Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F008902.534ON1671678631e-120
NDAI0H013902.534ON1671677631e-105
YMR071C (TVP18)2.534ON1671677611e-104
Skud_13.2272.534ON1671677541e-103
Suva_13.2482.534ON1671677511e-103
KNAG0C058002.534ON1671677451e-102
SAKL0A09504g2.534ON1671677401e-101
TDEL0A030802.534ON1671677143e-97
CAGL0K03025g2.534ON1671677092e-96
KLTH0D06864g2.534ON1671677022e-95
Smik_13.2502.534ON1671676892e-93
KAFR0A018702.534ON1671676883e-93
TPHA0G035202.534ON2041686862e-92
TBLA0G022402.534ON1671676562e-88
AGL072W2.534ON1671675331e-69
Kpol_348.92.534ON1301305082e-66
Ecym_72542.534ON1671675079e-66
ZYRO0B02024g2.534ON1661665042e-65
KLLA0E18525g2.534ON1711654964e-64
Kwal_26.80252.534ON64642583e-29
NDAI0D003707.492ON27844760.12
TBLA0E007007.17ON1274129701.0
Ecym_63511.264ON79642663.3
TBLA0G028403.224ON98299646.0
TPHA0B044101.90ON122458636.7
AFR354C1.476ON121031638.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00890
         (167 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   337   e-120
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   298   e-105
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   297   e-104
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   295   e-103
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   293   e-103
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   291   e-102
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   289   e-101
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   279   3e-97
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   277   2e-96
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   275   2e-95
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   270   2e-93
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   269   3e-93
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   268   2e-92
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   257   2e-88
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   209   1e-69
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   200   2e-66
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   199   9e-66
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   198   2e-65
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   195   4e-64
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...   103   3e-29
NDAI0D00370 Chr4 (77608..78444) [837 bp, 278 aa] {ON} Anc_7.492 ...    34   0.12 
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    32   1.0  
Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}...    30   3.3  
TBLA0G02840 Chr7 complement(759469..762417) [2949 bp, 982 aa] {O...    29   6.0  
TPHA0B04410 Chr2 (1030785..1034459) [3675 bp, 1224 aa] {ON} Anc_...    29   6.7  
AFR354C Chr6 complement(1078269..1081901) [3633 bp, 1210 aa] {ON...    29   8.7  

