Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F002206.14ON69552124470.0
SAKL0E01012g6.14ON54452716700.0
NDAI0K028806.14ON70450816460.0
Smik_5.276.14ON60845116020.0
Skud_5.296.14ON60845616010.0
YEL060C (PRB1)6.14ON63544315950.0
Kwal_56.223876.14ON54352415850.0
Suva_5.76.14ON66443815810.0
KLTH0C11396g6.14ON55053915380.0
TBLA0A073006.14ON57344115300.0
TDEL0G045506.14ON56442115140.0
KLLA0D00979g6.14ON56152214870.0
ZYRO0C07942g6.14ON54853014710.0
KAFR0L003606.14ON50241813930.0
Kpol_1032.56.14ON68049514030.0
CAGL0B03619g6.14ON46842713780.0
ACR012C6.14ON54152213660.0
KNAG0E009206.14ON53152313580.0
Ecym_30186.14ON57553013600.0
Kpol_1045.756.14ON47741913351e-178
TPHA0M002306.14ON58542812531e-164
Suva_15.1786.14ON47641311851e-156
Smik_15.1726.14ON47841511811e-155
Skud_15.1646.14ON48241311741e-154
YOR003W (YSP3)6.14ON47841411291e-147
CAGL0E02651g6.14ON48541410121e-130
KAFR0B065506.14ON45641410031e-129
NCAS0D026306.14ON4514188991e-113
NDAI0I022806.14ON4824668055e-99
KNAG0F02970singletonON4204237795e-96
CAGL0L13266gsingletonON5794237523e-90
NCAS0D043906.313ON4923844892e-53
TDEL0A072806.313ON4363654563e-49
SAKL0A02002g6.313ON4794114569e-49
ZYRO0D08822g6.313ON4904164472e-47
Kpol_1028.616.313ON5183174464e-47
Suva_3.846.313ON5273484394e-46
Smik_3.1496.313ON4913274313e-45
Skud_3.1246.313ON5403484291e-44
KLTH0A06094g6.313ON4963154243e-44
KNAG0I024706.313ON4753934224e-44
YCR045C (RRT12)6.313ON4913274172e-43
KAFR0J024506.313ON4783574074e-42
TBLA0F039706.313ON7343184165e-42
CAGL0L10802g6.313ON5173404078e-42
Kpol_1018.56.313ON4653164048e-42
Kwal_23.61836.313ON4934114031e-41
TPHA0D037606.313ON6073174073e-41
Ecym_21056.313ON6103223984e-40
NDAI0I005606.313ON4834003909e-40
AAR069W6.313ON7683243944e-39
KLLA0F06028g6.313ON5083183601e-35
Kwal_33.133721.78ON3773063202e-31
Kpol_2000.691.78ON3863043123e-30
TBLA0A067006.313ON4973203033e-28
KLTH0F02288g1.78ON3803102931e-27
ZYRO0F16764g1.78ON3863022575e-23
TDEL0C062301.78ON3642902104e-17
TPHA0B045201.78ON3882692114e-17
TBLA0A054101.78ON3822841936e-15
ZYRO0F15598g2.6ON79063800.53
SAKL0G00440g2.6ON83663800.57
NDAI0F038902.6ON83367771.3
TBLA0B001302.6ON84259771.3
NCAS0A008802.6ON83367752.3
KAFR0A080402.6ON76663752.4
Ecym_46857.390ON77861742.7
Skud_14.1012.6ON81966725.2
Kpol_1015.82.6ON84364716.8
Kwal_56.248002.6ON80363717.0
KLTH0H00418g2.6ON81163717.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00220
         (695 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   947   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   647   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   638   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   621   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   621   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   619   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   615   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   613   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   597   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   593   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   587   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   577   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   571   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   541   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   545   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   535   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   530   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   527   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   528   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   518   e-178
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   487   e-164
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   461   e-156
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   459   e-155
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   456   e-154
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   439   e-147
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   394   e-130
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   390   e-129
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     350   e-113
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   314   5e-99
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              304   5e-96
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   294   3e-90
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   192   2e-53
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   180   3e-49
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   180   9e-49
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   176   2e-47
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   176   4e-47
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   173   4e-46
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   170   3e-45
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   169   1e-44
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   167   3e-44
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   167   4e-44
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   165   2e-43
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   161   4e-42
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   164   5e-42
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   161   8e-42
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   160   8e-42
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   159   1e-41
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   161   3e-41
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   157   4e-40
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    154   9e-40
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   156   4e-39
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   143   1e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   127   2e-31
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   124   3e-30
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   121   3e-28
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   117   1e-27
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   103   5e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    86   4e-17
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    86   4e-17
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    79   6e-15
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.53 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.57 
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    34   1.3  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    34   1.3  
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    33   2.3  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    33   2.4  
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    33   2.7  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    32   5.2  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    32   6.8  
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    32   7.0  
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    32   7.0  

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/521 (91%), Positives = 478/521 (91%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAKYSEQIIESARK 60
           MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAKYSEQIIESARK
Sbjct: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAKYSEQIIESARK 60

Query: 61  IGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHK 120
           IGKSVQDSVNLKMAPLVTPTPYPVVSG          IIPNRYIVVFKKSILPEEVDFHK
Sbjct: 61  IGKSVQDSVNLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHK 120

Query: 121 ELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLEL 180
           ELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLEL
Sbjct: 121 ELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLEL 180

Query: 181 IRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTC 240
           IRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTC
Sbjct: 181 IRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTC 240

Query: 241 YVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXX 300
           YVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYG          
Sbjct: 241 YVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAV 300

Query: 301 XXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAA 360
             LRSNGSGSMSDVIKGVEF                     NMSLGGGKSPTLDLAVNAA
Sbjct: 301 KVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAA 360

Query: 361 VDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNI 420
           VDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNI
Sbjct: 361 VDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNI 420

Query: 421 LSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINY 480
           LSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINY
Sbjct: 421 LSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINY 480

Query: 481 SSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEEDIKV 521
           SSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEEDIKV
Sbjct: 481 SSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEEDIKV 521

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%)

Query: 662 QEQISPADLAKSLGTSSDSVFQQIRDMFDRMDIL 695
           QEQISPADLAKSLGTSSDSVFQQIRDMFDRMDIL
Sbjct: 662 QEQISPADLAKSLGTSSDSVFQQIRDMFDRMDIL 695

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/527 (63%), Positives = 390/527 (74%), Gaps = 31/527 (5%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFN-DITDVVAKYSEQIIESAR 59
           MK++ T+LPIAAL  L +ALVIP + K  KD   ++ K+ N D  +V+A ++++I  +A 
Sbjct: 1   MKVQSTILPIAALTTLAAALVIPEVDKSSKD---VSVKEINSDSQEVLASFAKEITRAAA 57

Query: 60  KIGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFH 119
           + G+ V      K+APLV+ +P P              IIP+RYI+VFKK   PEE+ FH
Sbjct: 58  EKGEEV------KLAPLVS-SPQPA------------NIIPHRYIIVFKKDATPEEISFH 98

Query: 120 KELINQIQLESAAKLPKDDKFFSAS-AIEDE-----SINQGGILTTFNISNLLNGYVGYF 173
           KE+I++   ES AKL   D FF+A+    DE       ++GGI  +F+I+N+LNGY+GYF
Sbjct: 99  KEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYF 158

Query: 174 TDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDD 233
           TDEV++ IRMN  VE++EKDSLV A+EFD QN APWGL+RISHRERLNLGSFNKYLYDDD
Sbjct: 159 TDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDD 218

Query: 234 AGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXX 293
           AGKGVT YVIDTGIN  H DFN RAVWGKT+P ND+D DGNGHGTHCAGTIAS HYG   
Sbjct: 219 AGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAK 278

Query: 294 XXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTL 353
                    LRSNGSG+MSDV+KGVEF                     NMSLGGGKSP L
Sbjct: 279 NAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPAL 338

Query: 354 DLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDI 413
           DLAVNAAV AGIHFAVAAGNENQDACNTSPA+AE AITVGASTLSDDRAYFSNWGKCVDI
Sbjct: 339 DLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDI 398

Query: 414 FAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQM 473
           FAPGLN+LSTYIG + ATATLSGTSMASPHVAGLLTYFLSLQP SDSEFF  + +TPAQ+
Sbjct: 399 FAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQL 458

Query: 474 KKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEEDIK 520
           KKKLI YS+KDVL++LPE TPN LI+NG G +L D W K   EE +K
Sbjct: 459 KKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGK--SEEQVK 503

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/508 (64%), Positives = 386/508 (75%), Gaps = 24/508 (4%)

Query: 27  KEDKDKLAINNKKFNDITDVVAKYSEQIIESARKIGKSVQDSVN------------LKMA 74
           K   D   ++N K++DI     KYS+QIIESARK+  +  ++              +K+A
Sbjct: 161 KRPDDNKQVSNDKYSDI---FHKYSKQIIESARKLKDNTPNAAGKDQDQDDQDDQDIKLA 217

Query: 75  PLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKL 134
           PL+TPT                 I+PN+YI+VFK SI  +E+ +HKELI++IQ +SA++L
Sbjct: 218 PLITPT---FGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRL 274

Query: 135 PKDDKFF-SASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKD 193
           P    FF S S  E+ES   GGI+++FNI+N+L+GY GYFT EV++LIR+NPLV+YVE+D
Sbjct: 275 PPHHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERD 334

Query: 194 SLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHND 253
           S+VQ TEF+ QNNAPWGL+RISHRERLNLGSFNKYLYDDDAGKGVTC+VIDTGIN  H D
Sbjct: 335 SIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVD 394

Query: 254 FNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSD 313
           F KRA+WGKTIP ND+DIDGNGHGTHCAGTIASTHYG            LRSNGSGSMSD
Sbjct: 395 FGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSD 454

Query: 314 VIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGN 373
           VIKGVEF                     NMSLGGGKSPTLDLAVNAAV+AGIHF+VAAGN
Sbjct: 455 VIKGVEF-AAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGN 513

Query: 374 ENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGD-DDATA 432
           ENQDACN+SPASAE AITVGASTLSDDRAYFSNWG+CVD+FAPGLNILSTY+GD +D TA
Sbjct: 514 ENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTA 573

Query: 433 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPT---ELTPAQMKKKLINYSSKDVLFDL 489
           TLSGTSMASPHVAGLLTYFLSLQP S S FF+     ++TP Q+KKKLI YS+ D+L+DL
Sbjct: 574 TLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDL 633

Query: 490 PEGTPNKLIFNGAGGNLDDLWNKKSQEE 517
           P+GTPNKLI+NGAGG++ DLWN K QE+
Sbjct: 634 PDGTPNKLIYNGAGGDISDLWNGKVQEQ 661

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/451 (66%), Positives = 351/451 (77%), Gaps = 13/451 (2%)

Query: 70  NLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLE 129
           N K+APLV+   +               IIPNRYIVVFKK +  EEV+FHKE ++Q QL+
Sbjct: 131 NNKLAPLVSTAQF--------NPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQ 182

Query: 130 SAAKLPKDDKFFSASAIEDESINQ-GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVE 188
           S   L  +D FF+++     S ++ GGI  +FNI N+ +GY+GYFT E+++LIR NPLV+
Sbjct: 183 SVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVD 242

Query: 189 YVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGIN 248
           +VE+DS+V+ATEFD QN+APWGLARISHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N
Sbjct: 243 FVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN 302

Query: 249 TEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGS 308
             H DF KRA+WGKTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGS
Sbjct: 303 INHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGS 362

Query: 309 GSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFA 368
           G+MSDV+KGVE+                     NMSLGGGKSP LDLAVNAAV+AGIHFA
Sbjct: 363 GTMSDVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFA 422

Query: 369 VAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDD 428
           VAAGNENQDACNTSPASA++AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIG D
Sbjct: 423 VAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD 482

Query: 429 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVL 486
           +ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+KKKLI+YS+KD+L
Sbjct: 483 EATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL 542

Query: 487 FDLPEGTPNKLIFNGAGGNLDDLWN--KKSQ 515
           FD+PE TPN LI+NG G +L   WN  KKS 
Sbjct: 543 FDIPEDTPNFLIYNGGGQDLSAFWNDTKKSH 573

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 9/49 (18%)

Query: 1  MKIEKTVLPIAALAALGSALVIPN---------LAKEDKDKLAINNKKF 40
          MK+E T+  + AL ++ +ALVIPN         L  +DKD+    N KF
Sbjct: 1  MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKF 49

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/456 (66%), Positives = 349/456 (76%), Gaps = 13/456 (2%)

Query: 70  NLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLE 129
           N K+APLV+   +   +           IIPNRYI+VFKK +  E  DFHKE ++Q QL+
Sbjct: 131 NEKLAPLVSTAQFDPAA--------MPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQ 182

Query: 130 SAAKLPKDDKFFSASAIEDESINQ-GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVE 188
           S   L  +D FF ++     S ++ GGI  +FNI N+ +GY+GYFT E+++LIR NPLV+
Sbjct: 183 SVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVD 242

Query: 189 YVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGIN 248
           +VE+DS+V+AT+FD QN+APWGLARISHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N
Sbjct: 243 FVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN 302

