Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F003306.65ON28124713040.0
Smik_15.3526.65ON2881997427e-98
Skud_15.3366.65ON2862167297e-96
ZYRO0D14190g6.65ON2952487299e-96
YOR174W (MED4)6.65ON2841997262e-95
Kpol_1042.116.65ON2922327098e-93
Suva_8.2276.65ON2872437011e-91
KNAG0M010206.65ON2792346844e-89
NDAI0J013206.65ON3342566885e-89
KAFR0G025006.65ON2892536663e-86
CAGL0L04620g6.65ON2641976461e-83
AGR270W6.65ON2942366239e-80
TBLA0G005506.65ON3182216162e-78
Kwal_56.232426.65ON2562156077e-78
SAKL0A08426g6.65ON2991826109e-78
TPHA0F025906.65ON3062165796e-73
KLTH0G15444g6.65ON2632475722e-72
Ecym_31246.65ON2742275305e-66
TDEL0G040606.65ON2201945082e-63
KLLA0F20185g6.65ON2851695124e-63
KAFR0A013201.253ON176585731.4
CAGL0J04686g4.300ON40991711.6
YFR031C (SMC2)7.186ON1170162684.5
KAFR0K015203.426ON1213109677.2
ZYRO0D12298g5.516ON38246658.3
KLLA0D14355g7.125ON58867658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00330
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   506   0.0  
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   290   7e-98
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   285   7e-96
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   285   9e-96
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   284   2e-95
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   277   8e-93
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   274   1e-91
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   268   4e-89
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   269   5e-89
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   261   3e-86
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   253   1e-83
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   244   9e-80
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   241   2e-78
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   238   7e-78
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   239   9e-78
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   227   6e-73
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   224   2e-72
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   208   5e-66
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   200   2e-63
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   201   4e-63
KAFR0A01320 Chr1 complement(252704..258001) [5298 bp, 1765 aa] {...    33   1.4  
CAGL0J04686g Chr10 complement(446347..447576) [1230 bp, 409 aa] ...    32   1.6  
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    31   4.5  
KAFR0K01520 Chr11 (315301..318942) [3642 bp, 1213 aa] {ON} Anc_3...    30   7.2  
ZYRO0D12298g Chr4 (1033584..1034732) [1149 bp, 382 aa] {ON} simi...    30   8.3  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...    30   8.8  

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/247 (100%), Positives = 247/247 (100%)

Query: 1   MSSQENTLLGSTTSMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANL 60
           MSSQENTLLGSTTSMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANL
Sbjct: 1   MSSQENTLLGSTTSMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANL 60

Query: 61  VNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILG 120
           VNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILG
Sbjct: 61  VNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILG 120

Query: 121 ILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIG 180
           ILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIG
Sbjct: 121 ILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIG 180

Query: 181 PNNFIWPAEDALRRGMLALASLHADELTKAPGAHEGEEELIPKGSEPIAQEEPVTTRRES 240
           PNNFIWPAEDALRRGMLALASLHADELTKAPGAHEGEEELIPKGSEPIAQEEPVTTRRES
Sbjct: 181 PNNFIWPAEDALRRGMLALASLHADELTKAPGAHEGEEELIPKGSEPIAQEEPVTTRRES 240

Query: 241 FTFSGKT 247
           FTFSGKT
Sbjct: 241 FTFSGKT 247

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  290 bits (742), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 137/199 (68%), Positives = 163/199 (81%), Gaps = 2/199 (1%)

Query: 14  SMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNA 73
           SMGH++SSSVSL+ E   N   N ED +SKVQ+Y DLC YE  L  LV SVD+FKPD++ 
Sbjct: 12  SMGHMKSSSVSLVVEATSNM--NSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDV 69

Query: 74  ARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALP 133
           AR+LI++D  LF  +D   EYD ID +L+K++ +S ELD++TK IL I+NECHDEL ALP
Sbjct: 70  ARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALP 129

