Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F002006.11ON54954928640.0
NDAI0K028906.11ON56156416190.0
Kpol_1032.26.11ON53954615870.0
TPHA0M002106.11ON54555015150.0
ZYRO0F00506g6.11ON55055414980.0
Skud_5.316.11ON55756114890.0
KAFR0L003406.11ON54055414830.0
Smik_5.296.11ON55555514730.0
TBLA0G009806.11ON55856714720.0
TDEL0G046006.11ON52853914690.0
CAGL0B03597g6.11ON54055214690.0
Suva_5.106.11ON55355614540.0
SAKL0E00902g6.11ON54455314440.0
YEL058W (PCM1)6.11ON55755814380.0
Kwal_56.223556.11ON54155213740.0
Ecym_30146.11ON55155613610.0
KNAG0E009406.11ON53855313590.0
KLLA0D00858g6.11ON54155213470.0
KLTH0C11506g6.11ON54455213421e-180
ACR015W6.11ON55254012821e-171
TDEL0B005708.840ON63032970.004
Kpol_1068.88.840ON63231960.005
KLLA0D01573g8.840ON60731940.008
TBLA0B032508.840ON64328940.010
YMR278W (PGM3)8.840ON62254930.010
ABL126W8.840ON62455930.011
ZYRO0G14190g8.840ON61028930.011
Kwal_27.102588.840ON62032930.012
Smik_13.4918.840ON62228920.014
CAGL0M02981g8.840ON61728910.019
NDAI0K004108.840ON62628910.021
TPHA0I002508.840ON62933910.022
Skud_13.4508.840ON62228900.023
KNAG0J002708.840ON62528900.024
Suva_13.4668.840ON62228900.024
KLTH0C03872g8.840ON62153880.044
Ecym_46118.840ON63035870.055
SAKL0D01474g8.840ON62428870.063
NCAS0C004108.840ON62528850.10
KAFR0B039208.840ON62427810.29
TDEL0H009401.212ON51288790.45
Skud_5.1767.242ON442149780.56
KLTH0H07040g6.97ON115270752.0
Kpol_1055.604.280ON2073122732.7
Skud_8.2285.75ON152041724.3
TBLA0D01490singletonON44158714.6
KLTH0D15070g4.280ON205092715.1
Smik_11.484.280ON2051123706.7
CAGL0L05302g2.646ON54499697.6
Suva_11.424.280ON2051123698.6
YKL182W (FAS1)4.280ON2051121699.2
Smik_14.2672.248ON755115689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00200
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...  1107   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   628   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   615   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   588   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   581   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   578   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   575   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   572   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   571   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   570   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   570   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   564   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   560   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   558   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   533   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   528   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   528   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   523   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   521   e-180
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   498   e-171
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    42   0.004
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    42   0.005
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    41   0.008
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    41   0.010
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    40   0.010
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    40   0.011
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    40   0.011
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    40   0.012
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    40   0.014
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    40   0.019
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    40   0.021
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    40   0.022
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    39   0.023
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    39   0.024
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    39   0.024
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    39   0.044
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    38   0.055
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    38   0.063
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.10 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    36   0.29 
TDEL0H00940 Chr8 complement(154307..155845) [1539 bp, 512 aa] {O...    35   0.45 
Skud_5.176 Chr5 complement(275089..276417) [1329 bp, 442 aa] {ON...    35   0.56 
KLTH0H07040g Chr8 complement(621645..625103) [3459 bp, 1152 aa] ...    33   2.0  
Kpol_1055.60 s1055 (156928..163149) [6222 bp, 2073 aa] {ON} (156...    33   2.7  
Skud_8.228 Chr8 complement(395979..400541) [4563 bp, 1520 aa] {O...    32   4.3  
TBLA0D01490 Chr4 (369657..370982) [1326 bp, 441 aa] {ON}               32   4.6  
KLTH0D15070g Chr4 complement(1235757..1241909) [6153 bp, 2050 aa...    32   5.1  
Smik_11.48 Chr11 (86169..92324) [6156 bp, 2051 aa] {ON} YKL182W ...    32   6.7  
CAGL0L05302g Chr12 complement(590178..591812) [1635 bp, 544 aa] ...    31   7.6  
Suva_11.42 Chr11 (85423..91578) [6156 bp, 2051 aa] {ON} YKL182W ...    31   8.6  
YKL182W Chr11 (100671..106826) [6156 bp, 2051 aa] {ON}  FAS1Beta...    31   9.2  
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    31   9.8  

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 1107 bits (2864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/549 (97%), Positives = 537/549 (97%)

Query: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60
           MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV
Sbjct: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60

Query: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDP 120
           GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDP
Sbjct: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDP 120

Query: 121 KFPFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNA 180
           KFPFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNA
Sbjct: 121 KFPFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNA 180

Query: 181 KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240
           KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST
Sbjct: 181 KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240

Query: 241 WPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADRI 300
           WPSTLRGNVSII            DCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADRI
Sbjct: 241 WPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADRI 300

Query: 301 VFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLT 360
           VFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLT
Sbjct: 301 VFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLT 360

Query: 361 NVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTATQT 420
           NVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTATQT
Sbjct: 361 NVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTATQT 420

Query: 421 LLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFIT 480
           LLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFIT
Sbjct: 421 LLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFIT 480