Query: 249 TEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGS 308
             H DF KRA+WGKTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGS
Sbjct: 303 VNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGS 362

Query: 309 GSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFA 368
           G+MSDV+KGVE+                     NMSLGGGKSP LDLAVNAAV+AGIHFA
Sbjct: 363 GTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFA 422

Query: 369 VAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDD 428
           VAAGNENQDACNTSPASA++AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG D
Sbjct: 423 VAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSD 482

Query: 429 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVL 486
           DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+K KLI+YS+KD+L
Sbjct: 483 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDIL 542

Query: 487 FDLPEGTPNKLIFNGAGGNLDDLWN--KKSQEEDIK 520
           FD+PE TPN LI+NG G +L   WN  KKS     K
Sbjct: 543 FDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFK 578

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%)

Query: 1  MKIEKTVLPIAALAALGSALVIPNL 25
          MK+E T+L + AL ++ +ALVIPNL
Sbjct: 1  MKLENTLLTLGALGSISAALVIPNL 25

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/443 (67%), Positives = 343/443 (77%), Gaps = 5/443 (1%)

Query: 83  PVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFS 142
           P+VS           IIPNRYI+VFK+    EE+DFHKE + Q QL+S   L  +D FF 
Sbjct: 163 PLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFI 222

Query: 143 ASAIEDESINQ-GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEF 201
           ++     S ++ GGI  +FNI NL +GY+GYFT E+++LIR NPLV++VE+DS+V+ATEF
Sbjct: 223 STKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEF 282

Query: 202 DNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWG 261
           D QN+APWGLARISHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N  H DF KRA+WG
Sbjct: 283 DTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWG 342

Query: 262 KTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFX 321
           KTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MSDV+KGVE+ 
Sbjct: 343 KTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYA 402

Query: 322 XXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNT 381
                               NMSLGGGKSP LDLAVNAAV+ GIHFAVAAGNENQDACNT
Sbjct: 403 AKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNT 462

Query: 382 SPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMAS 441
           SPASA++AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIG DDATATLSGTSMAS
Sbjct: 463 SPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMAS 522

Query: 442 PHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPEGTPNKLIF 499
           PHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+KKKLI+YS+KD+LFD+PE TPN LI+
Sbjct: 523 PHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIY 582

Query: 500 NGAGGNLDDLWN--KKSQEEDIK 520
           NG G +L   WN  KKS     K
Sbjct: 583 NGGGQDLSAFWNDTKKSHSSGFK 605

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%)

Query: 1  MKIEKTVLPIAALAALGSALVIPNL 25
          MK+E T+  + AL ++ +ALVIPNL
Sbjct: 1  MKLENTLFTLGALGSISAALVIPNL 25

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/524 (58%), Positives = 368/524 (70%), Gaps = 28/524 (5%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAKYSEQIIESARK 60
           MK++ T LP+A +AAL SALV+P + +  KD L         + +  A   E I+ S  K
Sbjct: 1   MKLQ-TTLPVAMVAALASALVLPEVEEASKDALVA-------VEETAASLGESILSSFSK 52

Query: 61  --IGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDF 118
               K+ +    + ++PLVT                    IP+RYIVVFK  +LPEEVDF
Sbjct: 53  EVTKKAAESGAGVTLSPLVTA-------------RNMYDAIPHRYIVVFKDRVLPEEVDF 99

Query: 119 HKELINQIQLESAAKLPKDDKFFSASAIEDESI----NQGGILTTFNISNLLNGYVGYFT 174
           H E++++   +S  KL  +D FF A+  E+  I     +GGIL +F+++ +L GY+GYFT
Sbjct: 100 HMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFT 159

Query: 175 DEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDA 234
            E+++ IRMNPLV +VE+DS+V A EFD QN APWGL+RISHRE+LNLGSFNKYLYDD A
Sbjct: 160 QEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAA 219

Query: 235 GKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXX 294
           GKGVT YVIDTGIN +H DF  RA WGKT+P ND D DGNGHGTHCAGTIAS HYG    
Sbjct: 220 GKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKN 279

Query: 295 XXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLD 354
                   LRSNGSGSMSDV+KGVEF                     NMSLGGGKSP LD
Sbjct: 280 ANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALD 339

Query: 355 LAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIF 414
           +AVNAAV AGIHFAVAAGNENQDACN+SPA+AE AITVGASTL+DDRAYFSNWGKCVDIF
Sbjct: 340 MAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIF 399

Query: 415 APGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPT-ELTPAQM 473
           APGLN+LSTYIG + ATATLSGTSMASPHVAGLLTYFLSLQP SDSE+F     +TP+Q+
Sbjct: 400 APGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQL 459

Query: 474 KKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEE 517
           KKKLI YS+K+ L DLPE T N LI+NG G +LDD W K  +E+
Sbjct: 460 KKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEK 503

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/438 (67%), Positives = 340/438 (77%), Gaps = 5/438 (1%)

Query: 83  PVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF- 141
           P+VS           IIPNRYI+VFKK + PEE  FH+E + Q QL+S   L  +D FF 
Sbjct: 191 PLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFI 250

Query: 142 SASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEF 201
           S       S   GGI  +FNI +L +GY+GYFT E+++LIR NPLV++VEKDS+V+AT+F
Sbjct: 251 STRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDF 310

Query: 202 DNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWG 261
           D QN+APWGLAR+SHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N  H DF KRA+WG
Sbjct: 311 DTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWG 370

Query: 262 KTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFX 321
           KTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MSDV+KGVE+ 
Sbjct: 371 KTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYA 430

Query: 322 XXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNT 381
                               NMSLGGGKSP LDLAVNAAV+AGIHFAVAAGNENQDACNT
Sbjct: 431 AKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNT 490

Query: 382 SPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMAS 441
           SPASA++AITVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG D+ATATLSGTSMAS
Sbjct: 491 SPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMAS 550

Query: 442 PHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPEGTPNKLIF 499
           PHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+KKKLI+YS+KD+LFD+P+ TPN LI+
Sbjct: 551 PHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIY 610

Query: 500 NGAGGNLDDLWN--KKSQ 515
           NG G +L   WN  KKS 
Sbjct: 611 NGGGQDLSAFWNDTKKSH 628

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/539 (57%), Positives = 388/539 (71%), Gaps = 43/539 (7%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDIT----DVVAKYSEQIIE 56
           MK++ T LP+A +A++G+ALV+P+L +E  + +A+   K  D+      +V+ +S+Q+ +
Sbjct: 1   MKLQ-TALPVAVVASVGAALVLPDL-EEASNTVAL---KVKDVITAGESIVSSFSKQMTK 55

Query: 57  SARKIGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEV 116
            A   G+SV+      ++PLV+ +   +              IP+RYIVVFK+++ PEEV
Sbjct: 56  DAASKGESVE------LSPLVSSSGKYLA-------------IPHRYIVVFKQNLSPEEV 96

Query: 117 DFHKELINQIQLESAAKLPKDDKFFSASA--IEDESI------------NQGGILTTFNI 162
           DFHK+++++  L+S AKL    +FF+++   +ED                +GGI  +F++
Sbjct: 97  DFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDV 156

Query: 163 SNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNL 222
           S LL GY+GYFTDE+++ IRMNPLV++VE+DS+V A EF  QN APWGL+RISHRE+LNL
Sbjct: 157 SGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNL 216

Query: 223 GSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAG 282
           GSFNKYLYDDDAGKGVT YVIDTG+N +H DF  RA WGKTIP ND D DGNGHGTHCAG
Sbjct: 217 GSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAG 276

Query: 283 TIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXN 342
           TIAS HYG            LRSNGSGSMSDV+KGVEF                     N
Sbjct: 277 TIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTAN 336

Query: 343 MSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRA 402
           MSLGGGKSP LD+AVNAAV AGIHFAVAAGNENQDACN+SPASAE A+TVGASTL+DDRA
Sbjct: 337 MSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDRA 396

Query: 403 YFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEF 462
           YFSNWGKCVDIFAPGLN+LSTYIG D ATATLSGTSMASPHVAGLLTYFLSLQP SDSE+
Sbjct: 397 YFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEY 456

Query: 463 FDPT-ELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEEDIK 520
           F     +TP+Q+KKKLI YS+K+VL D+P+ T N LIFNG G  LDD W K+S  ++++
Sbjct: 457 FHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVE 515

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 339/441 (76%), Gaps = 17/441 (3%)

Query: 73  MAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAA 132
           +APL + + +P              IIP+RYI+ FKK + PEE+DFH++ IN++Q +S A
Sbjct: 111 IAPLYSQSLHP------------QNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIA 158

Query: 133 KLPKDDKFFSASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEK 192
           +LP D  +F++  +E   + Q  I+ +FNI++LL GY+GYFTD+V++ IR+NPLV++VE+
Sbjct: 159 QLPHDHPYFNS--VEGLDLQQP-IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQ 215

Query: 193 DSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHN 252
           DS V   EFD QN APWGLARISHRERLNLGSFNKYL+DD AG+GVT YVIDTG+N EHN
Sbjct: 216 DSTVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHN 275

Query: 253 DFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 312
           DF  RA WGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSGSMS
Sbjct: 276 DFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMS 335

Query: 313 DVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAG 372
           DV+KGVE+                     NMSLGGGKSP+LDLAVNAAV AGIHFAVAAG
Sbjct: 336 DVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAG 395

Query: 373 NENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATA 432
           NENQDACNTSPASA+ AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIG DDATA
Sbjct: 396 NENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA 455

Query: 433 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLP 490
           TLSGTSMASPHVAGLL+YFLSLQP  DSEF    +  +TPAQ+KK+LI+Y +KD+L D+P
Sbjct: 456 TLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIP 515

Query: 491 EGTPNKLIFNGAGGNLDDLWN 511
           E TPN L+FNGAG +L D WN
Sbjct: 516 ELTPNVLVFNGAGQDLSDFWN 536

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/421 (68%), Positives = 324/421 (76%), Gaps = 7/421 (1%)

Query: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILT 158
            P+RYIVV K S  PEE+  H E I Q QL+S  +L +DD FFSA  +       GGI  
Sbjct: 111 FPHRYIVVLKHSS-PEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVR----TTGGIQD 165

Query: 159 TFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRE 218
           +F+++ LLNGYVGYFTD V+ELIR +P+V++VE DS V A+EFD QN APWGL+RISHRE
Sbjct: 166 SFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRE 225

Query: 219 RLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGT 278
           RLNLGSFNKYL+DD+AGKGVT YVIDTGIN +H DF  RA WGKTIP ND+D+DGNGHGT
Sbjct: 226 RLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGT 285

Query: 279 HCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXX 338
           HCAGTIAS HYG            LRSNGSGSMSDVIKGVEF                  
Sbjct: 286 HCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKG 345

Query: 339 XXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLS 398
              NMSLGGGKSP LDLAVNAAV AGIHFAVAAGNENQDACNTSPA+AE+A+TVGASTLS
Sbjct: 346 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLS 405

Query: 399 DDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGS 458
           DDRAYFSN+GKCVDIFAPGLNILSTYIG DDATATLSGTSMASPHVAGLLTYFLSLQP S
Sbjct: 406 DDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDS 465

Query: 459 DSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQE 516
           DS+FFD     +TP Q+KKKLI YS+KD+L+DLPE TPN LI+NG G  L   W+   ++
Sbjct: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQ 525

Query: 517 E 517
           E
Sbjct: 526 E 526

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 22/27 (81%)

Query: 669 DLAKSLGTSSDSVFQQIRDMFDRMDIL 695
           +L+ +LG  +D++F Q+RD+ DR++I+
Sbjct: 538 ELSDNLGAKTDALFDQVRDVLDRLNII 564

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/522 (56%), Positives = 364/522 (69%), Gaps = 15/522 (2%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDK--DK-LAINNKKFNDITDVVAKYSEQIIES 57
           MK E T+L I AL+ + +ALVIP + +E+K  DK +AI +   +D+       + +    
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60

Query: 58  ARKIGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVD 117
           +R  G+        K+ P+   +    +             IPNRYI+VFKK    +EV 
Sbjct: 61  SR--GRCADSKKFDKLRPVDDAS---AILAPLSTVNDIANKIPNRYIIVFKKDASADEVK 115

Query: 118 FHKELINQIQLESAAKLPKDDKFFSASAIEDESIN------QGGILTTFNISNLLNGYVG 171
           FH+EL++    ++   L  +D FF+A++ E           +GGI  +F+I+  L+GYVG
Sbjct: 116 FHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVG 175

Query: 172 YFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYD 231
           YFT EV++ IR +PLVE+VE+DS+V +  F+ QN+APWGLARISHRE+LNLGSFNKYLYD
Sbjct: 176 YFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYD 235

Query: 232 DDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGX 291
           DDAGKGVT YV+DTG+N  H DF+ RAVWGKTIP +D D+DGNGHGTHCAGTI S HYG 
Sbjct: 236 DDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGV 295

Query: 292 XXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSP 351
                      LRSNGSG+MSDV+KGVE+                     NMSLGGGKSP
Sbjct: 296 AKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSP 355