Query: 134 MLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALR 193
           ML+QVEFE  TILQQRSKINS+ LLDYATKLSKFT+IPPTFDKGSIGPNNFIWPAEDALR
Sbjct: 130 MLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR 189

Query: 194 RGMLALASLHADELTKAPG 212
           RGMLA+ASLH+ ELT+ PG
Sbjct: 190 RGMLAMASLHSKELTRVPG 208

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  285 bits (729), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 138/216 (63%), Positives = 171/216 (79%), Gaps = 4/216 (1%)

Query: 15  MGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAA 74
           MGHI+SSSVSL+AE   N   N ED +SKVQ+Y DLC YE  L+ LV SVD+FKPD++ A
Sbjct: 13  MGHIKSSSVSLVAEAASNM--NSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVA 70

Query: 75  RELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPM 134
           R+LI  D  LF  +    +YD ID +L+K++ +S ELD+++++IL ILNECHDEL+ LP 
Sbjct: 71  RDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPT 130

Query: 135 LKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRR 194
           L+QVEFE  TILQQRSKINS+ LLDYATKLSKFTKIPPTFDKG++GPNNFIWPAEDALRR
Sbjct: 131 LEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRR 190

Query: 195 GMLALASLHADELTKAPGAHEGEEELIPKGSEPIAQ 230
           GMLA+ASLH+ ELT+ PG  E E E +P  + P++Q
Sbjct: 191 GMLAMASLHSKELTRVPGEDEQETEEVP--TAPLSQ 224

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  285 bits (729), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 143/248 (57%), Positives = 184/248 (74%), Gaps = 18/248 (7%)

Query: 14  SMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNA 73
           S GH+RSSS SL+++   +S +N++D++SKVQIY+DL  YE+KLA LV SVD FKPD+  
Sbjct: 17  SRGHVRSSSTSLISDAM-SSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKI 75

Query: 74  ARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALP 133
             ELIEVD+ L+++LDSF EYD+ID+ L +L+ ES ELD +TKE+L  L+EC++ LN LP
Sbjct: 76  VHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLP 135

Query: 134 MLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALR 193
           ML+QVEFE ++IL+QRSK+NSSVLL+YATKLSKFTKIPPTFDKG+IGPNNF+WPAEDALR
Sbjct: 136 MLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALR 195

Query: 194 RGMLALASLHADELTKAPGAHEGEE-----------------ELIPKGSEPIAQEEPVTT 236
           RGMLA+ASLH+ E+T+ PG  E EE                 E    G  P +       
Sbjct: 196 RGMLAIASLHSKEMTRIPGEPEEEEADATEKQGSGDKNGKEGEETKTGERPASPGAHGNE 255

Query: 237 RRESFTFS 244
           RR+SF F+
Sbjct: 256 RRQSFVFT 263

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  284 bits (726), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 135/199 (67%), Positives = 164/199 (82%), Gaps = 2/199 (1%)

Query: 14  SMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNA 73
           SMGHIRSSSVSL+AE   N+  N ED +SKVQ+Y DLC YE  L+ LV SVD+FKP+++ 
Sbjct: 12  SMGHIRSSSVSLVAEATSNT--NSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDI 69

Query: 74  ARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALP 133
           A++LI  D  LF+ +    EYD I  +L+K++ +S ELD++T++IL ILNECHDEL ALP
Sbjct: 70  AKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALP 129

Query: 134 MLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALR 193
           ML+QVEFE  TILQQRSKINS+ LLDYATKLSKFTKIPPTFDKG++GPNNFIWPAEDALR
Sbjct: 130 MLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALR 189

Query: 194 RGMLALASLHADELTKAPG 212
           RGMLA+ASLH+ ELT+ PG
Sbjct: 190 RGMLAMASLHSKELTRIPG 208

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  277 bits (709), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 177/232 (76%), Gaps = 15/232 (6%)

Query: 15  MGHIRS-SSVSLLAEVNPNSIS----------NDEDDISKVQIYSDLCSYEQKLANLVNS 63
           MGH++S SSVSL+ + N NSIS          N+ +D+SKVQIY+D+  YE  L  LV S
Sbjct: 6   MGHVKSISSVSLMTD-NTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVES 64

