IR L++ GV+N
Sbjct: 412 LKKNNAVFSC------------------------VNGGNRE-KLNDTDDIRNLISLGVIN 446

Query: 507 KEDVKRVLNQLV 518
           K+DVK+V+N+L+
Sbjct: 447 KDDVKKVINKLI 458

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  132 bits (332), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 83/132 (62%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ C  C K+FKR+SWLKRHLLSHS +RH+ CPWCLSR KR+DNLLQHMKLKH+  L++E
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 396

Query: 447 LKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNGVVN 506
           LK  N+IF++                   G              + +  I+TL+ +GV+N
Sbjct: 397 LKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLN 456

Query: 507 KEDVKRVLNQLV 518
           K+DVKRVLN L+
Sbjct: 457 KDDVKRVLNNLI 468

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  131 bits (330), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 84/135 (62%), Gaps = 24/135 (17%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           +N  ++CHIC K FKR+SWL+RHLLSHSSER++ CPWCLS+HKR+DNLLQHMKLKH++N+
Sbjct: 473 KNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENV 532

Query: 444 INELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNG 503
           + +L+                              P + G       N +  IRTL+  G
Sbjct: 533 LEQLRIN-----------------LKANNPNDNSEPTLEG-------NGDHNIRTLMGEG 568

Query: 504 VVNKEDVKRVLNQLV 518
           ++NK++VK++LN LV
Sbjct: 569 ILNKDEVKKLLNSLV 583

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  125 bits (314), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 82/132 (62%), Gaps = 33/132 (25%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           ++C +C K+FKR+SWL+RHLLSHS ERH+ CPWCLS+HKR+DNLLQHMKLKH++ ++ +L
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251

Query: 448 KFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNGVVNK 507
           + +NV  D                              E  N N    IRTL+  G +NK
Sbjct: 252 RNQNVGID-----------------------------GEVRNDN----IRTLLCEGRLNK 278

Query: 508 EDVKRVLNQLVD 519
           EDVK+VLN L+D
Sbjct: 279 EDVKKVLNGLID 290

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  128 bits (322), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 84/142 (59%), Gaps = 11/142 (7%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ C  C K+FKR+SWLKRHLLSHS +RH+ CPWCLSR KR+DNLLQHMKLKH+  L++E
Sbjct: 345 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 404

Query: 447 LKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGA----------NEPFNINSEFTI 496
           LK  N+IF++                                      NE  N   +  I
Sbjct: 405 LKKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGN-GYDTNI 463

Query: 497 RTLVTNGVVNKEDVKRVLNQLV 518
           +TL+ +GV+NK+DVKRVLN L+
Sbjct: 464 KTLINDGVLNKDDVKRVLNNLI 485

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 82/131 (62%), Gaps = 21/131 (16%)

Query: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINELKF 449
           CH+C K FKR+SWLKRHLLSHS +RH+ CPWC SRHKRRDNLLQHMKLKH  NL+ E+  
Sbjct: 536 CHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEINS 595

Query: 450 RNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNGVVNKED 509
           RN+ F+W                    +  QI G  E  +       +TL+  G++NK++
Sbjct: 596 RNMRFNWPILER---------------LSKQIDGTIEYPD------TKTLIHEGLLNKDE 634

Query: 510 VKRVLNQLVDE 520
           +K +LN ++D+
Sbjct: 635 LKNILNTVIDK 645

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  127 bits (318), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 87/144 (60%), Gaps = 12/144 (8%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ C  C K+FKR+SWLKRHLLSHS +RH+ CPWCLSR KR+DNLLQHMKLKH+  L++E
Sbjct: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386

Query: 447 LKFRNVIFDWXX---------XXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINS---EF 494
           LK  N+IF++                           GG       A  P N +    + 
Sbjct: 387 LKKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYDP 446

Query: 495 TIRTLVTNGVVNKEDVKRVLNQLV 518
            I+TL+ +GV+NK+DVKRVLN L+
Sbjct: 447 NIKTLINDGVLNKDDVKRVLNNLI 470

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  121 bits (304), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (59%), Gaps = 32/142 (22%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441
           +++  V+ CH+C+K+FKR+SWL+RHLLSHS  RH+ CPWCLS+HKR+DNLLQHMKLKH+ 
Sbjct: 128 EAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187

Query: 442 NLINELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVT 501
            ++ EL+  NV                              G+        +  IRTL+ 
Sbjct: 188 YVLQELRLNNVYVS-------------------------TEGS-------CKNNIRTLLY 215

Query: 502 NGVVNKEDVKRVLNQLVDENEN 523
            G +NK++VK+VLN L+D + N
Sbjct: 216 EGRLNKDEVKKVLNSLIDRHNN 237

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  125 bits (315), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 60/137 (43%), Positives = 85/137 (62%), Gaps = 6/137 (4%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           V+ C  C K+FKR SWLKRHLL+HS ERHY CPWCLS+HKR+DNLLQH+KLKH++ ++ +
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 447 LKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINS----EFTIRTLVTN 502
           L+  N+  +                     +     G N+  +I +       I+TL+ +
Sbjct: 619 LRLENI--EISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYD 676

Query: 503 GVVNKEDVKRVLNQLVD 519
           G +NKEDVK+VLN+L+D
Sbjct: 677 GRLNKEDVKKVLNKLLD 693

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  124 bits (310), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 23/139 (16%)

Query: 386 AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLIN 445
           +VY CH+C K+F+R SWLKRHLL+HSS+RHY CP C+S+HKR+DNLLQH+KLKH+  ++ 
Sbjct: 385 SVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLE 444

Query: 446 ELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNGVV 505
           +L+  N+                                 E     S   I+TL+  G +
Sbjct: 445 QLRQDNIDIKTAKDE-----------------------GEEDQGTASNTNIKTLLVEGRL 481

Query: 506 NKEDVKRVLNQLVDENENE 524
           NKEDVK+VLN+L+D    E
Sbjct: 482 NKEDVKKVLNRLIDSANQE 500

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  120 bits (300), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 90/151 (59%), Gaps = 12/151 (7%)

Query: 372 VTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNL 431
           V P   +   D EN  + CH+C K+FKR+SWLKRHLLSHSS + + CPWC SRHKR+DNL
Sbjct: 243 VQPHQGQNPADPENP-HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNL 301

Query: 432 LQHMKLKHSKNLINELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPP--QIHGANEPFN 489
           LQHMKLKH+  ++ EL+   V                       G+P    +HG     +
Sbjct: 302 LQHMKLKHTPQVLQELQSAGV----HPIVSNITLINLASTAGQNGVPSLVPVHG-----D 352

Query: 490 INSEFTIRTLVTNGVVNKEDVKRVLNQLVDE 520
           ++   +I+T++ +G +NK+DVKRVLN L++ 
Sbjct: 353 MSMMTSIKTMIDDGTLNKDDVKRVLNMLINR 383

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  114 bits (285), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 29/138 (21%)

Query: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           +E A + C  C K FKR+SWLKRH+LSHS ER Y CPWC+SRHKR+DNLLQHMKLKH+  
Sbjct: 108 NEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDE 167

Query: 443 LINELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTN 502
           ++ +LK                            M   + G +    +N +  IRT++  
Sbjct: 168 VLKKLK----------------------------MTCYLEGDDGEEMMNRD-NIRTMLYE 198

Query: 503 GVVNKEDVKRVLNQLVDE 520
           G+++K++VK+VLN+L++E
Sbjct: 199 GLLDKDEVKKVLNELLEE 216

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  115 bits (287), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 57/68 (83%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ C  C K+FKR+SWLKRHLLSHS +RH+ CPWCLSR KR+DNLLQHMKLKH+  L++E
Sbjct: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385