Query: 481 TNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVC 540
           TNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVC
Sbjct: 481 TNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVC 540

Query: 541 KFVLSSVSN 549
           KFVLSSVSN
Sbjct: 541 KFVLSSVSN 549

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/564 (58%), Positives = 408/564 (72%), Gaps = 25/564 (4%)

Query: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLC---- 56
           M  +K  L+  +N  C T++Y YTYGTAGFRD A +LDTVMF TGI+AC RS+ L     
Sbjct: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64

Query: 57  GTPVGVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILE- 115
            + +GVMVTASHNPP DNGVK++EP G+ML+QEWEP  T+ ANIAANESF++ Y  +++ 
Sbjct: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDS 124

Query: 116 -VSKDPKFPFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFI 174
            V+ +     ++  P+LI+GHDSR+SSP L   ++ +A  I+NA I NY  VTTPQLHF+
Sbjct: 125 IVTLENDLNIKQ-PPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183

Query: 175 TSLWNAKYNKNTNDVISVDNYYNYFNASWSKFQELYD-FNSFKSFENLIIDSANGIGGPK 233
           T+L N              NYY++FN   S+ Q LY  FN    F+NLIID+ANGIG P+
Sbjct: 184 TNLTNTTGTAEE------INYYDHFNKYLSQLQSLYPPFNL--PFDNLIIDAANGIGAPQ 235

Query: 234 VTDLISTW----PSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNP--SNL 287
           V  L+ T     P  ++  + II            +CGADYVKTNQKLP+GI     +N 
Sbjct: 236 VEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANS 295

Query: 288 NLHCSFDGDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQ 347
            L CS+DGDADRIVFYYI  +   F+LLDGDKIATLFAKF SNLL    L   LKLGVVQ
Sbjct: 296 TLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQ 355

Query: 348 TAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQ 407
           TAYANGSSTNY+++ LKVPVSCTKTGVKHLHHEA TKYDIGIYFEANGHGTV+FS++F  
Sbjct: 356 TAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHS 415

Query: 408 VLQNEPKTTATQ---TLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLP 464
            L    ++ +++   TLLLF ++INQTVGDAM+DML VI VLS+ +++P+ WD+ YKDLP
Sbjct: 416 ELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLP 475

Query: 465 NKLAKVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYA 524
           NKLAKVIVPDRS FITT+QER+L  P GLQ  ++ AV+ V+ GRSFVRASGTEDAVRVYA
Sbjct: 476 NKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYA 535

Query: 525 EAATQEETEKLSQEVCKFVLSSVS 548
           EA TQEETE LS++VC+ V+ SV+
Sbjct: 536 EAKTQEETEWLSKKVCQLVIESVT 559

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/546 (56%), Positives = 392/546 (71%), Gaps = 18/546 (3%)

Query: 10  QVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTASHN 69
           +++   CTT+D+KY YGTAGFRD AS L+TVMF TGI+AC RS+ L G  VGVM+TASHN
Sbjct: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63

Query: 70  PPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKFPFQEN-- 127
           PP DNGVK+VEP GAML Q WEP+ T+LANIAAN +F+ +  ++ E  K  KF  +    
Sbjct: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEE--KVKKFSPESGSK 121

Query: 128 -KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNKNT 186
            +P +++G DSRES   L + L+ +A    NA I NYGL+TTPQLHF+T+  N K +   
Sbjct: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSY-- 179

Query: 187 NDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTLR 246
              +   +YYNYF  SW+K   L++        +L ID+ANGIGGPK+ +L+ +WP    
Sbjct: 180 --AVQESSYYNYFIESWNKITALHNITDLYC-SSLTIDTANGIGGPKIQELLKSWP--FA 234

Query: 247 GNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLN-LHCSFDGDADRIVFYYI 305
             V+++            +CGAD+VKTNQKLP G+   S  N L+CS+DGDADRIVFY+ 
Sbjct: 235 SKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYF- 293

Query: 306 SEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNVLKV 365
            + D++FHLLDGDKI+TLFAK ++ LL + NL  K+ LGVVQTAYANGSSTNYL   L V
Sbjct: 294 QDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNV 353

Query: 366 PVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPK----TTATQTL 421
           PVSC KTGVKHLHHEA T YDIG+YFEANGHGT++FS+ F QV + E K    + A  TL
Sbjct: 354 PVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTL 413

Query: 422 LLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFITT 481
           +    +INQTVGDA++DMLGV++VLS+ K++  QWD  Y DLPN L KVIVPDRSVFITT
Sbjct: 414 VALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITT 473

Query: 482 NQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVCK 541
           +QER+L SP GLQ KID A+S+ +NGRSFVRASGTEDAVRVYAEA++QEE ++L+  V K
Sbjct: 474 DQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTK 533

Query: 542 FVLSSV 547
            V  SV
Sbjct: 534 LVKESV 539

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/550 (54%), Positives = 384/550 (69%), Gaps = 16/550 (2%)

Query: 6   SVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVT 65
           +VL+ V+ S CTTR+++Y YGTAGFRD A+ LDTVM  TG++AC RS+ L G  VGVM+T
Sbjct: 4   NVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMIT 63

Query: 66  ASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKFPFQ 125
           ASHN P DNGVK+VEP G+ML Q WEP  T+LAN A+     + +   L+  K  ++   
Sbjct: 64  ASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQ-EKFAQYKVD 122