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 167/167 (100%), Positives = 167/167 (100%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI
Sbjct: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV
Sbjct: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  298 bits (763), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 154/167 (92%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL I QFIN AG+ KDLKSFNFSVYGRWFGYINIILCI LG++NLFHVNAVIAFGI+SI
Sbjct: 1   MALGITQFINIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQGLVILFIEIPFLLKICPLSE FIEFIKRFETNGYRC+FYL MAIIQYCSI LMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVA+GLTISS+SYA+AF NHQEFQNT I+KNP D DFP EAVVREM+
Sbjct: 121 VVAVGLTISSISYAIAFTNHQEFQNTQILKNPTDPDFPREAVVREML 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  297 bits (761), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 154/167 (92%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL + QFIN  GM KDLKSFNFSVYGRWFGYINIILCIALG+ANLFHV+ VIAFGIISI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQGLVILFIEIPFLLKICPLS+NFIEFIKRFETNG+RCLFYL MAIIQY SI +MATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVA+GLTISS+SYAVA+  HQEFQNTNIIKNP D DFPHEAVVREM+
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  295 bits (754), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/167 (83%), Positives = 154/167 (92%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL + QFIN  GM KDLKSFNFSVYGRWFGYINIILCIALG+ANLFHV+ VIAFGIISI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQGLVILFIEIPFLLKICPLS+NF+EFIK+FETNG+RC+FYL MA+IQY SI +MATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVA+GLTISS+SYAVA+  HQEFQNTNIIKNP D DFPHEAVVREM+
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  293 bits (751), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/167 (83%), Positives = 153/167 (91%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL + QFIN  GM KDLKSFNFSVYGRWFGYINIILCIALG+ANLFHV+ VIAFGIISI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQGLVILFIEIPFLLKICPLS+NF+EFIKRFETNG+RC+FYL MA IQY SI +MATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVA+GLTISS+SYAVA+  HQEFQNTNI+KNP D DFPHEAVVREM+
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNILKNPTDDDFPHEAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  291 bits (745), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL IKQF N AGM KDL+SFNFSVYGRWFG+INIILC+ALG+ANLFHV+ VIAFGI+SI
Sbjct: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           +QGL+ILFIEIPFLLKICPLS+NFIEFI RFETNGYR +FYL MA+IQYCS+ILM TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVAI LT+S++ YAVAF  HQEFQNTNIIKNPADADFPHEAVVREM+
Sbjct: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  289 bits (740), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (91%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL IKQFIN AG+ KDLKSFNFSVYG+WFGYINIILC+ALG+ANLFHVNAV+AFG++SI
Sbjct: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQ LVILFIE+PFLLKICPLS+NFIEFIKRFETNG R LFY  MAIIQ+CS+ LM TSLI
Sbjct: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVAIGLTIS+ SYAVA++ HQ+FQNTNIIKNP D DFPHEAVVREM+
Sbjct: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  279 bits (714), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 130/167 (77%), Positives = 152/167 (91%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL ++QFIN AG+ KDLKSFNFS+YGRWFGYINI LCIALG+ANLFHV+AVIAFGI++I
Sbjct: 1   MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           +QGL+ILF+EIPFLLKICPLS+NFIEFIKRFETNGYR LFY+ MA+IQ+CSI + ATSLI
Sbjct: 61  VQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVA+GLTIS+ SYAVA   HQEFQNT+I+K+P   DFPHEAVVREM+
Sbjct: 121 VVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHEAVVREML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  277 bits (709), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 148/167 (88%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL I QFIN AG+ KDLKSFNFSVYG+WFGYINI LCIALG+ANLFHV+AVIAFGI+ I
Sbjct: 1   MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           +QGL+ILFIEIPFLLKICPLS+ FIEFIKRFETNGYRC+FY  MAI+QYCS+ +M TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           V+ I LTIS++SY +AF  HQEF NTNIIKNP D DFPH+AVVREM+
Sbjct: 121 VLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVVREML 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  275 bits (702), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 151/167 (90%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL+IKQFIN AG+ +DLKSFNFSVYG+WFGYINI LC+ALG+ANLFHV+AVI FGII+I
Sbjct: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           +QGLVILF+E+PFLL+ICPLS+NFI FIKRFETNG R LFY+GMA +Q+CS+ +MATSLI
Sbjct: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
            VAIGLTIS+ SY VAF  HQ+FQ T++IK+PAD DFPHEAVVREM+
Sbjct: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  270 bits (689), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL + QFIN  GM KDLKSFNFSVYGRWFGYINIILCIALG+ANLFHV+ VIAFGIISI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQGL+ILFIEIPFLLKICPLS+NFIEFIK+FETNG+RC+FYL MAIIQY SI +MATSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVA+GLTISS+SYAVA+  HQEFQNTNIIKNP D DFPHEAVVREM+
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  269 bits (688), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 143/167 (85%), Positives = 153/167 (91%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL IKQFIN AG+ KDLKSFNFSVYGRWFGYINIILCIALG++NLFHVNAVIAFGIISI
Sbjct: 1   MALSIKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQGL+ILFIEIPFLLKICPLS+NF+EFIKRFETNGYRC+FYL MAIIQYCSIILMATSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVAI LT+S  SY +A    QEFQNTNIIKNP D DFPHEAVVREM+
Sbjct: 121 VVAICLTVSCASYGIAAFKKQEFQNTNIIKNPTDTDFPHEAVVREML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  268 bits (686), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 151/168 (89%), Gaps = 1/168 (0%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL IKQFIN AGM KDLKSFNFSVYG++FGYINIILC+ALG+ANLFHVNAVIAFGI++I
Sbjct: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           +Q LVILFIEIPFLLKICPLS+NF+ F+K FETNG+RCLF+ GMAI+Q+CS+IL  TSLI
Sbjct: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNT-NIIKNPADADFPHEAVVREMV 167
           VVAIGL+IS+  YA+AF   QEFQ+T N+IKNP D DFPHEAVVREM+
Sbjct: 157 VVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  257 bits (656), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 118/167 (70%), Positives = 147/167 (88%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           M + +++F+N  G+ + LKSFNFS+YG+WFGYINI+LC+ALG+ANLFHVN VIAFGI+SI
Sbjct: 1   MGVALQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           IQ  +ILF+E+PFLLKICPLS+NFI FIK F+TNG+RC+FY+ MA +Q+CSIIL ATSLI
Sbjct: 61  IQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLI 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           VVAIGLTIS++SYAVA+  +QEFQN +IIKNP D DFP EAVVREM+
Sbjct: 121 VVAIGLTISAISYAVAYFKNQEFQNVSIIKNPTDDDFPREAVVREML 167