Query: 447 LKFRNVIF 454
           LK  N+IF
Sbjct: 386 LKKNNIIF 393

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  113 bits (283), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 78/135 (57%), Gaps = 6/135 (4%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ C++C K FKR+SWLKRHLLSHSS R Y CPWCLS+HKR+DNLLQHMKLKH + ++ E
Sbjct: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312

Query: 447 L-KFRNVIFDWXXXXXXXXXXXXXXXXXXG-GMPPQIHGANEPFNINSEFTIRTLVTNGV 504
           + K      +                      M     G++     N   +I  +V NG 
Sbjct: 313 MDKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSS----NDNVSIIAMVDNGT 368

Query: 505 VNKEDVKRVLNQLVD 519
           + KE+VK+VLN +++
Sbjct: 369 LKKENVKKVLNSIIE 383

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 82/156 (52%), Gaps = 33/156 (21%)

Query: 378 RGTFDSENA----VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQ 433
           RG+FD   +    +Y C +C K+FKR+SW +RHLLSHSS + Y CPWC SRHKRRDNL Q
Sbjct: 374 RGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQ 433

Query: 434 HMKLKHSKNLINELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSE 493
           HMK KH   ++ EL     +                     G M     G N    I+  
Sbjct: 434 HMKTKHVHQVLQELMEAGDL--------------------DGSM-----GTNVRLAIDDM 468

Query: 494 F---TIRTLVTNGVVNKEDVKRVLNQLVDE-NENEP 525
               +IRTLV +G V KE VK VLN ++   ++ EP
Sbjct: 469 VAGPSIRTLVQDGRVKKERVKTVLNAVIARVHDGEP 504

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  108 bits (271), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 75/141 (53%), Gaps = 28/141 (19%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
            Y C +C K+FKRRSW KRHLLSHSS + Y CPWC SRHKRRDNL QHMK KH ++++ E
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447

Query: 447 LKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQI---HGANEPFNINSEFTIRTLVTNG 503
           L     +                      GM  Q+     A EP       +I+TL+ +G
Sbjct: 448 LLEVGDV----------------DGSVMSGM--QVTSDESAPEP-------SIKTLIQDG 482

Query: 504 VVNKEDVKRVLNQLVDENENE 524
            V KE VK VLN ++     E
Sbjct: 483 QVKKERVKAVLNAVIARVNGE 503

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  106 bits (265), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 74/132 (56%), Gaps = 10/132 (7%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           Y CH+C K F+R+SWLKRHLLSHS+ + + CPWC S HKR+DNLLQH+KLKH++ L++E 
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365

Query: 448 KFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNINSEFTIRTLVTNGVVNK 507
               ++ +                     +       NEP       TIR ++ +  + K
Sbjct: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLI-----NNEP-----STTIRDMLDSNALPK 415

Query: 508 EDVKRVLNQLVD 519
           + VKR LN +VD
Sbjct: 416 DQVKRCLNYIVD 427

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  101 bits (251), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 76/137 (55%), Gaps = 2/137 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ CH C K FKR+SWLKRHLLSHS+ + Y CPWC SRHKR+DNL QH+KLKH++ L+  
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344

Query: 447 LKFR-NVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGANEPFNIN-SEFTIRTLVTNGV 504
           L    N                             +  ++       + F+I+ ++ +G+
Sbjct: 345 LSSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGPTTFSIKDMIDSGM 404

Query: 505 VNKEDVKRVLNQLVDEN 521
           ++K +VK+ LN L++ +
Sbjct: 405 LSKNEVKKTLNSLINSD 421

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 77/140 (55%), Gaps = 27/140 (19%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           ++ CH C K FKR+SWLKRHLLSHS+ + Y CPWC SRHKR+DNL QH+KLKH++ L+  
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 243

Query: 447 LKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIHGAN-------EPFNINSEFTIRTL 499
           L                             +  ++H ++             + F+I+ +
Sbjct: 244 LS--------------------SNPNTPTSLINRLHSSDAAAGSAAAAAGTPAAFSIKDM 283

Query: 500 VTNGVVNKEDVKRVLNQLVD 519
           + +G+++K +VK+ LN L++
Sbjct: 284 IDSGMLSKNEVKKTLNSLIN 303

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  100 bits (249), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 58/73 (79%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           ++ ++ CH+C K+FKR+SWLKRHLLSHS +R++ CP CLS+HKR+DNL+QH+KLKH   +
Sbjct: 336 QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYI 395

Query: 444 INELKFRNVIFDW 456
           + +L   ++I  +
Sbjct: 396 LKKLNKDDLIIKY 408

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 89.7 bits (221), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 53/67 (79%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441
           D   +VY C++C+K F+R +WL+RH LSH+++R++ CPWC S+HKRRDNL +H+KLKH +
Sbjct: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHME 172

Query: 442 NLINELK 448
            L+  ++
Sbjct: 173 LLMKAIR 179

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 74/161 (45%), Gaps = 41/161 (25%)

Query: 363 REPHSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCL 422
           R+  +  +  TP PP  T       Y C  C K+F+R +WLKRH ++H++   + C WC 
Sbjct: 231 RKASARGKGRTPKPPTMT------SYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCK 284

Query: 423 SRHKRRDNLLQHMKLKHSKNLINELKFRNVIFDWXXXXXXXXXXXXXXXXXXGGMPPQIH 482
           S HKRRDN+ +HMKLKH   L+       VI ++                          
Sbjct: 285 SEHKRRDNMFKHMKLKHMNLLM------KVIRNYY------------------------- 313

Query: 483 GANEPFNINSEFTIRTLVTNGVVNKEDVKRVLNQLVDENEN 523
               P        ++ L+ +G ++KEDVKRVL  +V+   +
Sbjct: 314 ----PLAEFEGKDLKGLLADGRLHKEDVKRVLVDIVNPTRD 350

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 38/53 (71%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKH 439
            Y C +C K FKR SWLKRH  SHS  +++ C WC  ++KR+DNL+QH++ KH
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           F  EN  + C  C K F+R   LKRH+ S HSSER + CP C  +  R DNL QH+K
Sbjct: 758 FSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 5/66 (7%)

Query: 372 VTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDN 430
           VTP    G+ D +N  + C  C K F+R   LKRH+ S HSSER + C +C  +  R DN
Sbjct: 661 VTP----GSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDN 716

Query: 431 LLQHMK 436
           L QH+K
Sbjct: 717 LSQHLK 722

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           E   + CHICSK+FKR   LKRH+ S HS+ER + C  C  +  R DNL QH+K
Sbjct: 648 EEKPFHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 378 RGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
             T D E   + CHIC K+FKR   LKRH+ S HS+ER + C  C  +  R DNL QH+K
Sbjct: 637 ESTNDLEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 368 NQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHK 426
           N R +TP       D +   + C  CSK F+R   LKRH+ S HSSER + C +C  +  
Sbjct: 510 NSRSITP---MNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFS 566

Query: 427 RRDNLLQHMK 436
           R DNL QH+K
Sbjct: 567 RSDNLSQHLK 576

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 363 REPHSNQRFVTPSPP-----RGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHY 416
           R P   ++ +TPS         T + E   + CHIC K+FKR   LKRH+ S HS+ER +
Sbjct: 617 RRPSYRRKSMTPSRRSSVVIESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPF 676

Query: 417 FCPWCLSRHKRRDNLLQHMK 436
            C  C  +  R DNL QH+K
Sbjct: 677 ACHICDKKFSRSDNLSQHIK 696

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           +D +N  + C  C K F+R   LKRH  S HS+ER + C +C  R  R DNL QH+K
Sbjct: 908 YDDQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLK 964

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 363 REPHSNQRFVTPSPP-----RGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHY 416
           R P   ++ +TPS         T + E   + CHIC K+FKR   LKRH+ S HS+ER +
Sbjct: 616 RRPSYRRKSMTPSRRSSVVMESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPF 675