Query: 352 TLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCV 411
            LDLAVNAAV AG+HFAVAAGNENQDACNTSPA+AE AITVGASTLSD+RAYFSNWGKCV
Sbjct: 356 ALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCV 415

Query: 412 DIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPT-ELTP 470
           DIF PGLNILSTYIG D ATATLSGTSMA+PHV GLLTYFLSLQP +DSE+F     +TP
Sbjct: 416 DIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITP 475

Query: 471 AQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNK 512
           +Q+KKKLI++S+K+VL DLPE T N LI+NG G +LDDLW K
Sbjct: 476 SQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGK 517

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/530 (55%), Positives = 361/530 (68%), Gaps = 29/530 (5%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDK-DKLAINNKKFNDITDVVAKYSE------Q 53
           MK +K+V+P+A LA LGSAL+IP L   ++ +K        N+   VVA   E      +
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60

Query: 54  IIESARKIGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILP 113
           +   A K+ + VQD    + APLV P                  ++ NRYI++FKK + P
Sbjct: 61  LAVFASKLTQEVQD----RFAPLVVP-------------EDTLGVLENRYIILFKKGVNP 103

Query: 114 EEVDFHKELINQIQLESAAKLPKDDKFFSA---SAIEDESINQGGILTTFNISNLLNGYV 170
           +E+ FH+ELI Q+ L+  ++LP++  FF       + D  +  GGI  TF+I+ +L GY 
Sbjct: 104 QEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPL--GGIDHTFDINGMLMGYS 161

Query: 171 GYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLY 230
           GYF  +VL++IRM+PL+E VE+DS+V   + D +N APWGLARISHRERLNLGS+NKYLY
Sbjct: 162 GYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLY 221

Query: 231 DDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYG 290
           D+  G GVT YVIDTG+N  HN F  RA WGKTIP  D D DGNGHGTHCAGTI S+ YG
Sbjct: 222 DEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYG 281

Query: 291 XXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKS 350
                       LRSNGSGSMSDV+KGVE+                     NMSLGGGKS
Sbjct: 282 VAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKS 341

Query: 351 PTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKC 410
           P+LD AVNAAV AG++FAVAAGNE+QDACNTSPASA   ITVGASTLSDDRAYFSN+GKC
Sbjct: 342 PSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKC 401

Query: 411 VDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTP 470
           VD+FAPGLNILSTYIG D +TATLSGTSMASPHVAGLL YFLSLQPGSDSEF   + ++P
Sbjct: 402 VDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISP 461

Query: 471 AQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEEDIK 520
            Q+KKKL+ +S+KDVL D+P GTPN LI+NG GG+L   W  K   ++++
Sbjct: 462 DQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKEVAQELE 511

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 669 DLAKSLGTSSDSVFQQIRDMFDRMDIL 695
           DL   LG+ +D+VF QIR + DR+DI+
Sbjct: 522 DLVDELGSKTDAVFGQIRGLMDRLDII 548

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 316/418 (75%), Gaps = 6/418 (1%)

Query: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIE-DESINQ--G 154
           IIP+RYI+VFK  +  E++ FHKELI  + L+ ++    D   +  + I   ES+ Q  G
Sbjct: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLG 116

Query: 155 GILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARI 214
           GI++ F+IS+LL+GY+ Y +DE+L  IR+NPL+ ++E D++V  T+F+ QNNAPWGLARI
Sbjct: 117 GIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARI 176

Query: 215 SHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGN 274
           SHRE LNL +FNKYLYDDDAGK V  YVIDTG++  H +F+ RA WGKTIPLND+DIDGN
Sbjct: 177 SHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGN 236

Query: 275 GHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXX 334
           GHGTH AGTI S HYG            LRSNGSGSMSDV+KGVEF              
Sbjct: 237 GHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEF-AVSSHLERMKNEK 295

Query: 335 XXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394
                  NMSLGGGKSP LDLAVNAAV AGIHFAVAAGNENQ+ACN+SPASAE+A+TVGA
Sbjct: 296 NLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA 355

Query: 395 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIG-DDDATATLSGTSMASPHVAGLLTYFLS 453
           ST+SD+RAYFSNWG+CVDIFAPGLNILSTYIG +DD TATLSGTSMASPHVAGLL Y+LS
Sbjct: 356 STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLS 415

Query: 454 LQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWN 511
           LQP   SE F    ++ +Q+KKKLI Y++KDVL DLPEGTPN LI+NG G +L D WN
Sbjct: 416 LQPEKSSE-FSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWN 472

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/495 (56%), Positives = 351/495 (70%), Gaps = 40/495 (8%)

Query: 27  KEDKDKLAINNKKFNDITDVVAKYSEQIIESARKIGKSVQDSVNLKMAPL--VTPTPYPV 84
           K +  K  + N K +D  D+V   ++QI ESA K G+ V      K APL  +  T Y  
Sbjct: 178 KHNPPKQPVYNIKEDD--DIVDSVTQQIFESAEKSGEKV------KYAPLHSMENTKYEN 229

Query: 85  VSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSAS 144
           +            +IPN+YI+VFKK +  +++  HK+LI + Q             F  +
Sbjct: 230 L------------VIPNKYIIVFKKDVSVKDMQIHKDLIARAQ-------------FQYA 264

Query: 145 AIEDESINQ--GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFD 202
           ++ DE+ +   GGI   FN++NL +GY+G+F +++++ IR++P+V++VE+DS+V A E D
Sbjct: 265 SVSDETSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVD 324

Query: 203 NQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGK 262
            QNNAPWGLARISHR+ LNLGS+NKYLYDD AG+GVT YVIDTGIN +H +F  RAVWGK
Sbjct: 325 TQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGK 384

Query: 263 TIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXX 322
           TIP ND+D+DGNGHGTHCAGTIAS +YG            LRS+GSG+MSDV+KGVE+  
Sbjct: 385 TIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAA 444

Query: 323 XXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTS 382
                              NMSLGGGKS +LDLAV+AAV +GIHFAVAAGNENQDACN+S
Sbjct: 445 FSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSS 504

Query: 383 PASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASP 442
           PA++E AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIG D+ATATLSGTSMASP
Sbjct: 505 PAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASP 564

Query: 443 HVAGLLTYFLSLQPGSDSEFFD--PTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFN 500
           HVAGLL+YFLS+QP +DSEFF      ++PAQ+KKKLI YS+K++  DLPE TPN L++N
Sbjct: 565 HVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN 624

Query: 501 GAGGNLDDLWNKKSQ 515
            AG N+ D W  KS+
Sbjct: 625 -AGHNISDFWKPKSE 638

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 25/32 (78%)

Query: 1  MKIEKTVLPIAALAALGSALVIPNLAKEDKDK 32
          MK++KT++ +A LA LGS+LVIP  A++  DK
Sbjct: 1  MKLDKTLVSVATLATLGSSLVIPEFARDLDDK 32

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/427 (63%), Positives = 323/427 (75%), Gaps = 13/427 (3%)

Query: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAK---LPKDDKFFSASAIEDESINQG 154
           ++P++YIVV KK + PE V      +N +    AA    LPK+  FF+   +  E + +G
Sbjct: 1   MVPHKYIVVLKKGVSPEAV---ATFLNDVSAAHAAAIRDLPKEHDFFNF--VNAEGLPRG 55

Query: 155 GILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARI 214
           GI   FNI++L  G +GYF + V++L+  + +VE+VE+DS+V A+ FD QNNAPWGLARI
Sbjct: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115

Query: 215 SHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGN 274
           SHR+RLNLG+FNKYLYD+  G+GVT YVIDTGIN +H +F+ RA WGKTIPLND DIDGN
Sbjct: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175

Query: 275 GHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXX 334
           GHGTHCAGTIAS HYG            L+S+GSG+MSDVIKGVE+              
Sbjct: 176 GHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEY-AAQAHLKESKNNK 234

Query: 335 XXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394
                  NMSLGGGKSP LD+AVNAAV AGIHFAVAAGNENQDACNTSPASAE+AITVGA
Sbjct: 235 KFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294

Query: 395 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDD-ATATLSGTSMASPHVAGLLTYFLS 453
           STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGD +  TA+LSGTSMASPHVAGLLTYFLS
Sbjct: 295 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354

Query: 454 LQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPE-GTPNKLIFNGAGGNLDDLW 510
           LQP SDSEF+D ++  +TPAQ+KKKLI YS+K+VL DLP+  +PN LI+NGAGG+L   W
Sbjct: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

Query: 511 NKKSQEE 517
           N  S +E
Sbjct: 415 NSTSADE 421

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/522 (50%), Positives = 342/522 (65%), Gaps = 34/522 (6%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAKYSEQIIESARK 60
           MK+++ V P  AL    + L++P    + +D+L +       +   +A+ +++     RK
Sbjct: 1   MKLQRAVWPAVALTTAQALLILP----QAEDELVVAEAHRGQLVQWMARENQE-----RK 51

Query: 61  IGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHK 120
              + Q S   ++  +                      IP++YIVVF++ +  EE  FH 
Sbjct: 52  AQGAEQQSPLFRVDDVTRA-------------------IPHKYIVVFREGVSDEEAAFHM 92

Query: 121 ELINQIQLESAAKLPKDDKFFSASAIEDESIN------QGGILTTFNISNLLNGYVGYFT 174
           EL+     ES A+L +   FF ++  E+          +GGI   F +   L GYVGYFT
Sbjct: 93  ELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFT 152

Query: 175 DEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDA 234
           ++++ L+R NP V +VE+DS+V A++F  QN APWGLAR+SHRE+LN GSFNKYLYDD++
Sbjct: 153 EDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNS 212

Query: 235 GKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXX 294
           G+GVT YVIDTGIN +H DF  RA+WGKTIP ND D DGNGHGTHCAGTIAS  YG    
Sbjct: 213 GEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKK 272

Query: 295 XXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLD 354
                   LRSNG+GSMSDV++GVE+                     NMSLGGG+S  LD
Sbjct: 273 ANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALD 332

Query: 355 LAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIF 414
           LAV+AAVDAGIHFAVAAGNENQDACNTSPA++++AITVGASTL+DDRAYFSNWG+CVD+F
Sbjct: 333 LAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLF 392

Query: 415 APGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMK 474
           APG+NILSTYIG D A ATLSGTSMASPHVAGLLTYFLSLQP  DSEF +   ++P  +K
Sbjct: 393 APGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLK 452

Query: 475 KKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQE 516
           KK+I++ +KD L  LP  T N LI+NG G +L D W  K ++
Sbjct: 453 KKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKK 494

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/523 (53%), Positives = 336/523 (64%), Gaps = 33/523 (6%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAK-------YSEQ 53
           MKI + VL   AL  +  ALV+P +  E       +  + +D+ +   +         E+
Sbjct: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEK 60

Query: 54  IIESARKIGKSVQDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILP 113
                 K GK   D   L  APL TP                     N+YI++FK+ +  
Sbjct: 61  DEHRPCKHGKEAHDEEEL--APLYTP----------GSALSASSSRSNKYIILFKEGVTA 108

Query: 114 EEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILTTFNISNLLNGYVGYF 173
           E++  HK+L+ Q+ LE++          SA  I  +      +L +F++  +L+GYV   
Sbjct: 109 EQISAHKQLLQQVLLETSD--------VSAQGIVAD------VLDSFDLEGVLSGYVAEL 154

Query: 174 TDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDD 233
           +  VLEL+R +P V+ VE+DS V   EFD QNNAPWGLARISHR+ L+LGSFNKYLYDD 
Sbjct: 155 SPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDA 214

Query: 234 AGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXX 293
           AG+GV  Y+IDTGIN +H +F  RA WGKTIP ND D DGNGHGTHCAGTIAS HYG   
Sbjct: 215 AGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAK 274

Query: 294 XXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTL 353
                    LRSNGSGSMSDVI GVEF                     NMSLGGGKSP+L
Sbjct: 275 RANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSL 334

Query: 354 DLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDI 413
           D  V+AAV  G+HF+VAAGNENQDACNTSPA++ERAITVGASTLSDDRAYFSNWG CVDI
Sbjct: 335 DRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDI 394

Query: 414 FAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQM 473
           FAPGLNILSTY G DDATATLSGTSMASPHVAGLLTYFLSLQP   S+F    ++TP Q+
Sbjct: 395 FAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQL 454

Query: 474 KKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQE 516
           KKKL++YS+K VLFDLPE TPN LI+NG G +L D W  K ++
Sbjct: 455 KKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKK 497

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/530 (51%), Positives = 348/530 (65%), Gaps = 21/530 (3%)

Query: 1   MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAKYSEQIIESARK 60
           MK++  VLP+A  + LG+AL++P +  E +  + ++ +  +    V   +  ++ E  R 
Sbjct: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHG--RVPPPHHHKMGEHGRG 58

Query: 61  IGKSVQDSVNL--------KMAPLVTPTPYP----VVSGXXXXXXXXXXIIPNRYIVVFK 108
            GK      ++        K++P+     +      V             IP+RYIV+FK
Sbjct: 59  RGKGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFK 118