Query: 64  VDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILN 123
           VDKFKPD+  A +LI+VD  LF++LDSF EYDKI   L++ + E+ ELD +TKEILG LN
Sbjct: 65  VDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLN 124

Query: 124 ECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNN 183
           ECH  LN+LPML+QVEFE + IL+QRSKINS +LLDYATKLSKFTKIPPTF+KGSIGPNN
Sbjct: 125 ECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNN 184

Query: 184 FIWPAEDALRRGMLALASLHADELTKAPGAHEGEEELIP-KGSEPIAQEEPV 234
           FIWPAEDALRRGMLA+ASLH+ ELTK P  +E EE   P K +EP    EP+
Sbjct: 185 FIWPAEDALRRGMLAMASLHSKELTKLP--NEPEEASEPDKSTEPDKSTEPI 234

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  274 bits (701), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 177/243 (72%), Gaps = 17/243 (6%)

Query: 15  MGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAA 74
           M  IRSSSVSL+AE    S  N E   SKVQ+Y DLC YE  L  LV SVD+FKP++  A
Sbjct: 13  MNQIRSSSVSLVAEAT--SSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIA 70

Query: 75  RELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPM 134
           ++LI+ D  LF  +    +YDKID +L+K++ +S ELD++T++IL ILNECHDEL+ALPM
Sbjct: 71  KDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPM 130

Query: 135 LKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRR 194
           L+QVEFE +TILQQRSKINS+ LLDYATKLSKFT+IPPTFDKG++GPNNFIWPAEDALRR
Sbjct: 131 LEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRR 190

Query: 195 GMLALASLHADELTKAPGAHEGEEELIP------------KGSEPIAQEEPVTTRRESFT 242
           GMLA+ASLH+ ELT+ PG  E E E +P            + SE   Q  P    ++SF 
Sbjct: 191 GMLAMASLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNSPT---KDSFI 247

Query: 243 FSG 245
           F+G
Sbjct: 248 FNG 250

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  268 bits (684), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 171/234 (73%), Gaps = 5/234 (2%)

Query: 13  TSMGHIRSSSVSLLAE-VNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDM 71
            S GH R+SSVSLL E  +  +++   +D+ KV+IYS +  YE  LA LV SVD +KPDM
Sbjct: 14  VSAGHKRASSVSLLQEGTDAAALA---EDLKKVRIYSGIVEYEDTLAALVESVDSYKPDM 70

Query: 72  NAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNA 131
             A+ L++ D+ LF +LD F+EYD+I   L +L  +S  LD +T++IL  LNECHDELN 
Sbjct: 71  AVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNK 130

Query: 132 LPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDA 191
           LP L+QV+FEM+TIL+QR KINSS LLDYATKLSKFT+IPPTFDKGSIGPNNFIWPAEDA
Sbjct: 131 LPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDA 190

Query: 192 LRRGMLALASLHADELTKAPGAHEGEEELIPKGSEPIAQEEPVT-TRRESFTFS 244
           LR+GMLA+A+LH+ ELT+ PG  + E++        + +  PVT  RR SF F 
Sbjct: 191 LRKGMLAIAALHSRELTRIPGQDDAEDKKKQTEKPDVPEPAPVTEERRSSFVFG 244

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  269 bits (688), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 182/256 (71%), Gaps = 21/256 (8%)

Query: 12  TTSMGHIRSSSVSLLAEVNPN----------SISND--EDDISKVQIYSDLCSYEQKLAN 59
           TTS  H+R+SSVSLLAE   N          S  ND  +D +S+V+IY D+ +YE+ L+ 
Sbjct: 35  TTSANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSR 94

Query: 60  LVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEIL 119
           L++SVDKFKP++N A+ELI+ D+ LF TL+SF +YD+ID  LK L  ++ ++D  T+  L
Sbjct: 95  LIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTL 154

