Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F008107.126ON2312319921e-137
Smik_9.1847.126ON2141295371e-68
Skud_9.1627.126ON2171285353e-68
YIL010W (DOT5)7.126ON2151255327e-68
Suva_9.1947.126ON2152315266e-67
KNAG0G010207.126ON2072275092e-64
KLLA0D14333g7.126ON2052315082e-64
SAKL0F05368g7.126ON2312345079e-64
NDAI0H013107.126ON2611815072e-63
TBLA0A009407.126ON2881255041e-62
Kpol_1062.577.126ON2191264981e-62
KAFR0K012007.126ON2021284934e-62
ZYRO0C05214g7.126ON2701244924e-61
ADL018W7.126ON2441284713e-58
TDEL0H028807.126ON3541304778e-58
Ecym_83517.126ON2241244651e-57
CAGL0C03850g7.126ON2091284501e-55
TPHA0C043307.126ON2091244459e-55
Kwal_55.208397.126ON3051574261e-50
KLTH0F12562g7.126ON2931243962e-46
CAGL0L01551g1.501ON31060730.72
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00810
         (231 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   386   e-137
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   211   1e-68
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   210   3e-68
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   209   7e-68
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   207   6e-67
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   200   2e-64
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   200   2e-64
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   199   9e-64
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   199   2e-63
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   198   1e-62
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   196   1e-62
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   194   4e-62
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   194   4e-61
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   186   3e-58
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   188   8e-58
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   183   1e-57
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   177   1e-55
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   176   9e-55
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   168   1e-50
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   157   2e-46
CAGL0L01551g Chr12 complement(172658..173590) [933 bp, 310 aa] {...    33   0.72 

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  386 bits (992), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 199/231 (86%), Positives = 199/231 (86%)

Query: 1   MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRXXXXXXXXXXXXXXXXXPKLDGKEE 60
           MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQR                 PKLDGKEE
Sbjct: 1   MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRVSKTKKIVIKKSNGKMKPKLDGKEE 60

Query: 61  IVKSVKELDSTAVKNTDSIYKELQXXXXXXXXXXXXXXXVSVSLKKVVEENKIVVFFAFP 120
           IVKSVKELDSTAVKNTDSIYKELQ               VSVSLKKVVEENKIVVFFAFP
Sbjct: 61  IVKSVKELDSTAVKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFP 120

Query: 121 KANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFI 180
           KANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFI
Sbjct: 121 KANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFI 180

Query: 181 GLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFASN 231
           GLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFASN
Sbjct: 181 GLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFASN 231

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  211 bits (537), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 95/129 (73%), Positives = 116/129 (89%)

Query: 101 SVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKK 160
           S+SLKK+ EENKIVVFF +PKA+TPGCTRQACGFRDNY +LK+H+AV+G+S+D VT+QK+
Sbjct: 81  SISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKR 140

Query: 161 FKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEE 220
           F+TKQNLPY LLSD KR+FIGLLGAKKTP SG IRS+F+FVDGKL+ KRVKISPE+SV +
Sbjct: 141 FQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVND 200

Query: 221 ARKEVSAFA 229
           A+KE+   A
Sbjct: 201 AKKEILELA 209

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  210 bits (535), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 117/128 (91%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           +SLK++ +ENKIVVFF +PKA+TPGCTRQACGFRDNY++LK+HAAV+G+SADPVT+QKKF
Sbjct: 82  ISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKKHAAVFGLSADPVTSQKKF 141

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           +TKQNLPY L+SD KR+FIGLLGAKKTP SG IRS+F+FV+GKL+ KR+KISPE+SV +A
Sbjct: 142 QTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFVNGKLRFKRIKISPEVSVSDA 201

Query: 222 RKEVSAFA 229
           +KEV   A
Sbjct: 202 KKEVLEIA 209

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  209 bits (532), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 115/125 (92%)

Query: 101 SVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKK 160
           S+SLKK+ E N++VVFF +P+A+TPGCTRQACGFRDNY+ELK++AAV+G+SAD VT+QKK
Sbjct: 81  SISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKK 140

Query: 161 FKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEE 220
           F++KQNLPY LLSD KR+FIGLLGAKKTP SG IRS+FIFVDGKLK KRVKISPE+SV +
Sbjct: 141 FQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVND 200

Query: 221 ARKEV 225
           A+KEV
Sbjct: 201 AKKEV 205

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  207 bits (526), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 122/231 (52%), Positives = 150/231 (64%), Gaps = 31/231 (13%)