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  209 bits (533), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 95/167 (56%), Positives = 127/167 (76%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MAL  K F+N  G+  DL+SFNFSVYGRWFGYINI+LC+ALG+AN+FH + VIAF I++I
Sbjct: 1   MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
           +QGL+++F+E+P LLKICPLS+NFI  +K+ +TNG R L Y  +AI+QY S+ +  TSL+
Sbjct: 61  VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
            VAIGLTIS++ Y   +   QEF   N+I+NP D  F  EA VRE++
Sbjct: 121 AVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAVREVL 167

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  200 bits (508), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 116/130 (89%), Gaps = 1/130 (0%)

Query: 39  IALGVANLFHVNAVIAFGIISIIQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRC 98
           +ALG+ANLFHVNAVIAFGI++I+Q L+ILF+E+PFLLKICPLSENFI FIK FETNGYRC
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 99  LFYLGMAIIQYCSIILMATSLIVVAIGLTISSMSYAVAFANHQEFQN-TNIIKNPADADF 157
           +FY  MAI+Q+CS+ LM TSLIVVAI LTIS++ YA+A+  +QEFQ+ TN+IKNP D DF
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 158 PHEAVVREMV 167
           PH+AVVREM+
Sbjct: 121 PHDAVVREML 130

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  199 bits (507), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 124/167 (74%)

Query: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60
           MA+ +K FIN  G+  DLKSFNFSVYGRWFGYINIILCIALG+AN+FH   VI F I+++
Sbjct: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60

Query: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120
            QG  +LF+E+PFL+KICPLSE F+  +K F +N  R + Y  MA+IQ+ S++   TSL+
Sbjct: 61  GQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120

Query: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167
           V+AI LT+S++ YA  +   QEF+ +N+++ P    FPHEA VREM+
Sbjct: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  198 bits (504), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (0%)

Query: 3   LDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISIIQ 62
           +D+ Q      + + LKS+NFS+YG++  Y+NII CIA G+ANLFHVNAVIAFG+ISI+Q
Sbjct: 1   MDLAQIKILGSLVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQ 60

Query: 63  GLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLIVV 122
           G +ILF+E+PFLL+ICPLS+NFIEF+ RFETNG+R +FY+  A++Q+ S+ L  TSLIVV
Sbjct: 61  GAIILFLEVPFLLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVV 120

Query: 123 AIGLTISSMSYAVAFANHQEFQNTNIIKNP-ADADFPHEAVVREMV 167
           A+GLTIS+  Y VA+  HQ FQN++ IK P  +    +E  VREM+
Sbjct: 121 AVGLTISAAFYGVAYFKHQNFQNSSHIKEPVGEGVEANEQNVREML 166

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  195 bits (496), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 94/165 (56%), Positives = 126/165 (76%), Gaps = 2/165 (1%)

Query: 5   IKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISIIQGL 64
           +K   N +GM  DLKS NFS+YG+W  Y+NII C+A G+AN+FH +AVI F II+I+QGL
Sbjct: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSIIAIVQGL 66

Query: 65  VILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLIVVAI 124
           +ILFIE+PFLLKICPLS+NFI F+ +F+TN  R LFYL M  IQ+CSII+ +TSLIVVA+
Sbjct: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126

Query: 125 GLTISSMSYAVAFANHQEFQNTNIIKNPAD--ADFPHEAVVREMV 167
           GL+I++  YA+  A  QEF+N+ I+ +     A   +EAVVR+M+
Sbjct: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score =  103 bits (258), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (87%)