Query: 417 FCPWCLSRHKRRDNLLQHMK 436
            C  C  +  R DNL QH+K
Sbjct: 676 ACHICEKKFSRSDNLSQHIK 695

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLKH 439
            D E   + C  C+K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K   
Sbjct: 614 MDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHK 673

Query: 440 SKNLINEL 447
               I EL
Sbjct: 674 KHGDITEL 681

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 385 NAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           N  + C  C KNF+R   LKRH+ S HS ER + C  CL +  R DNL QH+K
Sbjct: 686 NKPFKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 37/71 (52%), Gaps = 8/71 (11%)

Query: 376 PPRGTFDSENAV-------YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKR 427
           PP+  F  E  V       YIC IC + F     L RH  S HS E+ + CP C  R KR
Sbjct: 762 PPQSKFSEEEVVVSKNGKVYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKR 821

Query: 428 RDNLLQHMKLK 438
           RD++LQH+  K
Sbjct: 822 RDHVLQHLNKK 832

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           +++C IC++ F R+  L RH  SH+ E+ YFC  C  R  RRD LL+H    H  N    
Sbjct: 58  LFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHKLHGGNCGET 117

Query: 447 LK 448
           +K
Sbjct: 118 IK 119

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 377 PRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHM 435
           P    D E+  + C  C K F+R   LKRH+ S HSSER + C +C  +  R DNL QH+
Sbjct: 579 PVNLADDESKPFKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHL 638

Query: 436 K 436
           K
Sbjct: 639 K 639

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 376 PPRGT-----FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRD 429
           PPR +      + E   + C  C+K F+R   LKRH+ S HSSER + C +C  +  R D
Sbjct: 624 PPRNSKSSSPVEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSD 683

Query: 430 NLLQHMK 436
           NL QH+K
Sbjct: 684 NLSQHLK 690

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + CH+CSK FKR   LKRH+ S HS++R + C  C  +  R DNL QH+K
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + E   + C  C+K F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 436 EEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 491

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 363 REPHSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWC 421
           REP S+ +    +P       +N +Y+C  C + F     L RH  S HS E+ + CP C
Sbjct: 685 REPCSSPQTSKFAPEEIVLSGKNKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKC 744

Query: 422 LSRHKRRDNLLQHMKLK 438
             R KRRD++LQH+  K
Sbjct: 745 GKRFKRRDHVLQHLNKK 761

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           +  EN  + C  C+K+F+R   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 705 YGDENKPFQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 12/78 (15%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS------- 440
           ++CHIC++ F R+  LKRH  +H++E+ + C +C     RRD +L+H    HS       
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKES 120

Query: 441 -----KNLINELKFRNVI 453
                KN I+ +  +N+I
Sbjct: 121 VDSRDKNEIDAMNDKNII 138

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 383 SENA-VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           SEN  VYIC  C + F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 771 SENGKVYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C+ C K FKR   LKRH+ S HS+ER Y C +C     R DNL QH+K
Sbjct: 308 FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           YIC  C++ F R+  LKRH  SH++E+ + C +C     RRD +L+H +  HS  + N+
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLMTND 163

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 6/72 (8%)

Query: 367 SNQRFVTP-SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSR 424
           S  R +TP S P    D E   + C  C+K F+R   LKRH+ S HS+ER + C +C  +
Sbjct: 362 SKSRSITPMSGP----DEEVKPFKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKK 417

Query: 425 HKRRDNLLQHMK 436
             R DNL QH+K
Sbjct: 418 FSRSDNLSQHLK 429

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 383 SENA-VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           SEN  VYIC  C + F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 681 SENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
            + E   + C  C+K F+R   LKRH+ S HSS+R + C +C  +  R DNL QH+K
Sbjct: 497 LEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
            D E   + C  C+K F+R   LKRH+ S HS++R + C +C  +  R DNL QH+K
Sbjct: 691 LDEEEKPFKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 366 HSNQRFVTPSPPRG-----TFD----SENAVYICHICSKNFKRRSWLKRHLLS-HSSERH 415
           HSN     P  PR      T D     +N  + C  C K F+R   LKRH+ S HS+ER 
Sbjct: 540 HSNSSGKVPIQPRKRKSITTIDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERP 599

Query: 416 YFCPWCLSRHKRRDNLLQHMK 436
           + C +C  +  R DNL QH+K
Sbjct: 600 FACMFCEKKFSRSDNLSQHLK 620

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           +N  + C  C K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 569 KNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           +N  + C  C K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 580 KNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 633

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 383 SENA-VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           SEN  +Y+C  C + F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 853 SENGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           +++CH C++ F R+  L RH  SH++E+ Y C  C  R  RRD LL+H    H  +  + 
Sbjct: 48  LFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGGSCGDA 107

Query: 447 L 447
           L
Sbjct: 108 L 108

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           + C  C + FKR+  LKRH+LS H  E+ + CP C     R DNL QH+K   ++N
Sbjct: 400 FGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIKTHSNEN 455

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           +++C +CS+ F R+  L RH  SH++E+ Y C  C  +  RRD LL+H +  H+ N
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVHNGN 132

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQ 433
           +P       +N +YIC  C + F     L RH  S HS E+ + CP C  R KRRD++LQ
Sbjct: 696 APEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 755

Query: 434 HMKLK 438
           H+  K
Sbjct: 756 HLNKK 760

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           +N  + C  C K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 578 KNKPFNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLK 631

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C+K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 620 FKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLK 669

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++CHIC++ F R+  LKRH  +H++E+ + C +C     RRD +L+H    HS
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHS 113

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           ++C +C++ F R+  LKRH  SH++E+ + C +C     RRD +L+H    HS  +  EL
Sbjct: 52  FVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTEL 111

Query: 448 KFRNV 452
              NV
Sbjct: 112 HHENV 116

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++CHIC++ F R+  LKRH  +H++E+ + C +C     RRD +L+H    HS
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHS 113

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++CHIC++ F R+  LKRH  +H++E+ + C +C     RRD +L+H    HS
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHS 113

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLIN 445
           +++C IC++ F R+  L RH  SH+ E+ Y C  C  +  RRD L++H +  H+ N+++
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVVD 173

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 383 SENA-VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           SEN  VYIC  C + F     L RH  S HS E+ Y CP C  + KRRD++LQH+  K
Sbjct: 750 SENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 372 VTPS-PPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDN 430
           VTPS  PR        +++C +C++ F R+  L RH  SH+ E+ Y C  C  R  RRD 
Sbjct: 116 VTPSGKPR--------LFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDL 167

Query: 431 LLQHMKLKHSKN 442
           L++H +  H  N
Sbjct: 168 LIRHCQKLHGGN 179

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 377 PRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHM 435
           P   FD +  ++ C +C + FKR+  LKRH+ S H  ER Y C  CL    R DNL QH 
Sbjct: 208 PSLLFD-DAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHK 266

Query: 436 K 436
           +
Sbjct: 267 R 267

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C+K F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K
Sbjct: 437 FKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLK 486

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           ++C +C++ F R+  LKRH  SH++E+ Y C  C     RRD L++H +  HS NL
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           ++C +C++ F R+  LKRH  SH++E+ Y C  C     RRD L++H +  HS NL
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           ++C +C++ F R+  LKRH  SH++E+ Y C  C     RRD L++H +  HS NL
Sbjct: 110 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 165

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           VY+C  C + F     L RH  S HS E+ Y CP C  R KRRD++LQH+  K
Sbjct: 759 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           ++C +C++ F R+  LKRH  SH++E+ Y C  C     RRD L++H +  HS NL
Sbjct: 104 FVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 383 SENA-VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           SEN  VY+C  C + F     L RH  S HS E+ Y CP C  + KRRD++LQH+  K
Sbjct: 782 SENGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 38/72 (52%), Gaps = 9/72 (12%)