Query: 109 KSILPEEVDFHKELINQIQLESAAKLPKDDKFFSAS-AIEDESIN----QGGILTTFNIS 163
             +   +V  H++L+    +E+ A+L     FF A+  +  E I+    +GGI   F I+
Sbjct: 119 DGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIA 178

Query: 164 NLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLG 223
             L GY GYFTD +L+LIR + LV+ +E+DS+V A++F+ Q  APWGLAR+SHRERLNLG
Sbjct: 179 GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLG 238

Query: 224 SFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGT 283
           SFNKYLYDD+AGKGVT YVIDTGIN +H +F  RA WGKTIP ND D DGNGHGTHCAGT
Sbjct: 239 SFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 298

Query: 284 IASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNM 343
           IAS  YG            LR+NG+G+MSDV++GVE+                     NM
Sbjct: 299 IASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTA--NM 356

Query: 344 SLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAY 403
           SLGGGKS  L+LAV+AAV AGIHFAVAAGNENQDACNTSPAS+++ ITV ASTLSDDRAY
Sbjct: 357 SLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAY 416

Query: 404 FSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFF 463
           FSNWG CVDIFAPGLNILSTYIG D A ATLSGTSMASPHVAGLL YFLSLQP S SE++
Sbjct: 417 FSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYY 476

Query: 464 DPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKK 513
             + ++P  +KKK++ Y SK++L ++P  T N LIFNG GG+LD  WN K
Sbjct: 477 TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSK 526

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  518 bits (1335), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 253/419 (60%), Positives = 302/419 (72%), Gaps = 7/419 (1%)

Query: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQ--GG 155
           +IP  YIVVF + +   E+  H E ++Q+QL+S   LP D +FF+ S   D + N   GG
Sbjct: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGG 93

Query: 156 ILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARIS 215
           +   F I N L+GY G FTDEV+E +R++PLV+++E+DS+V  TE   Q NAPWGLARIS
Sbjct: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153

Query: 216 HRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNG 275
           HR RLNL +FNKYLYDD  GKGV  YVIDTGIN  + DF  RA WGKTIP  + ++DGNG
Sbjct: 154 HRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNG 213

Query: 276 HGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXX 335
           HGTH AGTIAS HYG            LRSNG+GSMSDV+KGVE+               
Sbjct: 214 HGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEY--VVGAHQRDVGTAG 271

Query: 336 XXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAS 395
                 NMSLGGGKS +LDLAVNAAV AG+HFAVAAGNENQDACNTSPA+AERAITVGAS
Sbjct: 272 FKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVGAS 331

Query: 396 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQ 455
           TLSD RAYFSNWG+CV IFAPGLNILSTYIG  DATATLSGTSMASPH+AGL+ YFLSLQ
Sbjct: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQ 391

Query: 456 PGSDSEFF---DPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWN 511
           P   S+F+     T +TP Q+KKK++ + +K+ L DLP  TPN + +NGAG +L+D WN
Sbjct: 392 PAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN 450

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  487 bits (1253), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 252/428 (58%), Positives = 307/428 (71%), Gaps = 13/428 (3%)

Query: 101 NRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILTTF 160
           +RYI+VFKK +  E+VD H ++++ +     ++  +      ASA+ D       ++ TF
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMMSAL-FRRLSEEQRPAAAPGASALRDGFDR---VMDTF 189

Query: 161 NISNLLNGYVGYFTD-EVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRER 219
            ++   +GY+      ++++ IR+NPLV+YVEKDS+V + + + QNNAPWGLARISHRE 
Sbjct: 190 EVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREG 248

Query: 220 LNLGSFNKYLY-DDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGT 278
           LNLG+FNKYLY  + AGKGVT YV+DTGI+  H +F +RA WGKTIP+ND DIDGNGHGT
Sbjct: 249 LNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGT 308

Query: 279 HCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXX 338
           HCAGTI S HYG            LRS+GSG+MSDV+KGVE+                  
Sbjct: 309 HCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNS 368

Query: 339 ----XXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394
                  NMSLGGGKSP LD AVNAAV AG+HFAVAAGNENQDACN+SPA+AE AITVGA
Sbjct: 369 NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA 428

Query: 395 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSL 454
           STLSDDRAYFSN+GKCVDIFAPGLNILSTYIG +DATATLSGTSMASPHVAGLLTY LSL
Sbjct: 429 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488

Query: 455 QPGSDSEFFDP-TELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKK 513
           QP   SEF+ P +ELTP QMKKK+I+Y++K+ L DLP  TPNKLI+NG G N  D W   
Sbjct: 489 QPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNSTDFWASA 547

Query: 514 SQEEDIKV 521
           +  +  KV
Sbjct: 548 AAPQSHKV 555

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  461 bits (1185), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 293/413 (70%), Gaps = 4/413 (0%)

Query: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF-SASAIEDESINQGGIL 157
           +P RYI+ F +      ++ HK +I ++Q ES +KL KDD FF S SA  D  +  GGI 
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSD--LQFGGID 124

Query: 158 TTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHR 217
           + F+I+ L  GY GYFT+EV++ +  +P+++++E++S V+ T    Q  APWGL RISHR
Sbjct: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 218 ERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHG 277
           E+   G   +YLY+D AG+GVT YV+DTGI+  H DF  RAVWG  IP ND+  D NGHG
Sbjct: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244

Query: 278 THCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXX 337
           THCAG I S H+G            LRSNG G++SDVIKG+E+                 
Sbjct: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFK 304

Query: 338 XXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTL 397
               N+SLG  KSP +++AVNAAV++G+HFA+AAGNE++DAC +SPA AE++ITVGAST 
Sbjct: 305 GSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364

Query: 398 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPG 457
           SDDRA+FS+WG CVD+FAPG+NILSTYIG  +A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424

Query: 458 SDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510
           SDSEFFD T ++P Q+K+K+IN+S++ VL D+ E TPN+LI+NG G  LD+ W
Sbjct: 425 SDSEFFDST-VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  459 bits (1181), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 217/415 (52%), Positives = 295/415 (71%), Gaps = 4/415 (0%)

Query: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFS--ASAIEDESINQGG 155
           +IP RYIVVF + I  + ++ H++++ +    S +KL +DD F    +S+I  + +  GG
Sbjct: 66  LIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPD-LQLGG 124

Query: 156 ILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARIS 215
           I ++F+I+ L  GY GYFTDE+L L+  +PL++++E++S V+ +    Q +APWGL RIS
Sbjct: 125 IDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRIS 184

Query: 216 HRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNG 275
           HRE+   G   +YLY+D AG+GVT YV+DTGI+TEH DF  RAVWG  IP ND+  D NG
Sbjct: 185 HREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG 244

Query: 276 HGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXX 335
           HGTHCAG I S HYG            LRSNG G++SDVIKG+E+               
Sbjct: 245 HGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKE 304

Query: 336 XXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAS 395
                 N+SLG  KS  +++AV+AAVD+G+HFA+AAGNEN+DAC +SPA A+++ITVGAS
Sbjct: 305 FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGAS 364

Query: 396 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQ 455
           T SDDRA+FSNWG CVD+FAPG+NI+STYIG  +AT +LSGTSMA+PHVAG+L+YFLSLQ
Sbjct: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQ 424

Query: 456 PGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510
           P  DSE+FD   L+P ++K+K++ +S+  VL D+ + TPN+LI+NG G  LDDLW
Sbjct: 425 PAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  456 bits (1174), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 216/413 (52%), Positives = 287/413 (69%), Gaps = 2/413 (0%)

Query: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF-SASAIEDESINQGGIL 157
           +P RYI+VF + I    ++ H ++I + Q  S +K+ +DD F  + SA    +   GGI 
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128

Query: 158 TTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHR 217
            +F+I+ L  GY GYFTDEV+E++  +PLV+++E +S V+ +    Q +APWGL RISHR
Sbjct: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188

Query: 218 ERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHG 277
           ER   G   +YLY+D AG GVT YV+DTGI+TEH DF  RA WG  IP ND+  D NGHG
Sbjct: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248

Query: 278 THCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXX 337
           THCAG I S H+G            LRSNG G++SDVIKG+E+                 
Sbjct: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKFK 308

Query: 338 XXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTL 397
               N+SLG  KSP +++AVNAAVD G+HFA+AAGNE++DAC +SPA AE++ITVGAST 
Sbjct: 309 GSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368

Query: 398 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPG 457
           SDDRA+FSNWG CVD+FAPG+NI+STYIG  +AT +LSGTSMA+PHVAG+L+Y LSLQP 
Sbjct: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428

Query: 458 SDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510
            DSEFF  T ++P Q+K+K++ +S++ VL D+ E TPN+L++NG G  LD+ W
Sbjct: 429 QDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  439 bits (1129), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 286/414 (69%), Gaps = 2/414 (0%)

Query: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQ-GGI 156
            +P RY++VF + I  +++  H +++ +    S  KL ++D F+   +    S +Q GGI
Sbjct: 66  FLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFGGI 125

Query: 157 LTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISH 216
              F+I+ L  GY GYFTDE++++I  +P++++VE+++ V+ +    Q  APWGL R+SH
Sbjct: 126 DNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRVSH 185

Query: 217 RERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGH 276
           RE+   G   +YLY+D AGKGVT YV+DTGI+TEH DF  RA WG  IP ND+  D NGH
Sbjct: 186 REKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNGH 245

Query: 277 GTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXX 336
           GTHCAG I S H+G            LRSNG G++SDVIKG+E+                
Sbjct: 246 GTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEF 305

Query: 337 XXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAST 396
                N+SLG  KS  +++AVNAAVD+G+HFA+AAGNE++DAC +SPA AE++ITVGAST
Sbjct: 306 KGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 365

Query: 397 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQP 456
            SDDRA+FSNWG CVD+FAPG+NI+STYIG  +AT +LSGTSMASPHVAG+L+YFLSLQP
Sbjct: 366 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQP 425

Query: 457 GSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510
             DSEFF+    +P ++K+K++ +S++ VL D+ + TPNKLI+NG G  LD  W
Sbjct: 426 APDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  394 bits (1012), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 264/414 (63%), Gaps = 4/414 (0%)

Query: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGIL 157
           IIPNRYIV+FK  +  +E+  H   I +I   S++   +D  F  A+   D S    G+ 
Sbjct: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEIN--SSSIFLQDSDFGKATQYNDISTRGIGLQ 130

Query: 158 TTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHR 217
             F+I   + GY+GYFT+   + I  +PLVE VE DS+V+   +  Q + PWGL RIS R
Sbjct: 131 HEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQR 190

Query: 218 ERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHG 277
           E+L +     Y YDD  GK    +VIDTGI  +H DF  RA WGKTI  ND D D NGHG
Sbjct: 191 EKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250

Query: 278 THCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXX 337
           THCAGTIAS HYG            LRS+GSGSMSDVI+GVE+                 
Sbjct: 251 THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYNDLKKTKSNLK 309

Query: 338 XXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTL 397
               NMSLG  KS  L+ A++AA  AGI FAVAAGNE+ DACN+SPASA   ITVG STL
Sbjct: 310 GAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGSTL 369

Query: 398 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPG 457
           SDD A+FSN+G+CVDIFAPG+NI+STYIG  +AT +LSGTSM+SPHVAG+L Y+LSLQP 
Sbjct: 370 SDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPD 429

Query: 458 SDSEFF-DPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510
             S+F+ + + ++P  +KKK++NY++   L  LP  T N L++NG G NL   W
Sbjct: 430 HKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  390 bits (1003), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 204/414 (49%), Positives = 259/414 (62%), Gaps = 20/414 (4%)

Query: 98  IIPNRYIVVFKKSILPEEVDFH-KELINQIQLESAAKLPKDDKFFSASAIEDESINQGGI 156
           II ++YIV+FK S +  E + H K+L N I+  S     KDD                  
Sbjct: 59  IIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDD--------------HKSN 104

Query: 157 LTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISH 216
           L  F I   L+GY+     E L+L+R +P+V+ +E DS V A +   Q + PWGL+RIS 
Sbjct: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164

Query: 217 RERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGH 276
           R R+ +G    Y YDD     VT YV+DTGI   H  FN RA WGKTI  ND D D +GH
Sbjct: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224

Query: 277 GTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXX 336
           GTH AG IAS  +G            LRSNG G MSDV+KG+EF                
Sbjct: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYSKGSV 284

Query: 337 XXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAST 396
                N+SLG  KSP L LA++AA+   IHFAVAAGNEN DAC TSPA A RAITVGAS 
Sbjct: 285 V----NLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340

Query: 397 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQP 456
            SD+RA+FSNWG+CVD+FAPG+N++STYIG D+AT +LSGTS A+P+ AGL+ Y+LSLQP
Sbjct: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 457 GSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510
             DS +F   E+TP+++K+K++ + SKDVL++LPE TPN +I+NGAG NL   W
Sbjct: 401 DKDSGYF-TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 182/418 (43%), Positives = 247/418 (59%), Gaps = 25/418 (5%)