Query: 126 EN-KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNK 184
               P L++G DSR+S PRL + L + AV +    I +YGL+TTPQLHF+T   NA    
Sbjct: 123 SGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLT---NAINTT 179

Query: 185 NTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPST 244
            +   ++ D+YY++F  +W     L+     +S   L ID+ANGIGGPKV+ L   WP  
Sbjct: 180 KSRAPVTEDDYYSFFMDAWVSITALHGIKVLQS-PRLYIDAANGIGGPKVSKLFEVWPQA 238

Query: 245 LRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLN---LHCSFDGDADRIV 301
             G  +++            DCGADYVKTNQ+LPK I   ++ +   L+CSFDGDADRIV
Sbjct: 239 --GQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIV 296

Query: 302 FYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTN 361
           FYY  +    FHLLDGDKI+TLFA F+S  LK+  LT+K+ +GVVQTAYANG+STNYL N
Sbjct: 297 FYY-QDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLEN 355

Query: 362 VLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERF----QQVLQNEPKTTA 417
           VL +PVSC KTGVKHLHHEA T YD+GIYFEANGHGT++FS +F    + +L+   ++  
Sbjct: 356 VLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNESLE 415

Query: 418 TQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSV 477
            +TLL F  +INQTVGDA++DMLGV+ VLS+ K+TPS WD+ Y DLPN L KV+VPDRS+
Sbjct: 416 VKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSL 475

Query: 478 FITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQ 537
           F TT+QER+L +P G Q KID  V+K  NGRSFVRASGTEDAVRVYAEA+T ++   L++
Sbjct: 476 FTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNE 535

Query: 538 EVCKFVLSSV 547
           EV K VL+SV
Sbjct: 536 EVSKAVLASV 545

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/554 (53%), Positives = 382/554 (68%), Gaps = 22/554 (3%)

Query: 8   LQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTAS 67
           L ++ +  C+  D  Y YGTAGFR  A+ LDTV+FATGI+AC RS+ L G  +GVMVTAS
Sbjct: 7   LTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTAS 66

Query: 68  HNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAA--NESFEKVYDFILEVSKDPKFPFQ 125
           HNPP+DNGVKVVEP G+M+ + WEPL T+LAN  A    S E+       + ++ K   Q
Sbjct: 67  HNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQ 126

Query: 126 ENK--------PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSL 177
                      P+L++G DSRES P+L   LV +A E+++A IH+ GL+TTPQLHF+TS 
Sbjct: 127 SANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSE 186

Query: 178 WNAKYNKNTNDVISVDNYYNYFNASWSKFQELYDFN-SFKSFENLIIDSANGIGGPKVTD 236
             AK   N    ++   YY +F  +W    +L+    S  +  +L ID+ANGIG PKV +
Sbjct: 187 -TAKGVAN----VTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQE 241

Query: 237 LISTWPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGD 296
           L+S W    RG V  I            +CGAD+VK+NQ+ P G  + + L   CS+DGD
Sbjct: 242 LLSQW--ACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDSTGLG--CSYDGD 297

Query: 297 ADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSST 356
           ADR+VFYYI+E ++ F LLDGD+I+ LFA F + +LK+  L  +L LGVVQTAYANG+ST
Sbjct: 298 ADRVVFYYINEANE-FCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNST 356

Query: 357 NYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNE-PKT 415
            YL   L+VPVSC KTGVKHLHHEA TKYDIGIYFEANGHGT++FS +F +V++ +  ++
Sbjct: 357 EYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERS 416

Query: 416 TATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDR 475
            A +TL  F ++INQTVGDA++DMLGV+  LS+SK TP  W Q + DLPN+LAKV+VPDR
Sbjct: 417 VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDR 476

Query: 476 SVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKL 535
           SVFITT+QER+LT P GLQ+KID AV     GRSFVRASGTEDAVRVYAEAA+ E+ EKL
Sbjct: 477 SVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKL 536

Query: 536 SQEVCKFVLSSVSN 549
           S  V + V+ SV N
Sbjct: 537 SNTVKELVVKSVQN 550

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/561 (52%), Positives = 388/561 (69%), Gaps = 18/561 (3%)

Query: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60
           M ID   L+++Y+ TC T++ +Y+YGTAGFR  A  LDTVMF TGI+A  RS+ L G  V
Sbjct: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANES-FEKVYDFILEVSKD 119
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+  + FE+ Y  ++++ + 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120

Query: 120 PKFPFQEN--KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSL 177
            K     +   P +++G DSRESSP L + L +T   +++A + + G VTTPQLH+IT L
Sbjct: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180

Query: 178 WNAKYNKNTNDVISV--DNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVT 235
            N +  +  + + +    +YY++F  ++++    YD     S   L ID+ANGIGGP++ 
Sbjct: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240

Query: 236 DLIST--W--PSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHC 291
            L+++  W  PS     + II            +CGADYVKTNQ+LPKG+   S  +L+C
Sbjct: 241 KLLASKDWVVPS---DQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYC 297

Query: 292 SFDGDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYA 351
           SFDGDADR+VFYY+ + + KFHLLDGDKI+TLFAKFLS  L+  NL   LK+GVVQTAYA
Sbjct: 298 SFDGDADRVVFYYV-DSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYA 356