Query: 372 VTPS-PPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDN 430
           VTPS  PR        +++C IC++ F R+  L RH  SH+ E+ Y C  C  +  RRD 
Sbjct: 109 VTPSGKPR--------LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDL 160

Query: 431 LLQHMKLKHSKN 442
           LL+H    H  N
Sbjct: 161 LLRHAHKIHGGN 172

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQ 433
           +P       +N +Y+C  C + F     L RH  S HS E+ + CP C  R KRRD++LQ
Sbjct: 703 APEEIVLSGKNKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 762

Query: 434 HMKLK 438
           H+  K
Sbjct: 763 HLNKK 767

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           E+  + C  C K FKR   LKRH+ S HS++R + C  C  +  R DNL QH+K
Sbjct: 559 EDKPFKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLK 612

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           Y CH+C K FKR   LKRH  + H   R + C  C  R  R DNL QH+++   + ++  
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEP 282

Query: 447 LKFRNVI 453
           ++ R+ +
Sbjct: 283 IRKRSSV 289

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 362 IREPHSNQR---FVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYF 417
           I + H N+R     T +   G  +  +  + C  C K FKR   LKRH  S HS+ER + 
Sbjct: 284 IVDIHKNRRQSTIGTSTSDIGNDEDLDKQFKCSECEKGFKRSEHLKRHFRSVHSNERPFP 343

Query: 418 CPWCLSRHKRRDNLLQHMK 436
           C  C  +  R DNL QH+K
Sbjct: 344 CMLCEKKFSRSDNLSQHLK 362

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQ 433
           +P       +N +Y+C  C + F     L RH  S HS E+ + CP C  R KRRD++LQ
Sbjct: 698 APEEIVLSGKNKIYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQ 757

Query: 434 HMKLK 438
           H+  K
Sbjct: 758 HLNKK 762

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 376  PPRGTFD----SENA-VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRD 429
            PP+ T D    SEN  +Y+C  C + F     L RH  S HS E+ + CP C  + KRRD
Sbjct: 981  PPKFTEDEIIMSENGKIYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 1040

Query: 430  NLLQHMKLK 438
            ++LQH+  K
Sbjct: 1041 HVLQHLNKK 1049

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C K F+R   LKRH+ S HSSER + C +C  R  R DNL QH+K
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLK 515

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C IC++ F R+  LKRH  +H+SE+ + C +C     RRD +L+H    HS
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHS 106

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQ 433
           S P    D     + C  C K FKR   LKRH+ S HS ER Y C  C  +  R DNL Q
Sbjct: 590 SDPSTAEDDMEKPFHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQ 649

Query: 434 HMK 436
           H+K
Sbjct: 650 HLK 652

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           ++C  C++ F R+  LKRH  SH++E+ + C +C     RRD +L+H    H+  + NEL
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNEL 131

Query: 448 K 448
           +
Sbjct: 132 Q 132

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
            D     + C  C K F+R   LKRH+ S HS+ER + C  C  +  R DNL QH+K
Sbjct: 379 IDENEKPFKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 374 PSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLL 432
           PSP    F+  + ++IC  C++ FKR+  LKRH  S H  E+ + C  C  +  R DNL 
Sbjct: 624 PSP----FNDPSKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLA 679

Query: 433 QHMK 436
           QH+K
Sbjct: 680 QHIK 683

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           +++C  C++ F R+  L RH  SH+ E+ Y C  C  R  RRD LL+H    H  N
Sbjct: 29  LFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVHGGN 84

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
            D  + VY+C  C++ F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
            + C+ C K F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 461 TFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLK 511

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C IC++ F R+  LKRH  +H++E+ + C +C     RRD +L+H +  HS
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 130

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           +++C +C++ F R+  L RH  SH+ E+ Y C  C  +  RRD LL+H    H  N
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGN 140

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +YIC  C++ F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C IC++ F R+  LKRH  +H++E+ + C +C     RRD +L+H +  HS
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 84

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +YIC  C++ F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKH 439
           +++C IC++ F R+  L RH  SH+ E+ Y C  C  +  RRD LL+H +  H
Sbjct: 43  LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           ++C IC++ F R+  LKRH  SH++E+ + C +C     RRD +L+H    H+  L+++ 
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAA-LVSKT 133

Query: 448 KFRNVIFDW 456
              +V+ D+
Sbjct: 134 LEEDVMMDF 142

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +YIC  C++ F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C IC++ F R+  LKRH  SH++E+ + C +C     RRD +L+H +  H+
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHA 125

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 12/72 (16%)

Query: 380 TFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRH------------KR 427
           T D +   ++CH C   F+ R +L RH+  H+ E+ Y CP+   +              R
Sbjct: 190 TLDDDEKEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSR 249

Query: 428 RDNLLQHMKLKH 439
           RD    HMK +H
Sbjct: 250 RDTYKTHMKARH 261

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +YIC  C++ F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 849 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +Y+C  C + F     L RH  S HS E+ + CP C  R KRRD++LQH+  K
Sbjct: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSKNLINEL 447
           CHIC K+  R S L+ H+L H+ +R + C W  C  R   + N+ +H KL   K L NE+
Sbjct: 493 CHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQLANEV 552

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 362 IREPHSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPW 420
           IR P  + +    +P       +  VY+C  C + F     L RH  S HS E+ + CP 
Sbjct: 692 IRTPKRSPQPSKLTPEEIILSEKGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK 751

Query: 421 CLSRHKRRDNLLQHMKLK 438
           C  + KRRD++LQH+  K
Sbjct: 752 CGKKFKRRDHVLQHLNKK 769

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 377 PRGTFDSENAV-----YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRD 429
           PR T   E  +     YIC IC++ F     L RH   H+ E+++ CP+  C  R  R D
Sbjct: 158 PRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 217

Query: 430 NLLQHMK 436
           N LQH +
Sbjct: 218 NCLQHYR 224

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMK 436
           YIC +CSK       L RH   H+ E+++FCP+  C  R  R DN +QH +
Sbjct: 301 YICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGCNQRFSRHDNCIQHYR 351

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 377 PRGTFDSENAV-----YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRD 429
           PR T   E  +     YIC IC++ F     L RH   H+ E+++ CP+  C  R  R D
Sbjct: 158 PRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 217

Query: 430 NLLQHMK 436
           N LQH +
Sbjct: 218 NCLQHYR 224

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 372 VTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNL 431
           +TPS  + TF       +C +C K F R+  L RHL SH++E+ + C  C     RRD L
Sbjct: 40  LTPSGNKRTF-------LCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLL 92

Query: 432 LQHMKLKHSKNLI 444
           ++H    HS   I
Sbjct: 93  IRHSNKLHSDTAI 105

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQH 434
           ++C IC++ F R+  LKRH +SH++E+ + C +C     R+D +L+H
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 14/77 (18%)

Query: 377 PRGTFD--SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-- 425
           P+GT D  SE   Y+CH C   F+ R +L RH+  H+  + Y CP+        L  H  
Sbjct: 192 PQGTADESSETLPYVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTS 251

Query: 426 ---KRRDNLLQHMKLKH 439
               RRD    H+K +H
Sbjct: 252 GGFSRRDTYKTHLKSRH 268

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           +++C +C++ F R   L RH   H+ E+ Y C  C  ++ RRD LL+H+   H  N
Sbjct: 52  LFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMHGGN 107

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKH 439
           Y+C IC++ F R+  L+RH  +H++E+ + C +C     RRD +L+H    H
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 138

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           ++C IC++ F R+  L+RH  SH++E+ + C +C     RRD +L+H +  H+ +L+++ 
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHA-SLMDQD 141

Query: 448 KFRNVI 453
           K  +++
Sbjct: 142 KDADIV 147

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           ++C +C++ F R   L+RH  SH++E+ Y C  C     RRD LL+H    H+ N  N +
Sbjct: 75  FVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTHNGNCGNTI 134