Query: 4   LRRSGRISTLKKTHFLTEEDSEEV-----KPAIKKQRXXXXXXXXXXXXXXXXXPKLDGK 58
           LRRS RI+T K+   L  E S+ V     +PA KK +                 PKLD  
Sbjct: 5   LRRSARIATSKR--LLENEGSKLVPVSPPEPAKKKIKTV---------------PKLD-- 45

Query: 59  EEIVKSVKELDSTAVKNTDSIYKELQXXXXXXXXXXXXXXXVSVSLKKVVEENKIVVFFA 118
             I + VK  D +++        EL+                 VSLK++ +ENKIVVFF 
Sbjct: 46  --IEEPVKREDHSSLGAN-----ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFV 98

Query: 119 FPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRD 178
           +PKA+TPGCTRQACGFRDNY++LKEHAAV+G+SAD V +QKKF+TKQ LPY LLSD KR+
Sbjct: 99  YPKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKRE 158

Query: 179 FIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229
           FIGLLGAKKTP SG IRS+F+FVDGKL+ KRVKISPE+SV +A+KEV   A
Sbjct: 159 FIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELA 209

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  200 bits (509), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 143/227 (62%), Gaps = 29/227 (12%)

Query: 1   MVELRRSGRISTLKK-THFLTEEDSEEVKPAIKKQRXXXXXXXXXXXXXXXXXPKLDGKE 59
           MVELR+S R++ +KK T   T   S ++   +KK                   P +D K 
Sbjct: 1   MVELRKSARVANIKKQTTLTTPATSNKI---VKKTSNAASHKKVKIVAETEDKPLVDAKV 57

Query: 60  -EIVKSVKELDSTAVKNTDSIYKELQXXXXXXXXXXXXXXXVSVSLKKVVEENKIVVFFA 118
            EI   + +L  T V     +                      VSL +V   NKI+V FA
Sbjct: 58  LEIGDEIPDL--TLVDQEGEL----------------------VSLTEVASNNKILVIFA 93

Query: 119 FPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRD 178
           +P+A+TPGCTRQACGFRDNY ELK+HAAVYG+SAD V +QKKF+TKQNLPY+LLSD KR+
Sbjct: 94  YPRASTPGCTRQACGFRDNYAELKKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKRE 153

Query: 179 FIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEV 225
           FIG+LGAKKT QSG+IRSY+IF +GKL++K++K+SPE SV E++ EV
Sbjct: 154 FIGVLGAKKTSQSGIIRSYWIFFNGKLRIKKIKVSPEASVAESKAEV 200

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  200 bits (508), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 145/231 (62%), Gaps = 31/231 (13%)

Query: 1   MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRXXXXXXXXXXXXXXXXXPKLDGKEE 60
           MVELRRS RIS  K+   L  E +E +K   K +                   K +GK+E
Sbjct: 1   MVELRRSNRISAKKEP--LDSESAEPIKVKAKTESKVT---------------KPNGKKE 43

Query: 61  IVKSVKELDSTAVKNTDSIYK--ELQXXXXXXXXXXXXXXXVSVSLKKVVEENKIVVFFA 118
                       VKN DS  K  ELQ                 +SLK+V  +NK+VVFFA
Sbjct: 44  ------------VKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFA 91

Query: 119 FPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRD 178
           +PKA+TPGCTRQACG+RDNY ELKEHAAV+G+SAD   +QK F+TKQ LP+ LLSD KR+
Sbjct: 92  YPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKRE 151

Query: 179 FIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229
           FIG LGAKKT  SGV+RS++IF +GKL+VKRV++SPE+S+EE +KEV   A
Sbjct: 152 FIGALGAKKTAVSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELA 202

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  199 bits (507), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 112/234 (47%), Positives = 148/234 (63%), Gaps = 15/234 (6%)

Query: 1   MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRXXXXXXXXXXXXXXXXXPKLDGKEE 60
           MVELRRS R++  KK   L + +   V+P  KK +                  K++ K E
Sbjct: 1   MVELRRSNRLAASKK---LGKGEKPSVEPPAKKLKISRKNKSED---------KIEDKTE 48

Query: 61  IVKSVKELDSTAVKNTDS---IYKELQXXXXXXXXXXXXXXXVSVSLKKVVEENKIVVFF 117
                K  D +  + T+       EL+                 +SLK++ ++N+IVVFF
Sbjct: 49  DEVQDKPADKSEDEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFF 108