Query: 352 NGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQN 411
           NGSST Y+ + L  PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FSE+F Q +++
Sbjct: 357 NGSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIES 416

Query: 412 E-----PKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNK 466
           E       T A +TL  F K+INQTVGDAM+DML V+  L++ K+ P  WD+ YKDLPNK
Sbjct: 417 ELSKPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNK 476

Query: 467 LAKVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEA 526
           L K IVPDRS+F TT+QER+L +PVGLQ KID  ++K   GRSFVRASGTEDAVRVYAE 
Sbjct: 477 LVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAEC 536

Query: 527 ATQEETEKLSQEVCKFVLSSV 547
               + ++   E+  +V +SV
Sbjct: 537 QDMSKLDQFCNEIVGYVKASV 557

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/554 (54%), Positives = 384/554 (69%), Gaps = 27/554 (4%)

Query: 4   DKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVM 63
           D + L+  +   CTTR++ YTYGTAGFR  AS LDTVMF TGI+A  RS+VL G  +GVM
Sbjct: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62

Query: 64  VTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSK-DPKF 122
           +TASHNPP DNGVK+VEP+GAMLI+ WE + T LANIA++ +F     F++ +S+   K 
Sbjct: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTA---FVMHLSQVIAKL 119

Query: 123 PFQENK-PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAK 181
              E   P LI+GHDSRESSP L + L   A  +++  + N+ L+TTPQLH++T L N  
Sbjct: 120 NIDETTTPRLIVGHDSRESSPYLMECL-QAAAPVFDTIVINHTLITTPQLHYLTMLQN-- 176

Query: 182 YNKNTNDVISVDNYYNYFNASWSKFQELY-DFNSFKSFENLIIDSANGIGGPKVTDLIST 240
                 DV++  +YY +F+ SW+    LY D N   +F NLI+D ANG+G  + +  +  
Sbjct: 177 ------DVVTEVDYYKFFSTSWNNLFSLYPDLN--LTFNNLIVDGANGVGSVQFSKFLPY 228

Query: 241 WPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADRI 300
            P  L    +II            DCGAD+VKTNQKLP GI NP+  +L+ SFDGDADRI
Sbjct: 229 LPQ-LATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRI 287

Query: 301 VFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLT 360
           VFYY+   ++KFHLLDGDKI+T+  K L ++L+E+ L + + LGVVQTAYANGSST Y+T
Sbjct: 288 VFYYVDN-NKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYIT 346

Query: 361 NVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQ--------NE 412
             LKVPV CTKTGVKHLHH A +K+DIGIYFEANGHGTVLFS +F +VLQ        +E
Sbjct: 347 KSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSE 406

Query: 413 PKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIV 472
               A  +L  F K+INQTVGD+MAD+L VI  LS+ +++PS WD  Y+DLPN L K  V
Sbjct: 407 KIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTV 466

Query: 473 PDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEET 532
            +R VF TT+ ER+LTSP GLQEKID AVSK  +GRSFVRASGTEDAVR+YAEA T+ E 
Sbjct: 467 LNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEV 526

Query: 533 EKLSQEVCKFVLSS 546
           E LS+EV + V +S
Sbjct: 527 EALSKEVTQLVENS 540

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/555 (50%), Positives = 387/555 (69%), Gaps = 10/555 (1%)

Query: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60
           M ID   L ++Y+ TC T++ +Y+YGTAGFR  A  LDTVMF TGI+A  RS+ L G  V
Sbjct: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60

Query: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANES-FEKVYDFILEVSKD 119
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+  S FE+    +  + + 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120

Query: 120 PKFPFQEN-KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLW 178
            K     +  P +++G DSRESSP L + L +T V +++A + + G VTTPQLH+IT L 
Sbjct: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 179 NAKYNKN-TNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDL 237
           N +  +  + +V +  +YY++F  ++++    Y+     S   L ID+ANGIGGP++  L
Sbjct: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240

Query: 238 ISTWPSTLRGN-VSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGD 296
           +++    +  + + +I            +CGADYVKTNQ+LPKG+   S+ +L+CSFDGD
Sbjct: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300

Query: 297 ADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSST 356
           ADR+VFYY+ + + +FHLLDGDKI+TLFAKFLS  L+  +L + L++GVVQTAYANGSST
Sbjct: 301 ADRVVFYYV-DSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSST 359

Query: 357 NYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTT 416
           NY+ N L+ PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FSE+F QV+++E    
Sbjct: 360 NYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRA 419

Query: 417 -----ATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471
                A +TL  F K+INQTVGDA++DML V+  L++ K+ P  WD+ Y DLPNKL K I
Sbjct: 420 RGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCI 479

Query: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531
           VPDRS+F T +QER+L +PVGLQ KID+ ++K   GRSFVRASGTEDAVR+YAE     +
Sbjct: 480 VPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQ 539

Query: 532 TEKLSQEVCKFVLSS 546
            ++   E+ + V +S
Sbjct: 540 LDQFCNEIVELVKAS 554

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/567 (52%), Positives = 391/567 (68%), Gaps = 34/567 (5%)

Query: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62
           +D S    +++  C T+++ YTYGTAGFRDKA+ LDTVMF TG +AC RS+   G  VGV
Sbjct: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64