Query: 448 KFR 450
             R
Sbjct: 135 VKR 137

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKH 439
           Y+C IC++ F R+  LKRH  SH++E+ + C +C     RRD +L+H    H
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 108

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           +++C IC++ F R+  L RH  SH+ E+ Y C  C     RRD LL+H    H  N
Sbjct: 58  LFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVHGGN 113

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKN 442
           ++C ICS+ F+R+  +KRH+ + H  ER Y C  C     R DNL QH++  H++N
Sbjct: 413 FLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLR-THTRN 467

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C +C++ F R+  LKRH  SH++E+ + C +C     RRD +L+H +  H+
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHA 132

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 31/47 (65%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQH 434
           ++C IC++ F R   LKRH +SH++E+ + C +C     R+D +L+H
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 82

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%)

Query: 368 NQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKR 427
           +Q  + P   R     +   ++C ICS+ F R+  LKRH  SH+ E+ + C  C     R
Sbjct: 7   DQHCLIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFAR 66

Query: 428 RDNLLQHMKLKH 439
           +D +L+H++  H
Sbjct: 67  KDLVLRHLQKLH 78

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 18/82 (21%)

Query: 376 PPRGTFDSENAV------YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------L 422
           P R   D++ AV      YICH C   FK R +L RH+  H+ ++ Y CP+        L
Sbjct: 181 PKRADEDAKPAVASDVGTYICHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTEL 240

Query: 423 SRH-----KRRDNLLQHMKLKH 439
             H      RRD    H+K +H
Sbjct: 241 KCHNTGGFSRRDTYKTHLKTRH 262

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 354 FGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           SE+  +IC +C K FKR S L  H+  H+ E+ Y CP+  C      + N+L+H KL
Sbjct: 168 SEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKL 224

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +  VY+C  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 735 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 377 PRGTFDSENAV-----YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRD 429
           P+ T   E  +     YIC IC++ F     L RH   H+ E+++ CP+  C  R  R D
Sbjct: 159 PKNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 218

Query: 430 NLLQHMK 436
           N LQH +
Sbjct: 219 NCLQHYR 225

>Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON}
           (33422..34600) [1179 nt, 393 aa]
          Length = 392

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSK 441
           +N  YIC IC+K F+R    KRH+ +H+ E+ + C +  C     R D L +HM +  + 
Sbjct: 23  DNRPYICEICTKGFRRLEHKKRHIRTHTGEKPHVCTFQGCPKSFSRSDELKRHMNIHSTG 82

Query: 442 NL 443
            L
Sbjct: 83  EL 84

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           +IC ICSK F+R    KRH+ +H+ E+ + C +  C+ +  R D L +H+K+
Sbjct: 13  FICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI 64

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSKNL 443
           Y+C  C+K F     L RH   H+ E+++ CP+  C  R  R+DN LQH +  H KN 
Sbjct: 185 YLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYR-THFKNF 241

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +  VY+C  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 731 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 377 PRGTFDSENAV-----YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRD 429
           PR T   E  +     YIC IC++ F     L RH   H+ E+++ CP+  C  R  R D
Sbjct: 158 PRNTLSDEEDLELRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHD 217

Query: 430 NLLQHMK 436
           N LQH +
Sbjct: 218 NCLQHYR 224

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLK- 438
           + EN  Y C ICS+ F R    KRHL +H+ E+ + C  P C     R D L +H++   
Sbjct: 14  NDENRPYKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLRTHT 73

Query: 439 --HSKNLINELK 448
              S+N+ N+ +
Sbjct: 74  GISSRNMKNQAR 85

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSE 413
           Y CH+C K F R   L +HL +H+ E
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHTHE 472

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 14/83 (16%)

Query: 370 RFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHK--- 426
           ++ + +P        N +Y+CH C  +F+ R +L RH+  HS E+ Y CP+  + H+   
Sbjct: 17  KYKSSAPLSDKTSKTNGMYVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPF-YNEHQPSE 75

Query: 427 ----------RRDNLLQHMKLKH 439
                     RRD    H+K +H
Sbjct: 76  LKCHNSGGFSRRDTYKTHLKSRH 98

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           ++C  C++ F R   LKRH  SH+ E+ Y C +C     RRD +L+H    HS  L N  
Sbjct: 45  FLCPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLHSSILNNSK 104

Query: 448 KFRNVI 453
            + +++
Sbjct: 105 TYNSLV 110

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ Y C  C     R DNL QH+K
Sbjct: 495 FACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 388 YICHICSKNFKRRSWLKRHLLSH 410
           Y CHIC+KNF R   L +H+ +H
Sbjct: 524 YACHICNKNFSRSDNLTQHIKTH 546

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKL 437
           D++   Y C +C+K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H+++
Sbjct: 19  DNDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI 76

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 340 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           VY+C  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 460 FGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 12/70 (17%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW----CLSRHK--------RRD 429
           ++++  +ICH C   F+ R +L RH+  H+ E+ Y CP+     LS  +        RRD
Sbjct: 177 ETDDGPFICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRD 236

Query: 430 NLLQHMKLKH 439
               H+K +H
Sbjct: 237 TYKTHLKARH 246

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           +++C  C + F R+  L RH  SH++E+ + C  C     RRD L++H +  H  ++
Sbjct: 151 LFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIHGGDI 207

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C  C++ F R+  LKRH  SH+ E+ Y C +C     RRD +L+H +  H+
Sbjct: 104 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 156

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C  C++ F R+  LKRH  SH++E+ + C +C     RRD +L+H    H+
Sbjct: 71  FVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHA 123

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQ 433
           SP       +   YIC  C + F     L RH  S HS E+ + CP C  + KRRD++LQ
Sbjct: 712 SPEEIIISPQGKTYICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQ 771

Query: 434 HMKLK 438
           H+  K
Sbjct: 772 HLNKK 776

>TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.586
           YHR006W
          Length = 484

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 16/91 (17%)

Query: 365 PHSNQRFVTPSP----PRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW 420
           P S+    TP+P    P+     +  V++CH C   F+ R +L RH+  H+ ++ Y CP+
Sbjct: 111 PESSTTAKTPTPDGVSPQDEVAKDKEVFVCHYCDAKFRIRGYLTRHIKKHAIQKAYHCPF 170

Query: 421 CLSR------------HKRRDNLLQHMKLKH 439
             +               RRD    H++ +H
Sbjct: 171 FSAEAPQDMRCHNSGGFSRRDTYKTHLRARH 201

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C  C++ F R+  LKRH  SH+ E+ Y C +C     RRD +L+H +  H+
Sbjct: 36  FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 88

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 346 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C  C++ F R+  LKRH  SH+ E+ Y C +C     RRD +L+H +  H+
Sbjct: 125 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 177

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +   YIC  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 748 KGKAYICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%)

Query: 389 ICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNL 443
           IC +CS+ F R   LKRH  SH+ E+ Y C +C     R+D +L+H    H + L
Sbjct: 23  ICPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLHPEVL 77

>Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR461C
          Length = 562

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 15/92 (16%)

Query: 362 IREPHSNQRFVTPSPPRGTFDSENAV--YICHICSKNFKRRSWLKRHLLSHSSERHYFCP 419
           + EP S +   + + PRG  D E     Y+CH C   F+ R +L RH+  H+ E+ Y CP
Sbjct: 136 LEEPLSPRSSSSTAVPRGE-DGEGGKEKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCP 194

Query: 420 W---C---------LSRHKRRDNLLQHMKLKH 439
           +   C              RRD    H++ +H
Sbjct: 195 FFNGCSPPETRCHTTGGFSRRDTYKTHLRSRH 226