Query: 120 GILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSI 179
             LNECHD+LN LP L Q+EFE+ TIL QR+KINS++LLDYATKLSKFTKIPPTFDKGSI
Sbjct: 155 QTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSI 214

Query: 180 GPNNFIWPAEDALRRGMLALASLHADELTKAPGAHE--GEEELIPKGSEPIAQEEPVTT- 236
           GPNNFIWPAED+LRRGMLA+ASL AD+LT  PG  +   +E+ +P   +   ++      
Sbjct: 215 GPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPTEVQETQEQTQTQQQ 274

Query: 237 ------RRESFTFSGK 246
                 RRESF FSGK
Sbjct: 275 DQEEQPRRESFVFSGK 290

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  261 bits (666), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 134/253 (52%), Positives = 172/253 (67%), Gaps = 19/253 (7%)

Query: 14  SMGHIRSSSVSLLAEVNPNSISNDED---------DISKVQIYSDLCSYEQKLANLVNSV 64
           ++GH +SSS+SLL E    SI+N  +          I+KV IYSDL  YE+ L+ L+ S+
Sbjct: 5   TLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQSI 64

Query: 65  DKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNE 124
           D +KPD   A+ELI++D  LF +LDSF +YD+I + LK    +  E   +TKEIL  LNE
Sbjct: 65  DTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLNE 124

Query: 125 CHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNF 184
           CH+ LN LP + QV FEM T+L+QR KINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNF
Sbjct: 125 CHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNF 184

Query: 185 IWPAEDALRRGMLALASLHADELTKAPGAHEG----------EEELIPKGSEPIAQEEPV 234
           +WPAEDALRRGMLALA+ H DELTK  G              E + +  G  PI +++  
Sbjct: 185 VWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPEKKDS 244

Query: 235 TTRRESFTFSGKT 247
           ++RR S+ F+G++
Sbjct: 245 SSRRGSYIFAGQS 257

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  253 bits (646), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 155/197 (78%), Gaps = 2/197 (1%)

Query: 23  VSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDR 82
           +SL+AE N  +IS  E ++ KVQ+YSDLC YE+ L  LV+SVD FKP +   ++LIE D+
Sbjct: 1   MSLVAESNSGTIS--EQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADK 58

Query: 83  HLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEM 142
            L+ TLD   +YD +   L+ L+ E  ++D +TK IL ILNECHD+LNALP+L++VEFE 
Sbjct: 59  KLYSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEK 118

Query: 143 ETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASL 202
           + IL+QR KI S+VLL+YATKL+KFTKIPPTFDKG+IGPNNFIWPAEDALR+GMLA+ASL
Sbjct: 119 KMILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASL 178

Query: 203 HADELTKAPGAHEGEEE 219
           H  ELTK PG  +GEE+
Sbjct: 179 HGKELTKLPGQEDGEED 195

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  244 bits (623), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 162/236 (68%), Gaps = 10/236 (4%)

Query: 20  SSSVSLLAEVNPNSISN-DEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELI 78
           S+S+       P   S+ +++ +  V IY DLC YE+ L  LV SVDKF+PD+ AA+ELI
Sbjct: 25  STSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELI 84

Query: 79  EVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQV 138
           E+D  L+  L    +YD ID+ LKKL  ES ++D RT +ILGIL EC+++LN+LPM++QV
Sbjct: 85  EIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQV 144

Query: 139 EFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLA 198
           EFEM T+ +Q+ K+NSSVLL+YA KLSKFT++PPTF+K +IGPNNFIWPAEDA+RRGMLA
Sbjct: 145 EFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLA 204

Query: 199 LASLHADELTKAPGAHEGEEELIPKGSEPIAQEEPVTT---------RRESFTFSG 245
           +ASL + ELT  PG  + E E    G E       V+T         RR SF F+G
Sbjct: 205 MASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTG 260

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  241 bits (616), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 162/221 (73%), Gaps = 9/221 (4%)