Query: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122
           MVTASHNPP+DNGVK+VEP G+ML Q+WEP+ T LAN+A+    +++  F+         
Sbjct: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFV----NAKLI 120

Query: 123 PFQENK-PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAK 181
               NK P+LI+G DSRESS  L + L   ++++++A I +Y L+TTPQLHF+T+ +N +
Sbjct: 121 ELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLE 180

Query: 182 YNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKS---FENLIIDSANGIGGPKVTDLI 238
                 D+    +YY++FN +W +   + +  S  +    E+LIIDSANGIGGPK+ +L+
Sbjct: 181 -----KDLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLL 235

Query: 239 STWPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQ----NPSNLN-LHCSF 293
             W +  +  V +I            +CGADYVKTNQKLP GI     N S+ N +HCSF
Sbjct: 236 KYWKTNYK--VRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSF 293

Query: 294 DGDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNL--TDKLKLGVVQTAYA 351
           DGDADR+VFYY       F+LLDGDKI+TLFA F+S  LK   +   +++KLGVVQTAYA
Sbjct: 294 DGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYA 353

Query: 352 NGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVL-- 409
           NGSSTNYL   LK+PV+C KTGVKHLHHEA T+YDIG+YFEANGHGT++FSE F +++  
Sbjct: 354 NGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQ 413

Query: 410 --------QNEPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYK 461
                   +N PK  A +TL +   +INQTVGDA++DM+GV+ VL++   TP  W++ Y 
Sbjct: 414 KINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYT 473

Query: 462 DLPNKLAKVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVR 521
           DLPNKLAK++VPDRSVF TT+QER+LTSP GLQ KI+  V+K  NGRSFVRASGTEDAVR
Sbjct: 474 DLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVR 533

Query: 522 VYAEAATQEETEKLSQEVCKFVLSSVS 548
           VYAEA+  ++  KL QEV      SV+
Sbjct: 534 VYAEAS--DDVNKLCQEVLDATAESVN 558

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/539 (53%), Positives = 371/539 (68%), Gaps = 22/539 (4%)

Query: 8   LQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTAS 67
           L+ +    CTTR Y+Y YGTAGFRD + KLDTVMFATGI+AC RS VL G PVGVM+TAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 68  HNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKFPFQEN 127
           HNP  DNGVKVVEP G+MLIQ WE   T+LAN+ AN   E +   + +++          
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSGES----SV 120

Query: 128 KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNKNTN 187
           +P LI+G DSR S P L   LV +A  +++A I +YGL+TTPQLHF+T       N+   
Sbjct: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT-------NETMI 173

Query: 188 DVISVDN--YYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTL 245
               VD   Y+ +F  +W +   L          N+++D ANGIGGPK++ L++ W    
Sbjct: 174 TGAHVDEQAYFAHFLGAWDQIAALQPVK----LPNVVVDCANGIGGPKMSALLTQW--GF 227

Query: 246 RGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADRIVFYYI 305
               S+I             CGAD+VKT+Q+LP G++ P+  +L+CSFDGDADR+VFYY+
Sbjct: 228 AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVK-PNANDLYCSFDGDADRVVFYYL 286

Query: 306 SEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNVLKV 365
            + +  FHLLDGDKI+TLFA F++ LLK+  L   L +GVVQTAYANGSST YL + L+V
Sbjct: 287 DQ-NLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQV 345

Query: 366 PVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTATQTLLLF- 424
           PVSCTKTGVKHLHHEA   YDIGIYFEANGHGTV+FS +F + + N    T    +L + 
Sbjct: 346 PVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYL 405

Query: 425 QKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFITTNQE 484
            K+INQTVGDA++DM+ V+ VLS+ + +PS+WD+ + DLPNKL KV+V DRS F TT+QE
Sbjct: 406 AKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQE 465

Query: 485 RQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVCKFV 543
           R+L SP GLQ+KID AV+++ +GRSFVRASGTEDAVRVYAEAATQ E ++LS  V   V
Sbjct: 466 RRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/552 (54%), Positives = 380/552 (68%), Gaps = 31/552 (5%)

Query: 10  QVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTASHN 69
           Q+YN  C TRD  YTYGTAGFR  A  LD+VMF TG+IA  RS+     PVGVM+TASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 70  PPLDNGVKVVEPTGAMLIQEWEPLTTKLAN-IAANESFEKVYDFIL-EVSKDPKFPFQEN 127
           PP DNGVK+VE  G+ML+Q+WEPL T+LAN +A   +FE   + I+ E++  P      +
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQELNISPG-----H 118

Query: 128 KPSLIIGHDSRESSPRLTKLLVNTAVEIY-NADIHNYGLVTTPQLHFITSLWNAKYNKNT 186
            P +++GHDSRESSPRL   L++    +  +A I N+GL+TTPQLHF+T+          
Sbjct: 119 APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTA---------- 168

Query: 187 NDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTL- 245
           N     D YY YF  +W++  ELY    FKSF+ L+ID+ANGIGGP+   ++S   + L 
Sbjct: 169 NPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLP 228

Query: 246 ------RGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADR 299
                    + I              CGAD+VKTNQ+LP+GI N    NL+CSFDGDADR
Sbjct: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGI-NADPRNLYCSFDGDADR 287