Query: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILT 158
           IPN+YIV+FK      + + H   +N   L +                      Q  IL 
Sbjct: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDP--------------------QYTILH 92

Query: 159 TFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRE 218
           +F +++ L GY     ++++  +  +P+++ +E+DS V A     Q ++PWGLARIS RE
Sbjct: 93  SFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRE 152

Query: 219 RLNLGSFNKYLYDDD-AGKGVTCYVIDTGINTEHNDFNKRAVWGKTI-PLNDKDIDGNGH 276
           RL L     Y YDD  A     CY++DTGIN  HN+F  RA WG    P+     D NGH
Sbjct: 153 RLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGH 212

Query: 277 GTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXX-XXX 335
           GTHCAG I S  YG            L + G G MS VI+G+E+                
Sbjct: 213 GTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTG 272

Query: 336 XXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAS 395
                 N+SLG GKSP L   + AAV  G+HFAVAAGNE+ DAC+TSPA +  A+TVGAS
Sbjct: 273 FKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGAS 332

Query: 396 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIG-DDDATATLSGTSMASPHVAGLLTYFLSL 454
           + SDDR +FSNWG CVD+FAPG+NI+STYIG  ++ T +LSGTSM++P V GL+ YFLSL
Sbjct: 333 SFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSL 392

Query: 455 QPGSDSEFFDP-TELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWN 511
           QP + S+F+   T  TP Q+K K+I++S++ VL ++PEGTPN++++NG G +L D WN
Sbjct: 393 QPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  314 bits (805), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 186/466 (39%), Positives = 265/466 (56%), Gaps = 40/466 (8%)

Query: 66  QDSVNLKMAPLVTPTPYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQ 125
           +D+++    P + PT  P               IP++YIV+F+      ++   ++ ++ 
Sbjct: 41  RDTLDKNQIPFIIPTHGP-----------QKNFIPDQYIVLFENDTTDLQISRFEQFLSS 89

Query: 126 IQLESAAKLPKDDKFFSASAIEDESINQGGILTTFNISNLLNGYVGYF-TDEVLELIRMN 184
           +  E   K   +D             N   +L+ F ISN   G +     D+ LE ++ N
Sbjct: 90  LIEEDNQKYNVND-------------NYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNN 136

Query: 185 -----PLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDD-AGKGV 238
                 +++ +E+DS V   +F  Q ++ WGL+RIS R  L L     Y YDD+ +GKGV
Sbjct: 137 IFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGV 196

Query: 239 TCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGXXXXXXX 297
            CY++DTGIN+ H +F  RA WG ++P+ +  + D NGHGTHCAG I S  YG       
Sbjct: 197 DCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNL 256

Query: 298 XXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXX------XXXXXXXXXXNMSLGGGKSP 351
                L   G GSMSDVI G+EF                           N+SLG  KSP
Sbjct: 257 IAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSP 316

Query: 352 TLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCV 411
           +LD+A+ +A   GIH  VAAGNE++DAC TSPA +   ITVGAS+ SDDRA+FSNWG CV
Sbjct: 317 SLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCV 376

Query: 412 DIFAPGLNILSTYIG-DDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTP 470
           D+FAPG+NI STYIG +++ T +LSG+SM+SP V+GL  Y+LSLQP   S+F D + +TP
Sbjct: 377 DVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHD-SLMTP 435

Query: 471 AQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQE 516
            Q+K+K+I++S+  +L +LP  T NKL++NG G +L   WN   +E
Sbjct: 436 DQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  304 bits (779), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 171/423 (40%), Positives = 236/423 (55%), Gaps = 30/423 (7%)

Query: 81  PYPVVSGXXXXXXXXXXIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKF 140
           P   +SG           I N ++V+FK  +  EEV+    ++       A + P     
Sbjct: 23  PLADLSGEHRFFMSGKSTILNEFLVMFKPMVDREEVEVGLSVL-------AGRFPLAQ-- 73

Query: 141 FSASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATE 200
           F    I DE I  G  +  F   N+      YF  ++       P VE VE +S V A  
Sbjct: 74  FEQFHIADELI--GFTVKNFPFHNV------YFLLQI-------PFVEMVETNSKVYALN 118

Query: 201 FDNQNNAPWGLARISHRERLNLGSFNKYLYDDD-AGKGVTCYVIDTGINTEHNDFNKRAV 259
              Q + PWGL R+S R+R+ +G    Y YD   + K V  Y++DTGI  +H +F  RA 
Sbjct: 119 VTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRAR 178

Query: 260 WGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVE 319
           WGKTI  ND D D NGHGTHCAG +    YG            L + G G MSDVI+G+E
Sbjct: 179 WGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIE 238

Query: 320 FXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDAC 379
           F                     N+SLG G+SP L   V AA++ G+HFAVAAGNE+ +AC
Sbjct: 239 FAVNEHLTRNQDEVRGSII---NLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNAC 295

Query: 380 NTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG-DDDATATLSGTS 438
            +SPA+ +  +TVG ST SDDRA+FSNWG C+D+FAPG+N+ S+Y+G   + T +LSGTS
Sbjct: 296 YSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTS 355

Query: 439 MASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLI 498
            ++PHVAGL+ Y LSL+P + S+F       PAQ+K+KL++ +++  LF++P+ T N +I
Sbjct: 356 TSAPHVAGLMAYLLSLEPDTKSQFHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMI 414

Query: 499 FNG 501
           FNG
Sbjct: 415 FNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  294 bits (752), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 159/423 (37%), Positives = 240/423 (56%), Gaps = 9/423 (2%)

Query: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQ-GGI 156
           I+P RYIV+FK      E+  H + + ++QL  +  L  +D FF  +  ++ S  + GG+
Sbjct: 68  IVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFSTEELGGV 127

Query: 157 LTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISH 216
           L TF+I +  NGYVGYFTDEV+E IR   +V+YVE DS++   + +  +N+ W LARISH
Sbjct: 128 LYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLARISH 187

Query: 217 RERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGH 276
           R +L L +FN+Y +D + G+ +  Y++DTG+   H  + +R + G  I  N+ + D NGH
Sbjct: 188 RPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDMNGH 247

Query: 277 GTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXX 336
           GT  AG +     G            L   G G++S++IKG+ F                
Sbjct: 248 GTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEKNGVLG 307

Query: 337 XXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAST 396
                  S+ G KS +L+ A +  V +GIH  V AG +  +ACN+SPAS+ + ITV   +
Sbjct: 308 AVVL--FSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVAGMS 365

Query: 397 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATAT----LSGTSMASPHVAGLLTYFL 452
           ++D+     NWG CVDI+ PG  + +TY   +    T    ++G+S A+  VAGLL YF 
Sbjct: 366 ITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLAYFA 425

Query: 453 SLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNK 512
           SLQPG  +   D   LTP ++K++LI++ +K  L +L   +PN + FNGAGGNLD  +N 
Sbjct: 426 SLQPGLGTP--DVIPLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDSFFND 483

Query: 513 KSQ 515
            S+
Sbjct: 484 GSE 486

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  192 bits (489), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 149/384 (38%), Positives = 189/384 (49%), Gaps = 57/384 (14%)

Query: 156 ILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATE-------------FD 202
           I  TF+I +   G+    TD++LE I+ NPLV  V  +  V A E             FD
Sbjct: 58  IGKTFSIGSF-KGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFD 116

Query: 203 N-----------QNNAPWGLARISHRERL---------NLGSFNKYLYDDDA-GKGVTCY 241
           N           Q  AP  LAR+S R++L          L S  KY YD  + G  V  Y
Sbjct: 117 NKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAY 175

Query: 242 VIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXX 301
           +ID+GI  EH +FN RA+ G  +   +   D NGHGTH AG + S  YG           
Sbjct: 176 IIDSGIYLEHEEFNGRAIPGIDLT-GEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIK 234

Query: 302 XLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAV 361
            L   G GS++ V+ G+EF                     N+SLG  ++  L+ A+ AA+
Sbjct: 235 VLNRLGQGSLAMVLGGIEFAVKHCQETSKKGRCVA-----NLSLGSMRTAILNKAIKAAI 289

Query: 362 DAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDIFAPG 417
           DAG+   VAAGN N +AC  SPASA  AITVGA    DDR    A FSNWG+C+DIFAPG
Sbjct: 290 DAGLVVVVAAGNNNLNACWYSPASAPEAITVGAF---DDRIDAIAKFSNWGQCLDIFAPG 346

Query: 418 LNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKL 477
           + I S  I  D    T SGTSMASP VAGL    L+L  G  +E     E+    ++   
Sbjct: 347 VVIKSLSIFKDKEDVTYSGTSMASPTVAGLAA--LTLDQGVSAE-----EVKDYILEMGT 399

Query: 478 INYSSKDVLFDLPEGTPNKLIFNG 501
            N   +  L   P GTPNK+ FNG
Sbjct: 400 DNVFHRRSLLFKP-GTPNKICFNG 422

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  180 bits (456), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 130/365 (35%), Positives = 172/365 (47%), Gaps = 49/365 (13%)

Query: 176 EVLELIRMNPLV-EYVEKDSLVQATEFD------------NQNNAPWGLARISHRERLNL 222
           ++++ IR +PLV E V     V   E D             Q  AP  L+R+S R +L  
Sbjct: 73  DLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPY 132

Query: 223 ----------GSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDID 272
                     GSFN Y  +   G G+  Y+IDTGI  EH +F  RAV+G+ +   +   D
Sbjct: 133 DFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDLT-GEGPGD 191

Query: 273 GNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXX 332
           GNGHGTH AG + S+ YG            L + G G+++ VI  +EF            
Sbjct: 192 GNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHCRSSEGKG 251

Query: 333 XXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITV 392
                    N+SLG  ++  ++ AV AA +AGI   VAAGN N +AC  SPASA  AITV
Sbjct: 252 CVI------NLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITV 305

Query: 393 GA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYF 451
           GA    +D  A FSNWG CVDIFAPG+ + S            SGTSMASP + GL    
Sbjct: 306 GAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAIL 365

Query: 452 LSLQPGSDSEFFDPTELTPA-QMKKKLINYSSKDVL----FDLPEGTPNKLIFNGAGGNL 506
           L              E  P  ++K  ++  ++ DV          GTPN++ FNG   N 
Sbjct: 366 LD-------------EGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKND 412

Query: 507 DDLWN 511
           D   N
Sbjct: 413 DKFSN 417

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  180 bits (456), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 137/411 (33%), Positives = 189/411 (45%), Gaps = 54/411 (13%)

Query: 121 ELINQIQLESAAKLPKDDKFFSASAIEDESINQ---GGILTTFNISNLLNGYVGYFTDEV 177
           E+IN  +     K PK    F  S I D S+       I  TF+      G+   F  + 
Sbjct: 14  EIINAEEYLVRLKSPKSLTKFMESKIGDMSLKSFVSTRISKTFSFGKF-EGFTADFPKDF 72

Query: 178 LELIRMNPLVEYVEKDSLVQ------------ATEFDNQNNAPWGLARISHRERLNLGS- 224
           +E ++ NPLV  V  +S+              +  +  Q +AP  LAR+S R  L     
Sbjct: 73  VEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLARLSRRGPLPYSEE 132

Query: 225 ------FNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGT 278
                 FN Y      G  V  Y+IDTGI  +H D   RA +G  + + +   D NGHGT
Sbjct: 133 DGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM-VGEGPGDYNGHGT 191

Query: 279 HCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXX 338
           H AG + S  +G            L + G G+++ VI  +EF                  
Sbjct: 192 HVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVNHCKKSGMLCVA---- 247

Query: 339 XXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLS 398
              N+SLG  ++  L+ AV AAV++G+   VAAGN N +AC  SPASA  AITVGA    
Sbjct: 248 ---NLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISAITVGA---F 301

Query: 399 DDR----AYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSL 454
           DDR    A FSNWG CVD+FA G+ ++S            SGTSMASP VAGL    L  
Sbjct: 302 DDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVAGLAAVLLD- 360

Query: 455 QPGSDSEFFDPTELTPAQMKKKLINYSSKDVL----FDLPEGTPNKLIFNG 501
                      + + P  +K+K+I+ ++++V          GTPN++ FNG
Sbjct: 361 -----------SGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFNG 400

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  176 bits (447), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 141/416 (33%), Positives = 190/416 (45%), Gaps = 69/416 (16%)

Query: 133 KLPKDDKFFSASAIEDESIN-----QGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLV 187
           K P   +FF  SA +D + N        I  TF+  +   G     + +V+E IR NPLV
Sbjct: 25  KSPDGFQFFMNSA-KDHTKNFKEFFHNKISHTFSFGSF-RGITVDISQDVVEKIRNNPLV 82

Query: 188 -------EYVEKDSLVQATEF------DN--------------QNNAPWGLARISHRERL 220
                  ++   D ++   E       DN              Q  AP  LAR+S R  L
Sbjct: 83  ADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGEAPRHLARLSRRAPL 142

Query: 221 NLG---------SFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI 271
                       SFN Y Y    G+ +  Y+IDTGI  EH DF  RA++G+     +   
Sbjct: 143 PYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGRAIFGRDF-TGEGPG 201