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 514 FGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C  C++ F R+  LKRH  SH+ E+ Y C +C     RRD +L+H +  H+
Sbjct: 151 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 203

>KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {ON}
           Anc_8.234 YER169W
          Length = 900

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQ 433
           SP       +   Y+C  C + F     L RH  S HS E+ + CP C  R KRRD++LQ
Sbjct: 822 SPEEIIISEKGKTYMCQECKRKFSSGHHLTRHKKSVHSGEKPHPCPKCGKRFKRRDHVLQ 881

Query: 434 HMKLK 438
           H+  K
Sbjct: 882 HLNKK 886

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 27/56 (48%)

Query: 386 AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441
           AVY C IC K F R   LK HL SH+ ER Y C  C     R  +  +H  L   K
Sbjct: 467 AVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDLHTGK 522

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 9/66 (13%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--------PW-CLSRHKRRDNLLQHMKLK 438
           Y+C +C K F R     RH   H+ +R Y C         W C  +  R D L +H K +
Sbjct: 497 YVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKTE 556

Query: 439 HSKNLI 444
             K  I
Sbjct: 557 LGKKCI 562

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHS 440
           +E   YIC ICS+ F     L RH   H+ E+ + C  P C  R  R DN +QH +  H 
Sbjct: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT-HF 337

Query: 441 KN 442
           KN
Sbjct: 338 KN 339

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMK 436
           Y+C +C K F     L RH   H+ E+ + CP+  C  R  R DN LQH K
Sbjct: 402 YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYK 452

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 390 CHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           C  C + FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHS 411
           Y CHIC+K F R   L +H+ +HS
Sbjct: 293 YECHICNKKFSRSDNLNQHIKTHS 316

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKL 437
           Y+C ICS+ F R     RH+ +H+ E+ + C  P C  R  R D L +H ++
Sbjct: 34  YVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRI 85

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438
           +   Y+C  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 728 KGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783

>Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)
          Length = 542

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 14/76 (18%)

Query: 378 RGTFD--SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH--- 425
           +GT D  SE   YICH C   F+ R +L RH+  H+  + Y CP+        L  H   
Sbjct: 192 QGTADESSEALSYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSG 251

Query: 426 --KRRDNLLQHMKLKH 439
              RRD    H+K +H
Sbjct: 252 GFSRRDTYKTHLKSRH 267

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKL 437
           YIC ICS+ F R     RH+ +H+ E+ + C  P C  +  R D L +H ++
Sbjct: 26  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRI 77

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
            D+EN  + C  C++ F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 10  VDNENRPFRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMR 67

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 12/68 (17%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRRDNL 431
           E   ++CH C   F+ R +L RH+  H+ E+ Y CP+        L  H      RRD  
Sbjct: 269 EEGTFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRDTY 328

Query: 432 LQHMKLKH 439
             H+K +H
Sbjct: 329 KTHLKARH 336

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCP--WCLSRHKRRDNLLQHMKLKHSKNLIN 445
           Y+C IC K F     L RH   H+ E+++ CP   C  R  R DN +QH K    +N  +
Sbjct: 201 YVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLRRNTWH 260

Query: 446 E 446
           E
Sbjct: 261 E 261

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 12/71 (16%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRR 428
            D+    +ICH C   F+ R +L RH+  H+ E+ Y CP+        L  H      RR
Sbjct: 153 LDNGEEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRR 212

Query: 429 DNLLQHMKLKH 439
           D    H+K +H
Sbjct: 213 DTYKTHLKARH 223

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRRDNL 431
           E   ++CH C   FK R +L RH+  H+ ++ Y+CP+        L  H      RRD  
Sbjct: 37  EQEEFVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTY 96

Query: 432 LQHMKLKH 439
             HMK +H
Sbjct: 97  KAHMKTRH 104

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKH 439
           +N  Y C IC K F+R S LK H+  H+  + Y CP+  C      + N+L+H KL +
Sbjct: 411 KNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLHY 468

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMK 436
           Y+C ICS+ F     L RH   H+ E+++ CP+  C  R  R DN +QH +
Sbjct: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSKNLI 444
           YIC  CSK F     L RH   H+ E+++ CP+  C  R  R+DN LQH +  H K+++
Sbjct: 172 YICKTCSKGFTTSGHLARHNRIHTGEKNHECPFEGCQQRFSRQDNCLQHYRT-HFKSIM 229

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKL 437
           ++C IC + F+R     RHL +H+ E+ + C  P C  R  R D L +H ++
Sbjct: 29  HVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI 80

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 12/69 (17%)

Query: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRRDN 430
           SE   YICH C   F+ R +L RH+  H+  + Y CP+        L  H      RRD 
Sbjct: 199 SETLPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDT 258

Query: 431 LLQHMKLKH 439
              H+K +H
Sbjct: 259 YKTHLKSRH 267

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQH 434
           ++C IC++ F R   LKRH  +H++E+ + C +C     RRD +L+H
Sbjct: 33  HLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 79

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 386 AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441
           A+Y C +C K F R   LK HL +H++ER + C  C     R+ +  +H  L   K
Sbjct: 649 AIYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDLHTGK 704

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 9/66 (13%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--------PW-CLSRHKRRDNLLQHMKLK 438
           +IC IC+K F R+   KRH   H+ ++ Y C         W C  +  R D L +H K +
Sbjct: 679 FICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTE 738

Query: 439 HSKNLI 444
             K  I
Sbjct: 739 SGKRCI 744

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 379 GTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
           G  D     ++C IC + F R     RH+ +H+ E+ + C  P C+ R  R D L +H +
Sbjct: 34  GKGDDAPRPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRR 93

Query: 437 L 437
           +
Sbjct: 94  I 94

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 12/66 (18%)

Query: 386 AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSR------------HKRRDNLLQ 433
            +++CH C   FK R +L RH+  H+ ++ Y CP+ +                RRD    
Sbjct: 202 GLFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFSRRDTYKT 261

Query: 434 HMKLKH 439
           H++ +H
Sbjct: 262 HLRTRH 267

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRRDNLLQHM 435
           +ICH C   F+ R +L RH+  H+ E+ Y CP+        L  H      RRD    H+
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 436 KLKH 439
           K +H
Sbjct: 220 KARH 223

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 387 VYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           ++ C  C + FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 302 LFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHS 411
           + CHIC K F R   L +H+ +HS
Sbjct: 332 FSCHICEKKFSRSDNLNQHIKTHS 355

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
            D+EN  + C  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 12/69 (17%)

Query: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRRDN 430
           SE   YICH C   F+ R +L RH+  H+  + Y CP+        L  H      RRD 
Sbjct: 199 SETLPYICHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDT 258

Query: 431 LLQHMKLKH 439
              H+K +H
Sbjct: 259 YKTHLKSRH 267

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           Y C  C + FKR+  LKRH+ S H   + Y C  C  +  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRRDNLLQHM 435
           +ICH C   F+ R +L RH+  H+ E+ Y CP+        L  H      RRD    H+
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 436 KLKH 439
           K +H
Sbjct: 220 KARH 223

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSR------------HKRRD 429
           + +   Y+CH C   F+ R +L RH+  H+ E+ Y CP+  S+              RRD
Sbjct: 156 EEQRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRD 215

Query: 430 NLLQHMKLKH 439
               H+K +H
Sbjct: 216 TYKTHLKSRH 225

>KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 538

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 12/73 (16%)

Query: 379 GTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW----------C--LSRHK 426
           G  D +   ++CH C+  F  R +L RH+  H+ E+ Y+CP+          C       
Sbjct: 150 GCSDKDQKRFVCHYCNAKFYIRGYLTRHIKKHAVEKAYYCPYFNADAPKDQRCHTTGGFS 209

Query: 427 RRDNLLQHMKLKH 439
           RRD    H++ +H
Sbjct: 210 RRDTYKTHLRSRH 222

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSK 441
           Y+C +C++ F R    KRHL  H+ E+ Y C +  C  +  R D L +H K+ HS+
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHHSR 74