Query: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359
           +VFYY+ +    FHLLDGDKI+TL A F++ LLKE  L ++LKLGVVQTAYANGSST Y+
Sbjct: 288 VVFYYVDD-SLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYV 346

Query: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTA-- 417
           T  L+VPVS  KTGVKHLHHEA T YDIG+YFEANGHGTV+FS+ F +V+++     A  
Sbjct: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD 406

Query: 418 --TQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDR 475
             T TL L  ++INQT+GDA++DML +ITVL +   +P+ WD  Y DLPNKL KV+VPDR
Sbjct: 407 KSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDR 466

Query: 476 SVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKL 535
           S+FITT+QER+L SP GLQ+KID+ V+    GRSF+RASGTEDAVRVYAEA T E TEKL
Sbjct: 467 SIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKL 526

Query: 536 SQEVCKFVLSSV 547
           S EV   ++ +V
Sbjct: 527 STEVTDALIETV 538

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/556 (50%), Positives = 383/556 (68%), Gaps = 12/556 (2%)

Query: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60
           M ID   L+++Y  TC T++ +Y+YGTAGFR  A  LDTVMF TGI+A  RS+ L G  V
Sbjct: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAA-NESFEKVYDFILEVSKD 119
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+   +F++ Y  ++++ + 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120

Query: 120 PKFPFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWN 179
            K    +  P +++G DSRESSP L + L +T   +++A + + G VTTPQLH++T+L N
Sbjct: 121 EKIDL-DAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSN 179

Query: 180 AKYNKN-TNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLI 238
            +  +  +  V +  +YY++F  ++++           S   L +D+ANGIGGP++  L+
Sbjct: 180 KRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLL 239

Query: 239 ST--WPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGD 296
           ++  W +     + I+            +CGADYVKTNQ+LPKG+   S  +L+CSFDGD
Sbjct: 240 ASKDW-AVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGD 298

Query: 297 ADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSST 356
           ADR+VFYY+ + + KFHLLDGDKI+TLFAKFLS  L+  NLTD LK+GVVQTAYANGSST
Sbjct: 299 ADRVVFYYV-DPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSST 357

Query: 357 NYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTT 416
           +Y+ + L  PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FS++F Q +++E    
Sbjct: 358 SYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRA 417

Query: 417 -----ATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471
                A  TL  F  +INQTVGDA++DML V+  LS+  + P+ WD+ Y DLPNKL K I
Sbjct: 418 QGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCI 477

Query: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531
           VPDRS+F TT+QER+L +P GLQ KID  + K   GRSFVRASGTEDAVRVYAE     +
Sbjct: 478 VPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTK 537

Query: 532 TEKLSQEVCKFVLSSV 547
            ++   EV ++V SSV
Sbjct: 538 LDQFCNEVVEYVKSSV 553

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/553 (53%), Positives = 375/553 (67%), Gaps = 25/553 (4%)

Query: 7   VLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTA 66
           +L+++Y+  C T  + YTYGTAGFR KA  LDTVMF TGI+A  RS+ L G  VGVM+TA
Sbjct: 6   LLEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITA 64

Query: 67  SHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFE--KVYDFILEVSKDPKFPF 124
           SHNPP DNGVK+V+P G ML Q WEP  T+LAN A+    E  K  D ++      K   
Sbjct: 65  SHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLI-----TKLGI 119

Query: 125 QENKPSLI-IGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYN 183
            + + + I I  DSRES PRL + +++    + N  + ++ L+TTPQLHF+T     +YN
Sbjct: 120 DDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLT----YQYN 175

Query: 184 KNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPS 243
           + ++  +    YY+ F+++W+K   L+D NS      +IID+ANGIGGPKV++++     
Sbjct: 176 QGSSSKVEESTYYSAFSSAWTKICGLHDINSLPY--RVIIDAANGIGGPKVSEMLLK-NK 232

Query: 244 TLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQ-NPSNLNLHCSFDGDADRIVF 302
                VS+I             CGADYVKTNQ  PKG+  N  N  ++CSFDGDADRIVF
Sbjct: 233 FFSSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVF 292

Query: 303 YYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNV 362
           YY  E   KF+LLDGDKI+TLFAKF   LL      ++LKLGVVQTAYANGSST YL+++
Sbjct: 293 YYHDE-KSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSI 351

Query: 363 LKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVL-------QNEPKT 415
           L+VPVSCT TGVKHLHHEA   YDIGIYFEANGHGTV+FS+ F + +       Q+E   
Sbjct: 352 LEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTA 411

Query: 416 TATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDR 475
            A +TL LF  +INQTVGDA++DML V+ VL + K +P +WDQ Y DLPNKL KVIVPDR
Sbjct: 412 KALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDR 471

Query: 476 SVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKL 535
           SVF T+N ERQL SP GLQEKID  V +  +GRSFVRASGTEDAVRVYAEAAT+E+ ++L
Sbjct: 472 SVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRL 531

Query: 536 SQEVCKFVLSSVS 548
           +  V   V  SVS
Sbjct: 532 AASVSDLVSRSVS 544

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/558 (51%), Positives = 381/558 (68%), Gaps = 14/558 (2%)

Query: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60
           M +D   L ++Y+ TC T++ +++YGTAGFR  A  LDTVMF+TGI+A  RS+ L G  V
Sbjct: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60