Query: 272 DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXX 331
           D NGHGTH AG + S+++G            L + G G+++ VI  VEF           
Sbjct: 202 DRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISAVEFAVNHCKSSGKK 261

Query: 332 XXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAIT 391
                     N+SLG  ++  ++ A+ AA +AG+   VAAGN N +AC  SPASA  AIT
Sbjct: 262 GCVA------NLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNINACWNSPASAPEAIT 315

Query: 392 VGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTY 450
           VGA    +D  A FSNWG CVDIFA G+ + S            SGTSMASP V GL+  
Sbjct: 316 VGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIAFSGTSMASPSVTGLVAI 375

Query: 451 FLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDV-----LFDLPEGTPNKLIFNG 501
            L               + P  +K KL+  ++ D+     LF  P GTPN++ FNG
Sbjct: 376 LLD------------KGVEPENIKAKLVELATHDLLQRRTLFFKP-GTPNRIAFNG 418

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  176 bits (446), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 155/317 (48%), Gaps = 38/317 (11%)

Query: 204 QNNAPWGLARISHRERL--------NLGSFNKYLYDDD-AGKGVTCYVIDTGINTEHNDF 254
           Q  AP  L RIS R +L            F  Y Y+D   G  +  Y++DTGI  EH DF
Sbjct: 154 QYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDF 213

Query: 255 NKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDV 314
             R + G  +   +   D NGHGTH AG + S  +G            L   GSG+++ V
Sbjct: 214 ENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTTV 272

Query: 315 IKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNE 374
           + G++F                     NMSLG  ++  ++ A++ A  AG+   VAAGN 
Sbjct: 273 LSGIQFAVDHCRLMRETQGKQCVA---NMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNS 329

Query: 375 NQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNI--LSTYIGDD 428
           N  AC TSPASA+ AITVGA    DDR    AYFSNWG CVDIFAPG+ I  LS      
Sbjct: 330 NVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESH 386

Query: 429 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFD 488
               T SGTSMASP VAGL    L               + P  +K KL++ S+KDV   
Sbjct: 387 HKHVTHSGTSMASPVVAGLAAILLD------------KGVEPFDVKDKLLHLSTKDVFNK 434

Query: 489 L----PEGTPNKLIFNG 501
           L      GTPNK+ +NG
Sbjct: 435 LTLFFKYGTPNKIAYNG 451

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  173 bits (439), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 123/348 (35%), Positives = 175/348 (50%), Gaps = 36/348 (10%)

Query: 183 MNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNL---------GSFNKYLYDDD 233
            N   +Y  +D + +A     Q +AP  LARIS   +L             FN Y  D+ 
Sbjct: 141 FNTTAKYAYQD-IDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEY 199

Query: 234 AGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGXX 292
            G+GV  Y++DTGI+ EH +F  R + G  + L  +   D NGHGTH AG + S  +G  
Sbjct: 200 QGQGVNAYIMDTGIHAEHPEFEDRVIQG--VDLTKEGFGDENGHGTHVAGLVGSRTFGAA 257

Query: 293 XXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPT 352
                     L  +GSG  S+V+ G+EF                     N+SLG  +SP 
Sbjct: 258 KKVSLVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQGKKCVA---NLSLGSFRSPI 314

Query: 353 LDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA-STLSDDRAYFSNWGKCV 411
           +++AV  A++ GI F  AAGN N DA   SPASAE  ITVGA     D  A FSNWG CV
Sbjct: 315 INMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCV 374

Query: 412 DIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPA 471
           +IFAPG+ I S    +D+ +  LSGTSM++P V G+    LS              + P 
Sbjct: 375 NIFAPGVEIESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS------------KGIEPE 422

Query: 472 QMKKKLINYSSKDV-----LFDLPEGTPNKLIFNGAGGNLDDLWNKKS 514
            + +++   S+++V     LF  P  TPN++++NG    LDD ++ ++
Sbjct: 423 LIAQEIEYLSTRNVFHRRTLFFKP-STPNQILYNGV-DKLDDPYDDET 468

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 165/327 (50%), Gaps = 35/327 (10%)

Query: 204 QNNAPWGLARISHRERLNL---------GSFNKYLYDDDAGKGVTCYVIDTGINTEHNDF 254
           Q++AP  LARIS   +L             FN Y  DD  G+ V  Y++DTGI  +H +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 255 NKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSD 313
             R + G  I L  +   D NGHGTH AG + S  YG            L  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 242

Query: 314 VIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGN 373
           V+ G+EF                     N+SLG  +SP +++AV  A++ GI F  AAGN
Sbjct: 243 VLSGLEFIVEHCTRVSRPQGKKCVA---NLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 374 ENQDACNTSPASAERAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATA 432
            N DA   SPASAE  ITVGA     D  A FSNWG CV+IFAPG+ I S    + + T 
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTL 359

Query: 433 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDV-----LF 487
            LSGTSM++P V G+    LS              + P  + ++L   S+++V     LF
Sbjct: 360 VLSGTSMSTPIVTGVAAVLLS------------KGIEPEMIAQELEYLSTRNVFHRRTLF 407

Query: 488 DLPEGTPNKLIFNGAGGNLDDLWNKKS 514
             P  TPN++++NG    LDD ++ ++
Sbjct: 408 FKP-STPNQILYNGV-DKLDDRYDDET 432

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  169 bits (429), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/348 (35%), Positives = 175/348 (50%), Gaps = 36/348 (10%)

Query: 183 MNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNL---------GSFNKYLYDDD 233
            N   +Y+ +D + +A     Q++AP  LARIS   +L             FN Y  DD 
Sbjct: 154 FNATAKYLYED-IDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDY 212

Query: 234 AGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGXX 292
            G+ V  Y++DTGI ++H +F  R + G  I L  +   D NGHGTH AG + S  YG  
Sbjct: 213 LGQDVNAYIMDTGIFSDHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAA 270

Query: 293 XXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPT 352
                     L  +GSG  S+V+ G+EF                     N+SLG  +SP 
Sbjct: 271 KKVNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTRVSRPQGKKCVA---NLSLGSFRSPI 327

Query: 353 LDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA-STLSDDRAYFSNWGKCV 411
           +++AV  A++ GI F  AAGN N DA   SPASAE  ITVGA     D  A FSNWG CV
Sbjct: 328 INMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCV 387

Query: 412 DIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPA 471
           +IFAPG+ I S    + + T  LSGTSM++P V G+    LS              + PA
Sbjct: 388 NIFAPGVEIESLSHLNYEDTLILSGTSMSTPIVTGVAAVLLS------------KGIEPA 435

Query: 472 QMKKKLINYSSKDV-----LFDLPEGTPNKLIFNGAGGNLDDLWNKKS 514
            + +++   S+++V     LF  P  T N++++NG    LDD +N ++
Sbjct: 436 LIAQEIEYLSTRNVFHRRTLFFKP-STANQILYNGV-DKLDDPYNDET 481

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  167 bits (424), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 157/315 (49%), Gaps = 40/315 (12%)

Query: 204 QNNAPWGLARISHR-------ERLNLGSFN-KYLYDDD-AGKGVTCYVIDTGINTEHNDF 254
           Q  AP  LARIS R       E +++ + N  Y YDD+ +G  V  YVIDTGI  EH   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 255 NKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDV 314
             RA +G  + + +   D NGHGTH AG I S  +G            L + G G+++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 315 IKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNE 374
           I  +EF                     N+SLG  ++  L+ AV AA++AG+   VAAGN 
Sbjct: 254 ISAIEFTVNHCRKSRRGCVA-------NLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 375 NQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGDDDA 430
           N +AC +SPAS+  AITVGA    DDR    A FSNWG CVDIFAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 431 TATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFD-- 488
               SGTSMASP V+G++   L             + + P  +K +LI+ ++  V     
Sbjct: 364 PVAFSGTSMASPIVSGMVANLLD------------SGIHPFDIKTELIDLATDSVFHKRT 411

Query: 489 --LPEGTPNKLIFNG 501
                GTPN++ F G
Sbjct: 412 LLFKPGTPNRVAFTG 426

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  167 bits (422), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 183/393 (46%), Gaps = 47/393 (11%)

Query: 136 KDDKFFSASAIEDESINQGG-ILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDS 194
           + ++F ++   +D     GG I   F I  L  G     + +VL+ I+ +P V+ V  + 
Sbjct: 31  RSERFMNSVLSKDLKWFMGGKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPFVKEVVPNI 89

Query: 195 LVQATEFD------------NQNNAPWGLARISHRERLNLGSFNK--------YLYDDDA 234
           +V+A E D             Q  AP  LARIS R +L     NK        Y YD  A
Sbjct: 90  MVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWA 149

Query: 235 -GKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXX 293
            G     Y++DTG+  +H +F  R  +G T    + + D NGHGTH AG + S  +G   
Sbjct: 150 QGATTRAYILDTGVMRDHKEFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAK 208

Query: 294 XXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTL 353
                    L + G+G++  ++  +EF                     NMSLG  KS  L
Sbjct: 209 HVQLVDVKCLDALGAGTLVSILSALEFAVQDCQEHEDSQCVL------NMSLGSVKSNIL 262

Query: 354 DLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDR----AYFSNWGK 409
           + A+N     GI   VAAGN N +AC TSP+SA  AITVGA    DDR    A FSNWG 
Sbjct: 263 NQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGAF---DDRFDTIAKFSNWGP 319

Query: 410 CVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFL-SLQPGSDSEFFDPTEL 468
           CVDIFAPG+N+ S    D  +    SGTSMASP V G++   L    P  D   +     
Sbjct: 320 CVDIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELA 379

Query: 469 TPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNG 501
           T    KK+ + +           GTPN +++NG
Sbjct: 380 TDGVFKKRTLVFKP---------GTPNSVLYNG 403

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  165 bits (417), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 163/327 (49%), Gaps = 35/327 (10%)

Query: 204 QNNAPWGLARISHRERLNL---------GSFNKYLYDDDAGKGVTCYVIDTGINTEHNDF 254
           Q +AP  LARIS   +L             FN Y   D  G+ V  Y++DTGI  +H +F
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 255 NKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSD 313
             R + G  I L  +   D NGHGTH AG + S  YG            L  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASN 242

Query: 314 VIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGN 373
           V+ G+EF                     N+SLG  +SP +++AV  A++ GI F  AAGN
Sbjct: 243 VLSGLEFIVEHCTKVSRPQGKKCVA---NLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 374 ENQDACNTSPASAERAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATA 432
            N DA   SPASAE  ITVGA     D  A FSNWG CV+IFAPG+ I S    + + T 
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTL 359

Query: 433 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDV-----LF 487
            LSGTSM++P V G+    LS              + P  + +++   S+++V     LF
Sbjct: 360 ILSGTSMSTPIVTGVAAILLS------------KGIEPEMIAQEIEYLSTRNVFHRRTLF 407

Query: 488 DLPEGTPNKLIFNGAGGNLDDLWNKKS 514
             P  TPN++++NG    LDD ++ ++
Sbjct: 408 FKP-STPNQILYNGV-DKLDDPYDDET 432

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  161 bits (407), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 123/357 (34%), Positives = 167/357 (46%), Gaps = 53/357 (14%)

Query: 176 EVLELIRMNPLVEYVEKDSLVQATEFDNQNN--------------APWGLARISHRERL- 220
           +++E ++ NPLV  +  + L +A E D  NN              AP  LARIS R++L 
Sbjct: 77  KIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKLP 136

Query: 221 ----NLGS----FNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDID 272
               N+ S    FN Y   +  G  V  Y++D+G++    DF  R  +G      D + D
Sbjct: 137 YDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEGD 195

Query: 273 GNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXX 332
            NGHGTH AG + S  YG            L   G G++  V+  +EF            
Sbjct: 196 SNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPEKR 255

Query: 333 XXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITV 392
                    N+SLG  K+  ++ A+ AA + G+   VAAGN N +AC TSPASAE AITV
Sbjct: 256 CVA------NLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITV 309

Query: 393 GASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLL 448
           GA    DDR    A FSNWG CVDI+APG+ + S          + SGTSMASP V G +
Sbjct: 310 GA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQV 366

Query: 449 TYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVL----FDLPEGTPNKLIFNG 501
              L     +D             +K  LI  ++ DV           TPN+++FNG
Sbjct: 367 AILLDKGIPND------------DIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  164 bits (416), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 159/318 (50%), Gaps = 34/318 (10%)

Query: 199 TEFDNQNNAPWGLARISHRERL-----NLGSFNK---YLYDD-DAGKGVTCYVIDTGINT 249
           ++F  Q  AP  LARIS R++L     N   F +   Y YDD D G+GV  YVIDTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 250 EHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSG 309
           EH DF  R  +G  +   +   D NGHGTH AG I S  YG            +   GS 
Sbjct: 342 EHKDFEDRVEFGTDLT-GEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 310 SMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAV 369
            +S +I+ +E+                     NMSLG      ++ AV +A+  G+ F V
Sbjct: 401 QLSHIIEAIEYTVNDCNSRVDKKACVV-----NMSLGSFYVKVINEAVESAIAEGVVFVV 455

