Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F002106.12ON79793422e-43
Kpol_1032.36.12ON78831081e-07
ZYRO0F00528g6.12ON77781062e-07
TBLA0G009906.12ON78791002e-06
Kwal_56.223596.12ON91851002e-06
ACR014C6.12ON7084922e-05
Ecym_30156.12ON7083904e-05
KLTH0C11484g6.12ON8982906e-05
SAKL0E00924g6.12ON9795800.002
TPHA0M002206.12ON7830760.006
KLLA0D00880g6.12ON7183750.007
TDEL0G045906.12ON7484710.031
Skud_5.306.12ON7483710.033
YEL059C-A (SOM1)6.12ON7476690.056
Suva_5.96.12ON7376660.16
KAFR0L003506.12ON7155620.55
Smik_5.286.12ON7431591.8
NOTE: 1 genes in the same pillar as NCAS0F00210 were not hit in these BLAST results
LIST: KNAG0E00930

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00210
         (79 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...   136   2e-43
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    46   1e-07
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    45   2e-07
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    43   2e-06
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    43   2e-06
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    40   2e-05
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    39   4e-05
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    39   6e-05
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    35   0.002
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    34   0.006
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    33   0.007
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    32   0.031
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    32   0.033
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    31   0.056
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    30   0.16 
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    28   0.55 
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    27   1.8  

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score =  136 bits (342), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 67/79 (84%), Positives = 67/79 (84%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCR            EDGQYICFPFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 61 VFQECQGVRTEVTNVDSNM 79
          VFQECQGVRTEVTNVDSNM
Sbjct: 61 VFQECQGVRTEVTNVDSNM 79

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 46.2 bits (108), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 13/83 (15%)

Query: 1  MAPPVVVFGKDDI-RVKTALS--NNRTGE--TDAETGDGCRXXXXXXXXXXXXEDGQYIC 55
          MAPP  +  ++++ R K  L+  +N+ G+    + T   CR             +G+YIC
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSY--------EGEYIC 52

Query: 56 FPFKRVFQECQGVRTEVTNVDSN 78
           PFKR+F+EC G+R EVT+  +N
Sbjct: 53 LPFKRLFEECSGIRIEVTDRFTN 75

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 45.4 bits (106), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPP  +   + +      S  R      +  + C               G+YIC PFKR
Sbjct: 1  MAPPTPILTSEQV------SRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKR 54

Query: 61 VFQECQGVRTEVTNVDSN 78
          VF++C G   EVT+ D+N
Sbjct: 55 VFEKCLGHALEVTDADTN 72

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 43.1 bits (100), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPPV +  K+++ +   + N +  + D +     +            + GQ  CFPFKR
Sbjct: 1  MAPPVTIQTKEELDILEKV-NRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKR 59

Query: 61 VFQECQGVRTEVTNVDSNM 79
          +FQ+    R E+T+  +NM
Sbjct: 60 IFQQVGEYRREITDETTNM 78

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 43.1 bits (100), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 22/85 (25%)

Query: 1  MAPPVVVFGKDDIR--VKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDG-QYICFP 57
          MAPP VVFGK+++   ++  ++   T    + T   C              DG QY+C P
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMA---TCIFKSLTQSECNF------------DGHQYVCVP 45

Query: 58 FKRVFQEC----QGVRTEVTNVDSN 78
          FKRVF+EC    + +R EVT+ ++N
Sbjct: 46 FKRVFKECKVDGKSIRIEVTDRNTN 70

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 40.0 bits (92), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 19/84 (22%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQ-YICFPFK 59
          MAPP  V  +++  V  AL+ +R     + T + C              DG+ Y+C PF+
Sbjct: 1  MAPPTPVLTREE--VAPALATSRDCVLASLTQNECHF------------DGRGYVCVPFQ 46

Query: 60 RVFQEC----QGVRTEVTNVDSNM 79
          R+F+EC    + VR E+T  ++NM
Sbjct: 47 RLFRECTLNKRRVRIEITERNTNM 70

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 39.3 bits (90), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 19/83 (22%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQ-YICFPFK 59
          MAPP  +  +D+  V+  LS  +     +   + C              DG  Y+C PFK
Sbjct: 1  MAPPTPIITRDE--VEPILSRTKDCILASLIQNECHF------------DGHNYVCIPFK 46