Query: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAA-NESFEKVYDFILEVSKD 119
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+   +FE+    + ++ + 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120

Query: 120 PKFPFQENK-PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLW 178
            K        P +++G DSRESSP L + L ++   +++A + + G VTTPQLH+IT L 
Sbjct: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 179 NA-KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDL 237
           N  K   +T  V +  +YY++F  ++++    Y      S   L ID+ANGIGGP++  L
Sbjct: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240

Query: 238 IST--WPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDG 295
           +++  W       V +I            +CGADYVKTNQ+LPKG+   S  +L+CSFDG
Sbjct: 241 LASEDWDVPAE-QVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDG 299

Query: 296 DADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSS 355
           DADR+VFYY+ +   KFHLLDGDKI+TLFAKFLS  L+  +L   LK+GVVQTAYANGSS
Sbjct: 300 DADRVVFYYV-DSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSS 358

Query: 356 TNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNE--- 412
           T Y+ N L  PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FSE+F + +++E   
Sbjct: 359 TAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSK 418

Query: 413 ----PKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLA 468
                 T A +TL  F ++INQTVGDA++DML V+  L++ K++P  WD+ Y DLPNKL 
Sbjct: 419 SKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLV 478

Query: 469 KVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAAT 528
           K IVPDRS+F TT+QER+L +PVGLQ+KID+ V+K   GRSFVRASGTEDAVRVYAE   
Sbjct: 479 KCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKD 538

Query: 529 QEETEKLSQEVCKFVLSS 546
             +  +   EV + V +S
Sbjct: 539 SSKLGQFCDEVVEHVKAS 556

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/552 (52%), Positives = 368/552 (66%), Gaps = 24/552 (4%)

Query: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62
           +D   L+ +Y + C+T  + Y YGTAGFR KA  LDTVMF TG++A  RS+ L G  VGV
Sbjct: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSK-DPK 121
           M+TASHNPP DNGVK+V+P G ML Q WE   T LAN +A++ F    +F+  V +   K
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLAN-SASQGFS---EFVASVERLMTK 116

Query: 122 FPFQEN-KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNA 180
                N   S+++  DSRES PRL    ++    + N  + ++GL+TTPQLHF+TS  N 
Sbjct: 117 LEVGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN- 175

Query: 181 KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240
           +  K T   I    YY+ F ++W +  EL   +S      L ID+ANGIG P VT+++S 
Sbjct: 176 ELPKGTE--IGKSLYYDNFLSAWVEIAELCKIDSLPY--KLEIDAANGIGAPVVTEMLSQ 231

Query: 241 WPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLN-LHCSFDGDADR 299
                +G  +++             CGAD+VKTNQKLP GI      N + CSFDGDADR
Sbjct: 232 H-KFFKGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADR 290

Query: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359
           IVFYY  + +  FHLLDGDK+ATLFAKF   LL++  L D+L+LGVVQTAYANGSST Y+
Sbjct: 291 IVFYYCGK-NGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYI 349

Query: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQV--------LQN 411
             VL + V+CT TGVKHLHHEA  KYDIG+YFEANGHGTV+FS +F  V        L++
Sbjct: 350 EQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLES 408

Query: 412 EPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471
           +    + + L LF K+INQTVGDA++DML V+ VLS+ K +P +WD+ Y DLPNKL KV+
Sbjct: 409 DAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVL 468

Query: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531
           VPDR+VF T N ERQL SP G+QEKID  V+  + GRSFVRASGTEDAVRVYAEAAT +E
Sbjct: 469 VPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQE 528

Query: 532 TEKLSQEVCKFV 543
           TE LSQ+V K +
Sbjct: 529 TEALSQQVEKLL 540

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/556 (50%), Positives = 371/556 (66%), Gaps = 25/556 (4%)

Query: 6   SVLQQV---YNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62
           SV+++V   Y+  C +R +KY YGTAGFR KA  LDTV+F TG++AC RSM L G  VG 
Sbjct: 2   SVVEEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGA 60

Query: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122
           M+TASHNPP DNGVK+V+P G ML QEWE   T+LAN A++   + ++  + E+    +F
Sbjct: 61  MITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHR-LQELMN--QF 117

Query: 123 PFQ-ENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAK 181
             + +++  +++  DSRES  RL K LV+      N DI +Y ++TTPQLHF+T   N +
Sbjct: 118 GIKADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQ 177

Query: 182 YNKNTNDVISVDN--YYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIS 239
               +  VI V+   YY++F ++  +  EL++         L+ID+ANG+GG K  +L  
Sbjct: 178 ME--SERVIEVNEAFYYSHFLSALKELTELFNIPGLPY--PLVIDAANGVGGAKAEELFM 233

Query: 240 TWPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLN-LHCSFDGDAD 298
              +  + + +II             CGADYVKTNQ LP+GI   +++N LHCSFDGDAD
Sbjct: 234 K-NTFFKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDAD 292

Query: 299 RIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNY 358
           R++FYY  +VD  FHLLDGDKI+TLFAKF  ++L    + D +KLGVVQTAYANGSST Y
Sbjct: 293 RVIFYY-RDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRY 351

Query: 359 LTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPK---- 414
           L+ VL VPVSCT TGVK+LH +A   YD+GIYFEANGHGTV+FSE F   +    K    
Sbjct: 352 LSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSL 411