Query: 1   MSSQENTLLGSTTSMGHIR--SSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLA 58
           MS   NTL       GH +  S+S+S    +  N+  NDE  +SK+Q Y+DL  YE+ L+
Sbjct: 1   MSDFHNTL----PHHGHHKTLSTSISEGDVLQDNNDKNDE--LSKIQTYNDLIQYEETLS 54

Query: 59  NLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEI 118
            L +SVDK+KPD+  A +LI++DR L+ TLDSF +YD+I   LKKL  ++  LD +TK +
Sbjct: 55  KLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSV 114

Query: 119 LGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGS 178
           L  LN+CH+ LN LPML+QVEFE  T+L+QR KINS VLLDYATKL+KFTKIPPTF+K +
Sbjct: 115 LDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNT 174

Query: 179 IGPNNFIWPAEDALRRGMLALASLHADELTKAPGAHEGEEE 219
           +GPNNFIWPAEDALRRGMLA+AS H +ELT  PG+  G+EE
Sbjct: 175 LGPNNFIWPAEDALRRGMLAVASAHTEELTALPGS-VGDEE 214

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  238 bits (607), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 154/215 (71%), Gaps = 5/215 (2%)

Query: 35  SNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEY 94
           +N E  +SK QIYSD+C +E+ L  LV SVDKF PD+  A  LIEVD+ L +TL+S   Y
Sbjct: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75

Query: 95  DKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINS 154
           D+ID   K+L+ + +E D R   IL  L EC  +LNALPML+QVEFE +T+L+QR K+ +
Sbjct: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135

Query: 155 SVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAP--G 212
           +VLLDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA+RRGMLA+ASL A E  K P  G
Sbjct: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPETG 195

Query: 213 AHEGEEELI--PKGSEPIAQEEPVTTRRESFTFSG 245
           A +  EE    P+ S  +  EEP+  RR+SF F+G
Sbjct: 196 AAQTAEETTKQPQSSPQLKVEEPM-QRRDSFEFNG 229

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  239 bits (610), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 107/182 (58%), Positives = 142/182 (78%)

Query: 31  PNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDS 90
           P+    D+D +S+V++Y+D+C YE+ L  LV+SVDKFKPD+  A+ELIE D+ LF+ L+ 
Sbjct: 34  PHQHDQDQDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEE 93

Query: 91  FEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRS 150
           F +YDKID  L  L  +S E+D +T +IL +LN CH +LN+LP L+QV  E +T+L+QR 
Sbjct: 94  FPKYDKIDGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQRE 153

Query: 151 KINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKA 210
           KI S VLLDYA KL+KFT++PPTFDKG +GPNNFIWPAEDA+RRGMLA+ASL + ELT+ 
Sbjct: 154 KIYSGVLLDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRI 213

Query: 211 PG 212
           PG
Sbjct: 214 PG 215

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  227 bits (579), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 156/216 (72%), Gaps = 8/216 (3%)

Query: 39  DDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKID 98
           D ++ V IY+D+ +YE  L  LV+S+D F+PD+  A+ LIEVD+ L++ L SF+EYD+ID
Sbjct: 55  DSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEID 114

Query: 99  NSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLL 158
             + K+  +S +LD +TK IL ILN+  + LN+LPML+++ FE + + +++ KINS +LL
Sbjct: 115 TKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILL 174

Query: 159 DYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAPG--AHEG 216
           DYATK+SKFTKIPPTF+KGSIGPNNFIWPAEDALRRGMLA+AS+H  ELTK P   +++ 
Sbjct: 175 DYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDS 234

Query: 217 EEEL------IPKGSEPIAQEEPVTTRRESFTFSGK 246
           ++EL         G+E   + +    + ESF F GK
Sbjct: 235 DKELEEQQEQEQHGTENTREADVEQEQEESFVFDGK 270

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  224 bits (572), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 120/247 (48%), Positives = 157/247 (63%), Gaps = 25/247 (10%)

Query: 12  TTSMGHIRSSSVSLLAEVNPNSISND--EDDISKVQIYSDLCSYEQKLANLVNSVDKFKP 69
           +TS GH            NP    +D  E+ +SK+Q+Y+D+C +E  L  LV SVD+F P
Sbjct: 2   STSTGH-----------RNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNP 50