Query: 118 AFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKR 177
           A+PKA+TPGCTRQ CG+RDNY++LKEHAAV+G+SAD   AQK F+TKQ+LPY LLSD KR
Sbjct: 109 AYPKASTPGCTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKR 168

Query: 178 DFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFASN 231
           +FIGLLGAKKTPQSGVIRS+++F +GKL+ KRVKISPE SV + +KEV   A +
Sbjct: 169 EFIGLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKD 222

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  199 bits (507), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 131/181 (72%), Gaps = 7/181 (3%)

Query: 54  KLDGKE-EIVKSVKELDSTAVK----NTDSIYKELQXXXXXXXXXXXXXXXVSVSLKKVV 108
           K+DG E E VK VK  D   V     N DSI  EL+                 +SLK++ 
Sbjct: 77  KVDGIEHEEVKKVK-FDEQQVSDKSANNDSII-ELEIGDDIPDITLSNQNGKEISLKEIA 134

Query: 109 EENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLP 168
           + NKI+V FAFP+A+TPGCTRQACGFRDNY ELK++A V+G+SAD +++QKKF+ KQ+LP
Sbjct: 135 KTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLP 194

Query: 169 YSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAF 228
           Y LLSD KR  IGLLGAKKTPQSG +RSY+IFV+GKL +KR+K+SPE+SV E++KEV  F
Sbjct: 195 YDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEF 254

Query: 229 A 229
           A
Sbjct: 255 A 255

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  198 bits (504), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (85%)

Query: 101 SVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKK 160
           ++SLKKV+EEN+IVV FA+PKANTPGCTRQACG RDNY +LK++A V+GISAD V+AQK 
Sbjct: 145 TISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDLKKYAVVFGISADSVSAQKS 204

Query: 161 FKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEE 220
           F+ KQNLPY LLSD  R+ IG LG KKTP SG+IRS+FI V+GKLK KRVKISPE+SV +
Sbjct: 205 FQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIVNGKLKFKRVKISPEVSVSD 264

Query: 221 ARKEV 225
            +KEV
Sbjct: 265 CKKEV 269

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  196 bits (498), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 110/126 (87%)

Query: 100 VSVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQK 159
           V +SL+++ ++N I+VFFA+P+A TPGCTRQACGFRD Y +LK+HAAV+G+SAD   +QK
Sbjct: 85  VKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDLKKHAAVFGLSADSTHSQK 144

Query: 160 KFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVE 219
           KF+ K +LPY LLSD KR+FIGLLGAKKTPQSG+IRS+FIFVDGKL+ KR+KISPE+SV 
Sbjct: 145 KFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFVDGKLRFKRIKISPEISVN 204

Query: 220 EARKEV 225
           + +KEV
Sbjct: 205 DGKKEV 210

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  194 bits (493), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 111/128 (86%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           +SL++V + NKI+V FA+PKA+TPGCTRQACGFRDNY E+K+HAAV+G+SAD V +QK+F
Sbjct: 70  ISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRF 129

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           + KQNLP+ LLSD KR+ IG+LGAKKTPQSG+IRS+++F+DGKL+ + +K+SPE S+ E+
Sbjct: 130 QEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISES 189

Query: 222 RKEVSAFA 229
           +KEV   A
Sbjct: 190 KKEVMELA 197

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  194 bits (492), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 110/124 (88%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           +SLKKV +E+KIVV F +PKA+TPGCTRQACGFRDNY+++KEHAAV+G+SAD V AQKKF
Sbjct: 111 ISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHAAVFGLSADTVNAQKKF 170

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           + KQ+LP+ LLSD +R  +GLLGAKK+P+SG+IRS+++F DG LK KRVKISPE+S+EE 
Sbjct: 171 QEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLKHKRVKISPEVSIEEG 230

Query: 222 RKEV 225
           +KEV
Sbjct: 231 KKEV 234

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  186 bits (471), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 84/128 (65%), Positives = 105/128 (82%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           V L  VV++NKIVV FA+PKA+TPGCTRQACGFRDNY+EL++HA V+GISAD V +QK F
Sbjct: 106 VKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSF 165

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           + KQ LP+ LLSD KR+ IG LGA+KT Q+GVIRS+++FVDGKL  KR+KISPE+S+ + 
Sbjct: 166 QQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADG 225

Query: 222 RKEVSAFA 229
             EV  FA
Sbjct: 226 LSEVLLFA 233

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  188 bits (477), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 108/130 (83%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           VSL+ V +E+KI++ FA+PKA+TPGCTRQACG+RDNY ELKEHAAV+G+S D  +AQKKF
Sbjct: 221 VSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKF 280