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 389 ICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHSKN 442
           +C +C +  +R S LK H+L+H+ +R + C  P C      R N+L+H +L HS+ 
Sbjct: 205 VCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL-HSRG 259

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 372 VTPSPPRGTFDSENAVYIC---HICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRR 428
           V  S P+ +  +    + C     C+ +F R   L RH+  H+ E+ + CP CL    R 
Sbjct: 25  VAASTPKRSKSARRKTFKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRV 84

Query: 429 DNLLQHMKLKHS 440
           DNL QH +  H+
Sbjct: 85  DNLKQHRESVHA 96

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHS 440
           ++C  C++ F R+  LKRH  SH+ ER + C  C     R+D +L+H +  H+
Sbjct: 49  FLCPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLHA 101

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 386 AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441
           AVY C +C K F R   LK HL +H+ ER + C  C     R+ +  +H  L   K
Sbjct: 406 AVYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDLHTGK 461

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 9/69 (13%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCP--------W-CLSRHKRRDNLLQHMKLK 438
           + C IC K F R+   KRH   H+ ++ Y C         W C  +  R D L +H K +
Sbjct: 436 FACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTE 495

Query: 439 HSKNLINEL 447
             K  I  L
Sbjct: 496 GGKRCIAPL 504

>TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.281
           YBR066C
          Length = 175

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMK 436
           ++C +CSK F     L RH   H+ E+++FCP   C  R  R DN +QH +
Sbjct: 119 HVCKVCSKGFTTSGHLARHNRIHTGEKNHFCPLEGCNQRFSRHDNCIQHYR 169

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 362 IREPHSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPW 420
           +R+P +N     P+   GT    N    C+ C ++F     L RH  + H +E+ + CP 
Sbjct: 372 VRKPSNN-----PNQRNGTI---NPSTYCYECCRSFSSSHHLTRHKKTVHLNEKPFSCPR 423

Query: 421 CLSRHKRRDNLLQHMKLK 438
           C  R KRRD++LQH+  K
Sbjct: 424 CRKRFKRRDHVLQHLNKK 441

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHS 411
           + CHIC K+F R   L +H+ +HS
Sbjct: 427 FHCHICDKHFSRSDNLNQHIKTHS 450

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 13/79 (16%)

Query: 374 PSPPRGTFDSEN-AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW----------CL 422
           P+      DS+N   ++CH C  +F+ R +L RH+  H+ ++ Y CP+          C 
Sbjct: 165 PTTTNKKLDSKNDGEFVCHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCH 224

Query: 423 SR--HKRRDNLLQHMKLKH 439
           +     RRD    H+K++H
Sbjct: 225 TSGGFSRRDTYKTHLKVRH 243

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 365 PHSNQRFVT----PSPPRGTFDSENAVYIC---HICSKNFKRRSWLKRHLLSHSSERHYF 417
           P SN  F T     S P+ +  +    + C     C+ +F R   L RH+  H+ E+ + 
Sbjct: 14  PDSNGSFATNNVAGSTPKRSKSARRKSFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQ 73

Query: 418 CPWCLSRHKRRDNLLQHMKLKHS 440
           CP CL    R DNL QH +  H+
Sbjct: 74  CPACLKFFSRVDNLKQHRESVHA 96

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 372 VTPSPPRGTFDSENAVYIC---HICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRR 428
           V  S P+ +  +    + C     C+ +F R   L RH+  H+ E+ + CP CL    R 
Sbjct: 25  VAASAPKRSKSARRKTFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRV 84

Query: 429 DNLLQHMKLKHS 440
           DNL QH +  H+
Sbjct: 85  DNLKQHRESVHA 96

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMK 436
           Y C +C K F R S L+ HLL+H+  R + CP+  C      + N+++H+K
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
            D+EN  + C  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 381 FDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
            D+EN  + C  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 389 ICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKH 439
           +C  CS+ F RR  LKRH  +H+ E+ + C +C     RRD +++H    H
Sbjct: 42  LCPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLH 92

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSS 412
           + CHIC+KNF R   L +H+ +H+S
Sbjct: 417 FTCHICNKNFSRSDNLNQHVKTHAS 441

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 395 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSS 412
           + CHIC+KNF R   L +H+ +H+S
Sbjct: 424 FTCHICNKNFSRSDNLNQHVKTHTS 448

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 377 PRGTFDSENAVYIC---HICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQ 433
           P+ T  +    + C     C+ +F R   L RH+  H+ E+ + CP CL    R DNL Q
Sbjct: 33  PKRTKSARRKTFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQ 92

Query: 434 HMKLKHS 440
           H +  H+
Sbjct: 93  HRESVHA 99

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 12/64 (18%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW----------CLSR--HKRRDNLLQHM 435
           ++CH C   FK R +L RH+  H+ E+ Y CP+          C S     RRD+   H+
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTHL 301

Query: 436 KLKH 439
           + +H
Sbjct: 302 RSRH 305

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
           +S++  + C +C K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H++
Sbjct: 7   ESDHRPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR 63

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           ++   Y C +CSK FKR S L  H+  H+  + Y CP+  C      + N+L+H KL
Sbjct: 273 TDKVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKL 329

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 389 ICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           IC  C K F R S L+ H+L HS ++ + C W  C  +   + NL++H+KL
Sbjct: 233 ICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {ON}
           YGL035C (MIG1) - 1:1 [contig 227] FULL
          Length = 463

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           YIC ICS+ F R     RH+ +H+ E+ + C +  C  R  R D L +H ++
Sbjct: 23  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRI 74

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 376 PPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCP--WCLSRHKRRDNLLQ 433
           P RG+   +N   +C IC K+FKR S L+ H++ H++++ Y C    C  R   + N+L+
Sbjct: 214 PYRGSAYKKNGS-VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLR 272

Query: 434 HMKLKHSK 441
           HM+ KH +
Sbjct: 273 HMR-KHKE 279

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 12/68 (17%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW----------CLSR--HKRRDNL 431
           +   +ICH C   FK R +L RH+  H+ E+ + CP+          C S     RRD  
Sbjct: 118 DEEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTF 177

Query: 432 LQHMKLKH 439
             H+K +H
Sbjct: 178 KIHLKSRH 185

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 378 RGTFDSENAVYI------CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRD 429
           +  F+SE +  +      CHIC K   R + LK HLL H+ +  + CPW  C      + 
Sbjct: 133 KKAFNSEESKKMTLLRKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKS 192

Query: 430 NLLQHMK 436
           N+L+H+K
Sbjct: 193 NMLRHLK 199

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           D     + C  C + F+R+  +KRH+ S H +E+ Y C  C     R DNL QH K
Sbjct: 165 DDGTKKFACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSS 412
           + CHIC+KNF R   L +H+ +H S
Sbjct: 417 FTCHICNKNFSRSDNLNQHVKTHVS 441

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 12/77 (15%)

Query: 375 SPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-- 425
            P R +  S    ++CH C   F+ R +L RH+  H+ E+ + CP+        L  H  
Sbjct: 48  GPARPSSSSAMEPFVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPS 107

Query: 426 ---KRRDNLLQHMKLKH 439
               RRD    H+K+KH
Sbjct: 108 GGFSRRDTYKTHLKVKH 124

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 389 ICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSK 441
           IC IC K+FKR S L+ H++ H++++ Y C    C  R   + N+L+HM+ KH +
Sbjct: 250 ICEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR-KHKE 303

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 376 PPRGTF--DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCP--WCLSRHKRRDNL 431
           P R  F  D+E   + C +C + F R    KRH+ +H+ E+ + CP   C     R D L
Sbjct: 2   PTRRNFPSDNEERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDEL 61