Query: 60 RVFQEC----QGVRTEVTNVDSN 78
          R+F+EC    + VR EVT++ +N
Sbjct: 47 RLFEECTLNKRRVRIEVTDISTN 69

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 39.3 bits (90), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 16/82 (19%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPP +VFGK++++           E  AE                     +Y+C PFKR
Sbjct: 1  MAPPTLVFGKEELK--------GIWEKAAEPC----FLKALVQNECEFNGHEYVCTPFKR 48

Query: 61 VFQECQG----VRTEVTNVDSN 78
          +F+EC      VR EVT+ D+N
Sbjct: 49 LFKECGAGKRIVRIEVTDQDTN 70

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 35.4 bits (80), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 34/95 (35%)

Query: 1  MAPPVVVFGKDDI-----RVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYIC 55
          MAPP  VFGKD++     +VK   +     + +  T +G                 +YIC
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNEC-TFNG----------------EEYIC 43

Query: 56 FPFKRVFQEC------------QGVRTEVTNVDSN 78
           PFKR+F+EC            + VR E+T+  +N
Sbjct: 44 VPFKRLFKECLLDSKTKDGRTSRTVRIEITDRHTN 78

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 33.9 bits (76), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 49 EDGQYICFPFKRVFQECQGVRTEVTNVDSN 78
          E  +YIC PFKR+F+ C G   E T   +N
Sbjct: 44 ESNRYICRPFKRLFEVCAGTSYETTAQPTN 73

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 33.5 bits (75), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 18/83 (21%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPP  + G D            T +   + G+ C                 Y+C PFKR
Sbjct: 1  MAPPTKILGLD------------TQQRMLQRGENC-SLKSLVQNECAFNGNDYVCTPFKR 47

Query: 61 VFQEC-----QGVRTEVTNVDSN 78
          +F++C     + +  EVTN+++N
Sbjct: 48 LFEQCMVKDGRVLNIEVTNLNTN 70

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 32.0 bits (71), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 17/84 (20%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPP  V  ++++     +  ++     + T   C+              G Y C PFKR
Sbjct: 1  MAPPTPVLAREEL---PEIPQSKNCVLKSLTQFQCQLRPAG--------SGLYECVPFKR 49

Query: 61 VFQECQ------GVRTEVTNVDSN 78
          +FQEC+        R EVT+  +N
Sbjct: 50 LFQECRDPSGRFKSRIEVTSPLTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 32.0 bits (71), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 32/83 (38%), Gaps = 15/83 (18%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPP  +  +D      A  ++ T          C+            E   Y+CFPFKR
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTR---------CQLKELVQWECQFRE-ADYVCFPFKR 50

Query: 61 VFQEC-----QGVRTEVTNVDSN 78
          +F+ C          EVT+  +N
Sbjct: 51 LFERCIAPDKSATDYEVTDTYTN 73

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 31.2 bits (69), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 10/76 (13%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPP  +  +D      A  +++T          CR            +  +Y+C PFKR
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTN---------CRLKELVQWECQF-KGAEYVCSPFKR 50

Query: 61 VFQECQGVRTEVTNVD 76
          +F+ C       TN +
Sbjct: 51 LFEHCIAPDKSATNYE 66

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 30.0 bits (66), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 28/76 (36%), Gaps = 10/76 (13%)

Query: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKR 60
          MAPP  +  +D      A  ++RT     E                  +   Y+C PF+R
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKE----------LVQWECQFKGADYVCSPFRR 50

Query: 61 VFQECQGVRTEVTNVD 76
          +F+ C       TN +
Sbjct: 51 LFEHCTAPGEAATNYE 66

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 28.5 bits (62), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 23/55 (41%)

Query: 24 TGETDAETGDGCRXXXXXXXXXXXXEDGQYICFPFKRVFQECQGVRTEVTNVDSN 78
            E + +  +GC+              G   CFPFKR+F EC     ++  V++ 
Sbjct: 12 AAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVETR 66

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 27.3 bits (59), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 5/31 (16%)

Query: 53 YICFPFKRVFQEC-----QGVRTEVTNVDSN 78
          Y+C PFKR+F+ C          EVT+  +N
Sbjct: 43 YVCSPFKRLFEHCVEHGKPATNYEVTDTYTN 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,995,509
Number of extensions: 176375
Number of successful extensions: 254
Number of sequences better than 10.0: 17
Number of HSP's gapped: 254
Number of HSP's successfully gapped: 17
Length of query: 79
Length of database: 53,481,399
Length adjustment: 51
Effective length of query: 28
Effective length of database: 47,633,433
Effective search space: 1333736124
Effective search space used: 1333736124
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)