Query: 70  DMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDEL 129
           D+  AR LIE D+ L+++L+   +YD+ID   K L+ E  + D +T  IL  L EC  +L
Sbjct: 51  DLELARALIEADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDL 110

Query: 130 NALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAE 189
           NALPML+QVEFE ET+L+QR K+ + VLLDYA KL+KFT +PPTFDKG++GPNNF+WPAE
Sbjct: 111 NALPMLEQVEFERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAE 170

Query: 190 DALRRGMLALASLHADELTKAPGAH-EGEEELIPKGSE----------PIAQEEPVTTRR 238
           DA+RRGMLA+ASL A E   A       E++   K SE          P  +EEPV  RR
Sbjct: 171 DAMRRGMLAIASLRASEGANAQEQQASSEQKTSEKSSENEEAQTDIRSPDTKEEPV-ARR 229

Query: 239 ESFTFSG 245
            SF F G
Sbjct: 230 PSFGFDG 236

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  208 bits (530), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 113/227 (49%), Positives = 157/227 (69%), Gaps = 16/227 (7%)

Query: 35  SNDE-DDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEE 93
           +NDE + + +V +Y DLC +E+ L  LV SVDKF PD+ AA++LI  D  L+ TL+    
Sbjct: 15  NNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPL 74

Query: 94  YDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKIN 153
           YD ID  LK+L+ ES E+D RT +IL IL++C++ LN LPM++QVEFEM+ + +Q+ KI 
Sbjct: 75  YDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIK 134

Query: 154 SSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAP-- 211
           S VLL+YA KL+KFT++PPTF+K +IGPNNFIWPAEDA+RRGMLA+ASL ++ELT+ P  
Sbjct: 135 SGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVE 194

Query: 212 ------------GAHEGEEELIPKGSEPIAQEEPVTTRRESFTFSGK 246
                       G  + E+E+ P  S      +P  ++ ESF F+GK
Sbjct: 195 LNSEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKP-DSKSESFEFTGK 240

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  200 bits (508), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 134/194 (69%), Gaps = 6/194 (3%)

Query: 45  QIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKL 104
           Q+Y DL  YE+ L  LV SVD+F+PD++ AREL+E DR L ++LD F  YD++D  L++L
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 105 NAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKL 164
           + ES  L+  T   L  L+EC+  L+ALPML+QV+FE   +L+QR ++NS+VLL+YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 165 SKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAPGAHEGEEELIPKG 224
           SKFTK P      ++GPNNF+WPAEDALRRG LA+A+LH++E+T       GE     + 
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEITL---GSTGERSGSVES 176

Query: 225 SEPIAQEEPVTTRR 238
           SEP+   E    R+
Sbjct: 177 SEPVQPSESAEPRK 190

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  201 bits (512), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 126/169 (74%)

Query: 39  DDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKID 98
           +++  V IY DL  YE+ +  L  SVD FKPD++   ++IE D+ L++TL+ F+EY KI+
Sbjct: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIE 89

Query: 99  NSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLL 158
             L +L+ E   +D +T+EIL  LN C++ LN LPML+QVEFE + +L+QR KI+S V+L
Sbjct: 90  EELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149

Query: 159 DYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADEL 207
           DYA KL+KFT+ PPTFDK  IGPNNFIWPAED+LR+GMLA+ASL   EL
Sbjct: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKEL 198

>KAFR0A01320 Chr1 complement(252704..258001) [5298 bp, 1765 aa] {ON}
           Anc_1.253 YJL109C
          Length = 1765

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 40/85 (47%), Gaps = 12/85 (14%)

Query: 56  KLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDS-------FEEYDKID-----NSLKK 103
           KL+N+VN ++K K +    R LI    HL + LD        FE + KI+     N LK 
Sbjct: 364 KLSNIVNILEKVKLEKFEVRMLIIDLIHLSEILDDKSQLIQLFEYFIKINEKLVINCLKS 423