Query: 370 AAGNENQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYI 425
           AAGN N DAC +SP S++ AITVGA    DDR    A FSNWG+CVDIFA G+ + S   
Sbjct: 456 AAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSS 512

Query: 426 GDDDATATLSGTSMASPHVAGLLTYFLS--LQPGSDSEFFDPTELTPAQMKKKLINYSSK 483
                    SGTSMASP V G ++  LS  ++P    E     E+     K    +++ +
Sbjct: 513 QVPYKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQE-----EMVKLSTKG---DFTRR 564

Query: 484 DVLFDLPEGTPNKLIFNG 501
            ++F     T N+++FNG
Sbjct: 565 SLIF--KPFTSNRILFNG 580

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  161 bits (407), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 115/340 (33%), Positives = 152/340 (44%), Gaps = 50/340 (14%)

Query: 204 QNNAPWGLARISHRERLNL---------GSFNKYLYDDDAGKGVTCYVIDTGINTEHNDF 254
           Q+ AP  LAR+S R +L             FN Y Y    G+ V  YV+D+G+  +H DF
Sbjct: 160 QSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCDF 219

Query: 255 NKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDV 314
             RA +G     +    D NGHGTH AG I S  YG            L S GSG++  V
Sbjct: 220 EGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDTV 279

Query: 315 IKGVEFXXXXXXXXXXXXX------------------XXXXXXXXNMSLGGGKSPTLDLA 356
           + G+EF                                       N+SLG  +S  ++ A
Sbjct: 280 MSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINEA 339

Query: 357 VNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVD 412
           +   +  GI   VAAGN N +AC TSPAS    ITVGA    DDR    A FSNWG CVD
Sbjct: 340 IEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCVD 396

Query: 413 IFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQ 472
           IFAPG+ + S            +GTSMA+P V GL+   L             + + P Q
Sbjct: 397 IFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD------------SGIKPTQ 444

Query: 473 MKKKLINYSSKDVL----FDLPEGTPNKLIFNGAGGNLDD 508
           +KK+L   ++ ++          GTPN++ FNG   + DD
Sbjct: 445 IKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDD 484

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  160 bits (404), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 154/316 (48%), Gaps = 41/316 (12%)

Query: 204 QNNAPWGLARISHRERL-----NLGSF-NKYLYDDDA---GKGVTCYVIDTGINTEHNDF 254
           Q  AP  L+R+S R +L     N+  + N + Y  DA   G  V  Y+IDTGI  EH +F
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 255 NKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDV 314
             R  +   +   +   D NGHGTH AG + S  +G            L   G G +S +
Sbjct: 175 EGRVKFAIDLT-QEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTI 233

Query: 315 IKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNE 374
           +K +EF                     N+S G  ++  +D A+  A +AGI   VAAGN 
Sbjct: 234 LKALEFTIRHCKESVDKKCVA------NLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNS 287

Query: 375 NQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILS-TYIGDDD 429
           N DAC  SPAS++  ITVGA    DDR    A FSNWG CVD+FAPG+ + S ++I   D
Sbjct: 288 NIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSD 344

Query: 430 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFD- 488
               LSGTSMASP V+G+    L               L P  +K K+I  S+K++    
Sbjct: 345 VL-LLSGTSMASPSVSGIAAILLD------------KGLNPKFVKSKIIESSTKNIFHQG 391

Query: 489 ---LPEGTPNKLIFNG 501
              +   TPN ++FNG
Sbjct: 392 TIMIKPNTPNLIVFNG 407

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  159 bits (403), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 185/411 (45%), Gaps = 77/411 (18%)

Query: 144 SAIEDESIN---QGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYV---------- 190
           S I DE +N   QG IL TF+      G+   F   ++  +R NPLV  +          
Sbjct: 38  SRINDEFLNIFSQGKILKTFSFGKF-EGFTVDFPLSLISKLRNNPLVAEIVPNVEFNVFD 96

Query: 191 -EKDSLV----------------------QATEFDNQNNAPWGLARISHRERLNLGSFN- 226
            E+D                         +  +F  Q NAP  LARIS R  L     N 
Sbjct: 97  GEEDPSYWDDDNGDDEYDEDEDEDDEDNSEFPDFVAQKNAPRHLARISRRSALPYNPENI 156

Query: 227 -------KYLYDDD-AGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGT 278
                   Y YDD   G  V  YVIDTGI  EH  F  RA +G  + + +   D NGHGT
Sbjct: 157 APKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQFQGRAKFGADL-VGEGPGDLNGHGT 215

Query: 279 HCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXX 338
           H AG I S  YG            L + G G+++ VI  +EF                  
Sbjct: 216 HVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSVISAIEFTVNHCRKSKRGCVA---- 271

Query: 339 XXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLS 398
              N+SLG  ++  L+ AV AA++AG+   VAAGN N +AC +SPAS+  AI+VGA    
Sbjct: 272 ---NLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNSNANACWSSPASSLSAISVGA---F 325

Query: 399 DDR----AYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSL 454
           DDR    A FSNWG CVD+FAPG+ I S        +   SGTSMASP V G++   L  
Sbjct: 326 DDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFKSVAYSGTSMASPLVTGMVAVLLD- 384

Query: 455 QPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFD----LPEGTPNKLIFNG 501
                      + + P  +K++LIN ++  V          GTPN++ F G
Sbjct: 385 -----------SGIHPFDIKEELINTATDSVFHKRALLFKPGTPNRVAFTG 424

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  161 bits (407), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 154/317 (48%), Gaps = 36/317 (11%)

Query: 202 DNQNNAPWGLARISHRERL--------NLGSFNKYLYDDD-AGKGVTCYVIDTGINTEHN 252
           D Q  AP  L ++S R +L            F  Y YD    G     Y+IDTG+  EH 
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 253 DFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 312
           +F  R  +G    + +   D NGHGTH AG I S  +G            L   G G+++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 313 DVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAG 372
            V++G+EF                     NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCKLKQQPMGKNCVI---NMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 373 NENQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGDD 428
           N N  AC TSPAS+  AITVGA    DDR    A FSNWG+CVDIFAPG+ I S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 429 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFD 488
           +     SGTSMASP VAGL+   +      D            ++K+KLI+ SSK +   
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILMEKGYKCD------------EIKQKLIDDSSKSIFSK 428

Query: 489 L----PEGTPNKLIFNG 501
           L      GTPN++I+NG
Sbjct: 429 LTLFFKYGTPNRVIYNG 445

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  157 bits (398), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 159/322 (49%), Gaps = 36/322 (11%)

Query: 204 QNNAPWGLARISHRERLNLGS-------FNKYLYDDDAGKGVTCYVIDTGINTEHNDFNK 256
           Q+ AP  LAR   R  L   +       FN Y   +  G+ V  Y++D+GI+  H +F  
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 257 RAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIK 316
           RAV+G     N+   D NGHGTH AG + S  YG            +  +G GS S++I 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 317 GVEFXXXXXXXXXXXXXXXXXXXXXNMSLGG---GKSPTLDLAVNAAVDAGIHFAVAAGN 373
           GVEF                     NMSLGG   G S  LD AV AA++ G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSGKKCVA-------NMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 374 ENQDACNTSPASAERAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATA 432
             + AC  SPA  + AITVGA    SD  A FSN+GKCVDIFAPG+ + S      +   
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 433 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFD---L 489
            L+GTSM++P  AG++   L               +    +K++LI+ S+K V      +
Sbjct: 501 VLNGTSMSAPITAGVVAVLLD------------QGVKHEDVKERLIDLSTKGVFHRRRLV 548

Query: 490 PEGTPNKLIFNGAGGNLDDLWN 511
              TP++ +FNG     DD++N
Sbjct: 549 SSRTPDRTLFNGV-PQEDDVFN 569

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  154 bits (390), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 179/400 (44%), Gaps = 66/400 (16%)

Query: 153 QGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDN--------- 203
            G I  TF+  +   G     T +V+  I+ NPLV  V  +  + A ++D+         
Sbjct: 53  HGKISKTFSFGSF-RGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDD 111

Query: 204 -----------------QNNAPWGLARISHRERLNLGSFNKYLYDDD---------AGKG 237
                            QN AP  LAR+S R  L     +K  Y+D           G  
Sbjct: 112 IKQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTD 171

Query: 238 VTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXX 297
           V  Y+ID+GI+    +F  RA  G  +   +   D NGHGTH AG + S  YG       
Sbjct: 172 VNAYIIDSGIDINQEEFEGRATHGLDLT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTL 230

Query: 298 XXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAV 357
                L   GSGS+  VI  +EF                     N+SLG    P L+ A+
Sbjct: 231 VEVKALDRQGSGSLITVISALEFVVNHCGKSKSKKCVA------NLSLGAFMMPLLNEAI 284

Query: 358 NAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDI 413
            A VD+G+   VAAGN N DAC  SPAS + AITVGA    DDR    A FSNWG CVDI
Sbjct: 285 KATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDI 341

Query: 414 FAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQM 473
           FAPG+ I S  I D+  +   SGTSMASP VAG+++  + L  G ++E           +
Sbjct: 342 FAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVS--ILLDQGVENE----------DI 389

Query: 474 KKKLINYSSKDVL----FDLPEGTPNKLIFNGAGGNLDDL 509
           +  L   ++ DV           TPN++ FNG     +D 
Sbjct: 390 RDYLFELATDDVFQKRTLLFKPRTPNRITFNGISKKDEDF 429

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  156 bits (394), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 113/324 (34%), Positives = 156/324 (48%), Gaps = 35/324 (10%)

Query: 204 QNNAPWGLARISHRERLNLG-------SFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNK 256
           Q +AP  LAR   R  L          +FN Y  ++  G+GV  YV+D+GI   H +F+ 
Sbjct: 428 QVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFDG 487

Query: 257 RAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIK 316
           RA +G      +   D NGHGTH AG + S  +G            +  +G GS S++I 
Sbjct: 488 RAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNIIA 546

Query: 317 GVEFXXXXXXXXXXXXXXXXXXXXXNMSLGG---GKSPTLDLAVNAAVDAGIHFAVAAGN 373
           GVEF                     NMSLGG   G S  LD AV AA++ G+ F VAAGN
Sbjct: 547 GVEFAVKHCQQSGKRCVA-------NMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 598

Query: 374 ENQDACNTSPASAERAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATA 432
             + AC  SPA  + AITVGA    SD  A FSN+GKCVDIFAPG+ + S      +   
Sbjct: 599 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTMR 658

Query: 433 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFD---L 489
            L+GTSM++P  AG++   L               + P ++K  L++ S+K +      +
Sbjct: 659 VLNGTSMSAPITAGVVAVLLDQG------------IEPHEVKDHLLSISTKGLFHKRRLV 706

Query: 490 PEGTPNKLIFNGAGGNLDDLWNKK 513
              TP++ +F G     D    +K
Sbjct: 707 SSRTPDRALFTGVKREDDSFSTEK 730

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  143 bits (360), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/318 (36%), Positives = 161/318 (50%), Gaps = 40/318 (12%)

Query: 200 EFDNQNNAPWGLARISHRERL------NLGSFNKYLYDDD-AGKGVTCYVIDTGINTEHN 252
           +F +Q+ AP  LARIS R +L      +  S  KY Y ++  G+GV  YV+D+G+N +H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 253 DFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 312
           DF  RA+ G      +   D  GHGTH AG I S  YG            L S G G+++
Sbjct: 210 DFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVT 268

Query: 313 DVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGG-GKSPTLDLAVNAAVDAGIHFAVAA 371
           ++I+G+E+                     NMSLG  G    LD AV+A ++ G+   VA 
Sbjct: 269 NIIEGLEYVVNQCIGKKRKCVI-------NMSLGAPGTHSILDKAVSAVIEEGVVVVVAG 321

Query: 372 GNENQDACNTSPASAERAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGD 427
           GN   +AC  SPA   +AITV A    DDR    A FSNWG C+DI+APG+N+ S     
Sbjct: 322 GNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-NK 377

Query: 428 DDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVL- 486
              T  LSGTSMASP VAG    +  L  G+D          PA+++K L   +++ V  
Sbjct: 378 GRGTFVLSGTSMASPIVAGAAAIY--LDQGAD----------PAEVRKILSKTATRGVFK 425

Query: 487 ---FDLPEGTPNKLIFNG 501
                +   TPNK+++ G
Sbjct: 426 KRAIAVRPRTPNKVLYTG 443

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  127 bits (320), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 145/306 (47%), Gaps = 16/306 (5%)

Query: 155 GILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARI 214
           G +   ++ N      G F   +LE +  +  +  +  D ++   E+  Q +AP  LAR+
Sbjct: 44  GGVGAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARL 103

Query: 215 SHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI--- 271
           S +  L  GS   Y+Y  + G GV  Y++DTGI+  H +   R    K   L    +   
Sbjct: 104 SQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRV--QKIADLTSNPVSHG 160