Query: 432 LQHMKL 437
            +HMK+
Sbjct: 62  KRHMKV 67

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H   + Y C  C  +  R DNL QH+K
Sbjct: 386 FGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHS 411
           Y CHIC K F R   L +H+ +H+
Sbjct: 415 YACHICDKKFSRSDNLSQHIKTHT 438

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 258 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSE 413
           + CHIC K F R   L +H+ +HS +
Sbjct: 287 FNCHICDKKFSRSDNLNQHIKTHSHQ 312

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHS 440
           Y+C ICS+ F R     RH+ +H+ E+ + C +  C  +  RRD L +H ++  S
Sbjct: 22  YVCPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRRIHAS 76

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMK 436
           + C  C + FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSS 412
           + CHIC+KNF R   L +H+ +H+S
Sbjct: 418 FTCHICNKNFSRSDNLNQHVKTHAS 442

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 386 AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441
           A+Y C +C K F R   LK HL +H++ER + C  C     R+ +  +H  L   K
Sbjct: 497 AIYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDLHSGK 552

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--------PW-CLSRHKRRDNLLQHMKLK 438
           ++C IC K F R+   KRH   HS ++ Y C         W C  +  R D L +H K +
Sbjct: 527 FVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALGRHFKTE 586

Query: 439 HSKNLINEL 447
             K  I+ L
Sbjct: 587 AGKRCISLL 595

>NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {ON}
           Anc_3.281
          Length = 293

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
           YIC +CSK F     L RH   H+ E+ + C  P C  +  R DN +QH +
Sbjct: 228 YICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278

>KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON}
           uniprot|P50898 Kluyveromyces lactis MIG1 Regulatory
           protein MIG1
          Length = 474

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHS 440
           Y+C IC + F R     RH+ +H+ ER + C  P C  R  R D L +H ++  S
Sbjct: 26  YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS 80

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKL 437
           ++C +C + F R     RHL +H+ E+   C  P C+ R  R D L +H ++
Sbjct: 43  HVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI 94

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 388 YICH---ICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLI 444
           + CH    C   F R   L RH+  H+ E+ + C  C     R DNL QH +  H+   I
Sbjct: 18  FTCHGYGDCHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFI 77

Query: 445 NEL 447
           +E+
Sbjct: 78  DEM 80

>NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256
          Length = 394

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%)

Query: 393 CSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447
           CS  F R   L RH+  H+ E+ Y C  C     R DNL QH    H K + N L
Sbjct: 27  CSMAFTRAEHLTRHIRKHTGEKPYHCGICSKNFSRIDNLKQHEDCVHHKGVSNCL 81

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSR-HKRRDNLLQHMK 436
           Y C ICSKNF R   LK+H        H     CLSR HK   N+ +  K
Sbjct: 50  YHCGICSKNFSRIDNLKQH---EDCVHHKGVSNCLSRGHKTTTNMKRRTK 96

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%)

Query: 386 AVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441
           A+Y C +C K F R   LK HL +H+ ER + C  C     R+ +  +H  L   K
Sbjct: 422 AIYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDLHTGK 477

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 9/69 (13%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--------PW-CLSRHKRRDNLLQHMKLK 438
           + C++C K F R+   KRH   H+ ++ Y C         W C  +  R D L +H K  
Sbjct: 452 FACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFKTD 511

Query: 439 HSKNLINEL 447
             +  I  L
Sbjct: 512 SGRRCIAPL 520

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
           D++   + C ICS+ F R     RH+++H+ E+ + C  P C+ +  R D L +H K
Sbjct: 12  DNDRRPFKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAK 68

>Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463W
           (REAL)
          Length = 516

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 12/79 (15%)

Query: 373 TPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--C-----LSRH 425
           TP       ++    +ICH C   F+ R +L RH+  H+  + Y CP+  C     L  H
Sbjct: 145 TPEHSTKVLENGEEEFICHYCDATFRIRGYLTRHIKKHAIRKAYHCPFFNCATPPDLRCH 204

Query: 426 -----KRRDNLLQHMKLKH 439
                 RRD    H+K +H
Sbjct: 205 NSGGFSRRDTYKTHLKARH 223

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 389 ICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHSKN 442
           +C +C +  +R S LK H+L+H+ +R + C  P C      R N+L+H +L    N
Sbjct: 214 VCKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERLHGRDN 269

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 380 TFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           +   E A Y C  C+K FKR S L  H+  H+  + Y CP+  C      + N+L+H KL
Sbjct: 250 SISEEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa]
           {ON} Anc_3.518 YGL209W
          Length = 339

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
           +IC IC + F R    KRH+ +H+ E+ + C  P C+    R D L +H++
Sbjct: 20  FICEICHRGFHRLEHKKRHIRTHTGEKPHKCVFPGCIKSFSRSDELKRHLR 70

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 380 TFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW------CLS--RHKRRDNL 431
           TF  ++AVY C  C  NFK R +L RHL  H   + + CP+      C S     R+D  
Sbjct: 148 TFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTF 207

Query: 432 LQHMKLKH 439
             H+K  H
Sbjct: 208 RTHLKSIH 215

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 380 TFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
            FD E   Y C +C K F+R S L+ H    S  R Y CP+  C      + N+L+H KL
Sbjct: 232 AFD-EKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHSKN 442
           Y+C  C K F     L RH   H+ E+++ C  P C  R  R DN +QH K    +N
Sbjct: 202 YVCKTCVKGFTTSGHLARHNRIHTGEKNHVCPHPGCGQRFSRHDNCVQHYKTHLRRN 258

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
           D++   + C +CS+ F R    KRH+ +H+ E+ + C  P C     R D L +H++
Sbjct: 12  DNDERPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLR 68

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           YIC  C K F R S L+ H   H+ +R + CP+  C      R N+L+H KL
Sbjct: 207 YICSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 258

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 12/64 (18%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWC-------LSRH-----KRRDNLLQHM 435
           Y+CH C+  F+ + +L RHL  H++E+ Y CP+        L  H      RRD    H+
Sbjct: 100 YVCHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKTHL 159

Query: 436 KLKH 439
           K +H
Sbjct: 160 KSRH 163

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSKN 442
           ++C ICS  F     L RH   H+ E+++ CP+  C  +  R DN LQH +    KN
Sbjct: 210 HVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKKN 266

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHSKN 442
           YIC +CSK       L RH   H+ E++Y C    C  +  R DN  QH K  H KN
Sbjct: 256 YICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGCDQKFSRHDNCKQHYK-THLKN 311

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 375 SPPRGTFDSENAV---YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRD 429
            PPR +   +N     Y+C  C K F R S L+ H   H+ +R + CP+  C      R 
Sbjct: 167 GPPRLSPPVQNKAPQRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARS 226

Query: 430 NLLQHMKL 437
           N+L+H KL
Sbjct: 227 NMLRHHKL 234

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           Y C+IC K FKR S L  H+  H+ ++ Y CP   C      + N+L+H KL
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMK 436
           + C +C K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H++
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKL 437
           ++C IC + F R     RH+ +H+ E+ + C  P C+ R  R D L +H ++
Sbjct: 21  HVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI 72

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 384 ENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKL 437
           E   Y C IC K FKR S L  H+  H+  + + CP+  C      + N+L+H KL
Sbjct: 301 EKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL 356

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 389 ICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446
           IC +C K+F RRS L+ HLL H++ + + C +C      + NL +H ++   K + N+
Sbjct: 172 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERIHRQKVISNQ 229

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,275,332
Number of extensions: 1569501
Number of successful extensions: 4889
Number of sequences better than 10.0: 586
Number of HSP's gapped: 4584
Number of HSP's successfully gapped: 721
Length of query: 525
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 411
Effective length of database: 40,409,475
Effective search space: 16608294225
Effective search space used: 16608294225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)