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           +TKQ+LP+ LL D  R  IG LGAKKT QSG +RS+++F DGKLK KRVK+SPE+S+++ 
Sbjct: 281 QTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDG 340

Query: 222 RKEVSAFASN 231
           +KEV   A++
Sbjct: 341 KKEVLELAAS 350

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  183 bits (465), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 106/124 (85%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           V+LK V ++NKIV+ FA+PKANTPGCTRQACGFRDNY+EL++HA ++GIS+D V +QK F
Sbjct: 90  VNLKDVAKKNKIVLIFAYPKANTPGCTRQACGFRDNYEELQKHAVIFGISSDSVKSQKAF 149

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           ++KQ+LP+ LLSD  R+ IG+LGAKKT Q+GVIRS++IF +GKLK KRVK+SPE S+ E 
Sbjct: 150 QSKQHLPFDLLSDPDRELIGMLGAKKTAQAGVIRSHWIFCNGKLKYKRVKVSPETSISEG 209

Query: 222 RKEV 225
            +EV
Sbjct: 210 LEEV 213

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  177 bits (450), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           VSLK + +ENK+++ F +PKA+TPGCTRQACGFRDN+ +LKEH  V G+S D   AQ KF
Sbjct: 77  VSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKF 136

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           K K +LPY LL D  R+FIG+LGAKKTP SG IRS+F+F DGKLK KR+KISPE+SV + 
Sbjct: 137 KEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKLKFKRLKISPEISVADG 196

Query: 222 RKEVSAFA 229
           +KEV   A
Sbjct: 197 KKEVLELA 204

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  176 bits (445), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           +SL+ + ++NKI+  F +P+A+TPGCTRQACGFRDN+ +LK+++ + G+S D +TAQK F
Sbjct: 80  LSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLKKYSLILGLSGDSITAQKHF 139

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           KTKQNLPY LL D+++  I +LG KK P SG+IRSYFIFVDGKLK+KRVK+SPE+S+ E+
Sbjct: 140 KTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFVDGKLKLKRVKVSPEVSITES 198

Query: 222 RKEV 225
           +KE+
Sbjct: 199 KKEI 202

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  168 bits (426), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 109/157 (69%), Gaps = 1/157 (0%)

Query: 73  VKNTDSIYKELQXXXXXXXXXXXXXXXVSVSLKKVVEENKIVVFFAFPKANTPGCTRQAC 132
            K++DS   EL+                 VSLKKV +ENK+V+ F++PKA+TPGCT QAC
Sbjct: 37  AKSSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQAC 96

Query: 133 GFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSG 192
           GFRDNY++LKE  AV+G+SAD   AQ+KF+   +LP+ LLSD KR+ IGLLGAKK+P SG
Sbjct: 97  GFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SG 155

Query: 193 VIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229
             RS+++F +GKL  KR+ +SPE+S+ +A+ E    A
Sbjct: 156 TKRSHWVFANGKLINKRIAVSPEVSIRDAKTEAHEAA 192

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  157 bits (396), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 102 VSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKF 161
           VSLK VV++NK+VV FA+PKA+TPGCT+QACGFRDNY+ELK++AAV+G+S D   AQ+KF
Sbjct: 63  VSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLSTDTPNAQQKF 122

Query: 162 KTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEA 221
           K K +LP+ LLSD +R  IG LGA K+P SG  RSY++FV GKL+ KR+ +SPE SV EA
Sbjct: 123 KEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKLRTKRISVSPEASVSEA 181

Query: 222 RKEV 225
           +KE 
Sbjct: 182 KKEA 185

>CAGL0L01551g Chr12 complement(172658..173590) [933 bp, 310 aa] {ON}
           similar to uniprot|P54003 Saccharomyces cerevisiae
           YML052w SUR7
          Length = 310

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 10/60 (16%)

Query: 123 NTPGCTRQ----ACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRD 178
           N P  TR     AC + +N  +  E+       A P++    F TK+N+P+S +  SKRD
Sbjct: 55  NAPSLTRWTFWGACSYDNNKIDCGEYLK----PAAPISPVDNFHTKENVPHSFI--SKRD 108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,024,857
Number of extensions: 725478
Number of successful extensions: 1286
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1290
Number of HSP's successfully gapped: 24
Length of query: 231
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 125
Effective length of database: 41,326,803
Effective search space: 5165850375
Effective search space used: 5165850375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)