Query: 272 DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXX 331
           D +GHGT  AG I S  +G              S G+ ++  VI+ +E            
Sbjct: 161 DPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASVTQRP 220

Query: 332 XXXXXXXXXXNMSLGGGKSPTLDLAVNAAV-DAGIHFAVAAGNENQDACNTSPASAERAI 390
                            K+  L+ A+ A + D  +   VA GN NQ+AC++SPASA  A+
Sbjct: 221 SVVVIPFTMR-------KNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGAL 273

Query: 391 TVGA--STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLL 448
           T+G+   T  D  A F+N+G C+D FA G+NI S   GD ++    SGTS+++   +G++
Sbjct: 274 TIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVV 333

Query: 449 TYFLSL 454
            Y++SL
Sbjct: 334 AYYMSL 339

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  124 bits (312), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 152/304 (50%), Gaps = 24/304 (7%)

Query: 166 LNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISH---RERLNL 222
            +G+ G F DEV+  +  +P V  +  D ++   E+  QN+AP  LAR+S+     R++ 
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 223 GSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI---DGNGHGTH 279
            + N +++   AG GV  Y++D+GI+++H  F  R +  K I L D  I   D +GHGT 
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVGDPHGHGTA 179

Query: 280 CAGTIASTHYGXXXXXXXXXXXXLRSNGSG-SMSDVIKGVEFXXXXXXXXXXXXXXXXXX 338
            AG + S  +G            + +  +G  +S ++K +EF                  
Sbjct: 180 IAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIENHSRATMRPSVAV--- 236

Query: 339 XXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLS 398
               +     K+  L+ A+ +  ++ I   V AGN++  ACN SPASA  + ++ +    
Sbjct: 237 ----LPFSMSKNAILNSAIESMPNS-IAIVVPAGNQHHMACNFSPASARNSQSILSVGSL 291

Query: 399 DDR-----AYFSNWGKCVDIFAPGLN---ILSTYIGDDDATATLSGTSMASPHVAGLLTY 450
           D R     A FSN+G+CVD+F  G+    + +T   D++  + +SGTSM+    AG + Y
Sbjct: 292 DYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 451 FLSL 454
           ++SL
Sbjct: 352 YMSL 355

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 144/320 (45%), Gaps = 30/320 (9%)

Query: 200 EFDNQNNAPWGLARISHRERLNLGS---FNKYLYDDDAGKGVTCYVIDTGINTEHNDFNK 256
           ++  Q NAP  L+R S   +L   S   +N Y   D  G  VT YV+D+GI  +H +F  
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 257 RAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVI 315
           R +  +     D  + D  GHGT  AG I S  YG            L + G G++  ++
Sbjct: 201 RIL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSIL 258

Query: 316 KGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNEN 375
           +G++F                     N SLG      L+ A     +AGI    AAGN  
Sbjct: 259 QGLQFITKHCEENTNGNCII------NASLGAINIQILNKAFEEVHNAGIPVICAAGNNA 312

Query: 376 QDACNTSPASAERAITVGASTLSDDR-AYFSNWGKCVDIFAPGLNILSTYIGDDDATATL 434
            +AC  +PA ++   TVG+    DD  A FSNWG+CVD+ APG+ + +    +   +   
Sbjct: 313 VNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRES 372

Query: 435 SGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVL----FDLP 490
           SGTS+++P V GL    LS           P E    +++K      S+D+L    F   
Sbjct: 373 SGTSVSTPIVTGLAAILLSKGV--------PKENLYDEIRKM----GSRDLLRNKEFSRL 420

Query: 491 EGTPNKLIFNGAGGNLDDLW 510
            GTPN LI N      DD++
Sbjct: 421 PGTPN-LIVNIGPQKEDDVY 439

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  117 bits (293), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/310 (29%), Positives = 148/310 (47%), Gaps = 19/310 (6%)

Query: 154 GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLAR 213
           GG +    + N      G F  ++LE    +  +  +  D  +   E+  Q +AP  LAR
Sbjct: 43  GGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLAR 102

Query: 214 ISHRERLNLGSFN---KYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKD 270
           +S +  L  G+ +    Y+Y  +AG GV  Y++DTGI+  H  F  R    K    +   
Sbjct: 103 LSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQ--KAADFSSDP 160

Query: 271 I---DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXX 327
           +   D +GHGT  AG I S+ +G              S G  S+  V++ +E        
Sbjct: 161 VATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASKLAAV 220

Query: 328 XXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAV-DAGIHFAVAAGNENQDACNTSPASA 386
                          + L   ++  L+ AV A V D  I   VAAGNEN+ AC+ SPA A
Sbjct: 221 TKRPSLI-------TIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGA 273

Query: 387 ERAITVGASTLS--DDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHV 444
             A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  + D  +   LSGTS+++   
Sbjct: 274 YGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVATLGL-DHSSEHHLSGTSISAGVA 332

Query: 445 AGLLTYFLSL 454
           +GL+ Y++S+
Sbjct: 333 SGLVAYYMSI 342

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  103 bits (257), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 137/302 (45%), Gaps = 25/302 (8%)

Query: 168 GYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNK 227
            + G F+  +L+ +  +P V  + +D  ++  E   QNNAP  L  +S    L   S   
Sbjct: 56  AFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPL---SHQP 112

Query: 228 YLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI----DGNGHGTHCAGT 283
           ++Y  + G GV  Y++DTGI+ +H + +K  +  +   L    +    D  GHGT  AG 
Sbjct: 113 FIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNIL-RMADLTQSPVPQGTDPQGHGTAMAGI 171

Query: 284 IASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNM 343
           IAS  +G              SNG   +S +++ +                        +
Sbjct: 172 IASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLTQRHIEGTKRPSVVVIP-----L 226

Query: 344 SLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASA----ERAITVGASTLSD 399
            +  G +P L  A+ A+ D  +   + AGN  QDA N SPA+     +  I VG+  +++
Sbjct: 227 EVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNN 285

Query: 400 DRAYFSNWGKCVDIFAPGLNILSTYIGDDDA-------TATLSGTSMASPHVAGLLTYFL 452
           +   F+N+G  VD+F  G  I +    D D+       T  +SGTS +S   AG++ Y++
Sbjct: 286 NPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYM 345

Query: 453 SL 454
           SL
Sbjct: 346 SL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 132/290 (45%), Gaps = 21/290 (7%)

Query: 171 GYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLY 230
           G F+ E LE +  +  V  + +D  ++  E+  Q  +P  L+++S     + GSF    +
Sbjct: 58  GEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-----SGGSFT---F 109

Query: 231 DDDAGKGVTCYVIDTGINTEH---NDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIAST 287
           D  +G  V  YV DTGI+ +H    + N   +   T     +  D +GHGT  AG IAS 
Sbjct: 110 DPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADPHGHGTMMAGLIASE 169

Query: 288 HYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGG 347
            +G               +G   +S ++KG+                        M++ G
Sbjct: 170 TFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-----ASVAHARFTKRPSVFVLPMTI-G 223

Query: 348 GKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNW 407
            K+  LD  +  A+   I   + AGN+  DAC+ SP +    + +G+    +  A FSN+
Sbjct: 224 KKNHILDNFLQ-AIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNY 282

Query: 408 GKCVDIFAPGLNIL---STYIGDDDATATLSGTSMASPHVAGLLTYFLSL 454
           G CVD++  G +IL   ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 283 GNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 124/269 (46%), Gaps = 29/269 (10%)

Query: 204 QNNAPWGLARISHRERLNLGSF----NKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAV 259
           Q +AP  L R++ ++ +    +    N+Y++ D +G GV  Y++DTGI+ +H  + +  +
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 260 WGKTIPLNDKDI---DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGS-GSMSDVI 315
             K I L    I   D NGHGT  AG I S  +G            + +N    +MS V+
Sbjct: 156 H-KLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVL 214

Query: 316 KGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNEN 375
             +                        +     K+  L+ A+   +   I   + AGN++
Sbjct: 215 SALSLIEKHEQKTMRPSIIV-------LPFQTEKNTILESAIEN-ISKKIPVIIPAGNKH 266

Query: 376 QDACNTSPASAER---AITVGASTLSDDRAY-----FSNWGKCVDIFAPGLNILSTYI-- 425
           Q+AC  SP   ++    + VG+   S+++ Y     FSN+G CVDI+  G++I +     
Sbjct: 267 QNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSS 326

Query: 426 -GDDDATATLSGTSMASPHVAGLLTYFLS 453
            G  +    ++GTS +   VAG++ Y++S
Sbjct: 327 NGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 120/284 (42%), Gaps = 32/284 (11%)

Query: 187 VEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTG 246
           +  +  D  ++  E   Q +AP  L ++   E  +    N+++YD  AG GV  Y+ DTG
Sbjct: 80  IAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTG 135

Query: 247 INTEHNDFNKRAVWGKT----IPLNDKDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXX 302
           I       +   +         P+ D++I    HGT  +G I S  +G            
Sbjct: 136 IARNSPGLSASRIHDMPGMPGPPIRDQEIL--EHGTAMSGLIGSPAFGVLKKCNLIDVNV 193

Query: 303 LRSNGSGSMSDVIKGVEFXXXXXXXXXXXXXXXXXXXXXNMSLGGGKSPTLDLAV-NAAV 361
              NG   MS V+KG+                       N S    K+  L+ A  N   
Sbjct: 194 GDENGKVFMSKVLKGLNL-------VQQHVKHTNRPSVINFSYCTLKNAILNSAFDNFPR 246

Query: 362 DAGIHFAVAAGNENQDACNTSPASAER---AITVGASTLSDD---RAYFSNWGKCVDIFA 415
           D  I  AVAAGN  Q  C+ SP   +R    +  G+  ++DD    + FSN+G CV  +A
Sbjct: 247 DVPI--AVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYA 304

Query: 416 PGLNILSTYIGDD------DATATLSGTSMASPHVAGLLTYFLS 453
           PG  +L+  I D       D    +SGTS +S   AG++ Y+++
Sbjct: 305 PGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 230 YDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHCAGT 283
           Y++  G GV   ++D G++ E  D    F K   W       L    +D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 284 IAS 286
           IA+
Sbjct: 214 IAA 216

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 230 YDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHCAGT 283
           Y++  G GV   ++D G++ E+ D    F     W      PL    +  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 284 IAS 286
           IA+
Sbjct: 245 IAA 247

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 227 KYLYDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHC 280
           K  Y++  G+G+   ++D G++ E+ D    F+    W       L    +  + HGT C
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDYHGTRC 231

Query: 281 AGTIAST 287
           AG IA+T
Sbjct: 232 AGEIAAT 238

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 234 AGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDK------DIDGNGHGTHCAGTIAS 286
            GK VT  ++D G++ E+ D   +  +  +   ND        +  + HGT CAG IA+
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAA 224

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 227 KYLYDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHC 280
           +  Y++  G G+   ++D G++ ++++    F++   W      PL    +  + HGT C
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRC 242

Query: 281 AGTIAST 287
           AG IA++
Sbjct: 243 AGEIAAS 249

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 230 YDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHCAGT 283
           Y +  GKGV   V+D G++ E+ D    F K   W       L    +  + HGT CAG 
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGE 211

Query: 284 IAS 286
           IA+
Sbjct: 212 IAA 214

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 118 FHKELINQIQLESAAKLPKDDKFFSASAI---EDESINQGGILTTFNISNLLNGYVGYFT 174
           F   +IN I+  +   +   D+ F   AI   EDE +N   +L+ FN   +LNG   ++ 
Sbjct: 513 FQGTMINSIKCLTCDNVTSSDELFLDFAIPVNEDEEVNIQDMLSNFNQREMLNGANKFYC 572

Query: 175 D 175
           D
Sbjct: 573 D 573

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 6/66 (9%)

Query: 227 KYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKD------IDGNGHGTHC 280
           K  Y++  G GV   ++D G++ E+ D         +   ND        +  + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 281 AGTIAS 286
           AG IA+
Sbjct: 218 AGEIAA 223

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 229 LYDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHCAG 282
            Y+   GKGV   ++D G++ E  D    F K   W   +   L    +  + HGT CAG
Sbjct: 156 WYEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDDYHGTRCAG 215

Query: 283 TIAS 286
            IA+
Sbjct: 216 EIAA 219

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 230 YDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHCAGT 283
           Y++  G  V   V+D G++ E  D    F+    W     + L    +  + HGT CAG 
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDYHGTRCAGE 215

Query: 284 IAS 286
           IA+
Sbjct: 216 IAA 218

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 230 YDDDAGKGVTCYVIDTGINTEHND----FNKRAVW--GKTIPLNDKDIDGNGHGTHCAGT 283
           Y++  G  V   V+D G++ E  D    F+    W      P+    +  + HGT CAG 
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGE 214

Query: 284 IAS 286
           IA+
Sbjct: 215 IAA 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,712,682
Number of extensions: 2525772
Number of successful extensions: 5810
Number of sequences better than 10.0: 84
Number of HSP's gapped: 5734
Number of HSP's successfully gapped: 96
Length of query: 695
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 578
Effective length of database: 40,065,477
Effective search space: 23157845706
Effective search space used: 23157845706
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)