Query: 104 MAIIQYCSIILMATSLIVVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVV 163
           MA +Q+CSI LM TSLIVVA+GLTIS+ SY+VAF  HQ+FQ T++IKNPAD DFPHEAVV
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60

Query: 164 REMV 167
           REM+
Sbjct: 61  REML 64

>NDAI0D00370 Chr4 (77608..78444) [837 bp, 278 aa] {ON} Anc_7.492
           YBL049W
          Length = 278

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 114 LMATSLIVVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADF 157
           ++ TSLI   +    S+ SY     NH+  QN + + +P D DF
Sbjct: 75  VVTTSLIYPHLNHESSTRSYRNGRRNHRNHQNRHTVFSPTDNDF 118

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 53/129 (41%), Gaps = 16/129 (12%)

Query: 36  ILCIALGVANLFHVNAVIAFGIISIIQGLVILFIEIPFLLKICPLSENFIEFIKRFETNG 95
           ++ +    A   H   ++A   +S+ QGL I +    +  K C +S   + + K F   G
Sbjct: 799 LMLLRTSTALFLHFEKLLATKTLSLEQGLSIYYT---YFEKCCKISLKLVNYFKNFFGVG 855

Query: 96  YR-CLFYLGMAIIQYCSIILMAT--SLIVVAIGLTISSMSYAVAFANHQEFQNT------ 146
           Y  C       + +   + LM    SLI + + L ++ +S      +H +  NT      
Sbjct: 856 YGICAPLSNYMVTKMAQLSLMTVLFSLIGIIMRLELACISLNSMITSHSQNNNTEKISEL 915

Query: 147 ----NIIKN 151
               NI+KN
Sbjct: 916 LIKQNILKN 924

>Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}
           similar to Ashbya gossypii AFR085W
          Length = 796

 Score = 30.0 bits (66), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 125 GLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREM 166
           G+TI S   A++F N Q+  N N+I  P  ADF  E V+R +
Sbjct: 69  GITIQSA--AISF-NWQKLYNINLIDTPGHADFTFE-VIRSL 106

>TBLA0G02840 Chr7 complement(759469..762417) [2949 bp, 982 aa] {ON}
           Anc_3.224 YBR038W
          Length = 982

 Score = 29.3 bits (64), Expect = 6.0,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 3/99 (3%)

Query: 41  LGVANLFHVNAVIAFGIISIIQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLF 100
             +AN       +A  +  +I   V LFI   +L+ IC L+  FI  +      G + LF
Sbjct: 675 FSIANFVITFYYLAGSLNQVIHNGVALFIFFKYLI-ICDLACCFIISMGN-RPQGAKWLF 732

Query: 101 YLGMAIIQYCSIILMATSLIVVAIGLTISSMSYAVAFAN 139
              M II  C+I  +   L+     L   + SY+  F N
Sbjct: 733 LTSMVIITICAIYSLVCGLLFAIQTLVKHTESYS-TFVN 770

>TPHA0B04410 Chr2 (1030785..1034459) [3675 bp, 1224 aa] {ON}
           Anc_1.90 YGL140C
          Length = 1224

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 2   ALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIIS 59
           AL +  F  F   A+D   +  S +G W G++  ILC+   V   F V  + A G+IS
Sbjct: 636 ALQLSSFPMFMPSARD---WYISYHGAWIGFV-CILCMEPSVGGTFWVFFLRAVGVIS 689

>AFR354C Chr6 complement(1078269..1081901) [3633 bp, 1210 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL031W
           (SPF1)
          Length = 1210

 Score = 28.9 bits (63), Expect = 8.7,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 73  FLLKICPLSENFIEFIKRFETNGYRCLFYLG 103
           FL+  CPL ++ IE IK    + +RC+   G
Sbjct: 669 FLVFHCPLKDDAIETIKMLNESSHRCIMITG 699

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.146    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,931,721
Number of extensions: 588177
Number of successful extensions: 2708
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2759
Number of HSP's successfully gapped: 30
Length of query: 167
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 66
Effective length of database: 41,900,133
Effective search space: 2765408778
Effective search space used: 2765408778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 61 (28.1 bits)