Query: 104 LNAESIELDARTKEILGILNECHDE 128
           LN      + R    L  LNE +DE
Sbjct: 424 LNLTPELFEIRLTTSLFTLNEINDE 448

>CAGL0J04686g Chr10 complement(446347..447576) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q06410 Saccharomyces cerevisiae
           YLR423c
          Length = 409

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 12/91 (13%)

Query: 45  QIYSDLCSYEQKLA---NLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSL 101
           ++ ++   Y + LA    +  S++KFK       + I++ + L++  D FE      NS 
Sbjct: 284 ELIANCTKYSEYLAIFKGIATSIEKFKE---GCMQDIQLTKELYKFYDEFE------NSY 334

Query: 102 KKLNAESIELDARTKEILGILNECHDELNAL 132
            KL  E     A ++++LGI+  C +EL  L
Sbjct: 335 NKLLQEVQRRRALSQKMLGIIKNCENELKTL 365

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
            SMC2Subunit of the condensin complex; essential SMC
            chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase; Smc2p/Smc4p complex
            binds DNA; required for clustering of tRNA genes at the
            nucleolus
          Length = 1170

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 79/162 (48%), Gaps = 33/162 (20%)

Query: 52   SYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIEL 111
            S E +L  LV+ ++K+K + N   ++IE    L Q  +  E++D + N +K+   E I+L
Sbjct: 907  SSELELQKLVHDLNKYKSNTNNMEKIIE---DLRQKHEFLEDFDLVRNIVKQ--NEGIDL 961

Query: 112  DA---RTKEILGILNECHDEL------NALPMLKQVEFE-------METILQQRSKINSS 155
            D    R+K+    LNE   EL      N + M++ VE +       ++TI + + KI  +
Sbjct: 962  DTYRERSKQ----LNEKFQELRKKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQET 1017

Query: 156  V--LLDYATKLSKFTKIPPTFDKGSIG----PNNF--IWPAE 189
            +  L +Y  +    T    T D G+I     PN+F  + P E
Sbjct: 1018 ISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCE 1059

>KAFR0K01520 Chr11 (315301..318942) [3642 bp, 1213 aa] {ON}
           Anc_3.426 YGR090W
          Length = 1213

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 41  ISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNS 100
            S  Q++  +  Y   +    N   +F  D+N A  L +  +  FQT   F++  K+ N 
Sbjct: 400 FSSYQLFKGVIKYLATMDLCDNGHLQFHSDINYAASLSKYVQEGFQTPTLFDKTTKV-NI 458

Query: 101 LKKLNAESIE-LDARTKEILGILNECHDE------LNALPMLKQVEFEM 142
           L K+ A S + L    KE L +LN    +      L  +  L Q++++M
Sbjct: 459 LTKMTASSYQALKVYAKETLAMLNNVVQDQFSNIFLTNIGKLDQLKYDM 507

>ZYRO0D12298g Chr4 (1033584..1034732) [1149 bp, 382 aa] {ON}
          similar to uniprot|P32611 YEL050C Saccharomyces
          cerevisiae RML2 Mitochondrial ribosomal protein of the
          large subunit
          Length = 382

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 26 LAEVNPN--SISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKP 69
          + E+NP    I  D DD++ ++   DL    +KLA  +  + K KP
Sbjct: 42 IPEINPQMLKIVPDNDDVATLEKQDDLIKRRRKLAKEITVMKKLKP 87

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 82  RHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEIL-GILNECHDELNALPMLKQVEF 140
           + L + L+  E +  I+   K L  + +E   + + +L G+L++CHD +N L   K    
Sbjct: 279 KQLQEQLEKLESHRDINGKFKSLETDKVE--EKGQNVLNGLLDDCHDLVNDLSHQKDGGI 336

Query: 141 EMETILQ 147
            ++T LQ
Sbjct: 337 SLDTKLQ 343

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,178,322
Number of extensions: 1158874
Number of successful extensions: 4557
Number of sequences better than 10.0: 151
Number of HSP's gapped: 4764
Number of HSP's successfully gapped: 155
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)