Query: 415 ----TTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKV 470
                 A +TL  F K+INQTVGDAM+DM+ V+ VL + K TP QWD  Y DLPN L KV
Sbjct: 412 SAESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKV 471

Query: 471 IVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQE 530
           +VPDRS+F TTN ERQL SP GLQ +ID  +    N RSFVRASGTEDAVR+YAEAAT+E
Sbjct: 472 VVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKE 531

Query: 531 ETEKLSQEVCKFVLSS 546
           + + LS ++ + V+S+
Sbjct: 532 QADDLSIKISQLVISA 547

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/553 (49%), Positives = 361/553 (65%), Gaps = 23/553 (4%)

Query: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62
           + +  ++ V+++ CTT+ Y YTYGTAGFRDKA+ LDTVMFATG +A  RS  L G  VGV
Sbjct: 1   MSREAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60

Query: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122
           MVTASHNPP DNGVKVV+P G ML ++WEPL T+LAN+AAN +F++ +++   + ++  +
Sbjct: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY 120

Query: 123 PFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADI--HNYGLVTTPQLHFITSLWNA 180
                   L +GHD+RESSPRL K L++ A+ +    I      +   PQLH++TSL   
Sbjct: 121 ---TGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL--- 174

Query: 181 KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240
                 + V     Y ++F   W K     D      F+ L ID+ANG+G  ++      
Sbjct: 175 ----QRDGVTDAAAYNDHFQGCWQKL--FPDGVVAWPFDRLFIDTANGVGAVQLQQFFKG 228

Query: 241 WPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNL-----NLHCSFDG 295
           W +  +    ++             CGAD+VKTN +LP  + +         +L+CSFDG
Sbjct: 229 W-AVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDG 287

Query: 296 DADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSS 355
           DADRIVFY++   +++FHLLDGDKI+TLFAKF+  L       DKL +GVVQTAYANG+S
Sbjct: 288 DADRIVFYFVK--NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNS 345

Query: 356 TNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKT 415
           T Y+ + L +P +CTKTGVKHLHH A T+YDIGIYFEANGHGTV+FS++F +V+     T
Sbjct: 346 TRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAST 405

Query: 416 T-ATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPD 474
             A  TL  F K+INQTVGDA+ADMLGV+ VL   + TP  W   Y DLPN L KV+VPD
Sbjct: 406 NDAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPD 465

Query: 475 RSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEK 534
           RS+F TT+QER+L SP GLQEKID  V +    RSFVRASGTE+AVR+Y EA   +E ++
Sbjct: 466 RSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQE 525

Query: 535 LSQEVCKFVLSSV 547
           LS++V + VL+SV
Sbjct: 526 LSKQVTEAVLNSV 538

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/552 (51%), Positives = 361/552 (65%), Gaps = 33/552 (5%)

Query: 8   LQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTAS 67
            + +Y   C  + + YTYGTAGFR   S LDTVMF TGI+A  RS+ L    VGVM+TAS
Sbjct: 3   FRDLYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61

Query: 68  HNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKV----YDFILEVSKDPKFP 123
           HNPP DNGVKVVEP G ML+Q WEP+ TKLAN AA+ SF ++       I E++ D    
Sbjct: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLAN-AASSSFTQLESTLQSIIAELNIDTT-- 118

Query: 124 FQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNA-DIHNYGLVTTPQLHFITSLWNAKY 182
                 ++ +  DSRES PRL   L    + ++ A  I ++ L+TTPQLHF+       Y
Sbjct: 119 ---QLANITVARDSRESGPRLLAAL-KAGISVFPAVKIIDFELLTTPQLHFLV------Y 168

Query: 183 NKNTNDV---ISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIS 239
           + NT+     +    YY++F + W++  +LY+        +L ID ANGIG  KV  LIS
Sbjct: 169 SLNTSSQPSQVRDSTYYDHFVSIWNQLTQLYEVTELPF--HLTIDCANGIGADKVKQLIS 226

Query: 240 TWPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADR 299
                L  +++ +             CGAD+VKTNQ  P    NP    L+CSFDGDADR
Sbjct: 227 QAGHMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANC-NPKPSQLYCSFDGDADR 285

Query: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359
           +VFYY+   + KFHLLDGDKIATL AK +++LL++  L+D LKLGVVQTAYANGSST Y+
Sbjct: 286 VVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYI 345

Query: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSE--------RFQQVLQN 411
           T+ LK+PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGTV+FS         R Q+   N
Sbjct: 346 TDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGN 405

Query: 412 EPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471
           E +  +  +L L  ++INQTVGDA++DML VI  LS+  + P  WD  Y+DLPN+L KVI
Sbjct: 406 EQQYKSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVI 465

Query: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531
           VPDRSVF++TN ERQL SP GLQ KID+ V++  N RSFVRASGTEDAVRVYAEA T E 
Sbjct: 466 VPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTES 525

Query: 532 TEKLSQEVCKFV 543
             +L+ +V + V
Sbjct: 526 AIELATKVGELV 537

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  521 bits (1342), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 282/552 (51%), Positives = 364/552 (65%), Gaps = 24/552 (4%)

Query: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62
           +D   L+ +Y + C +  + Y YGTAGFR KA  LDTVMF TG++A  RS+ L G  VGV
Sbjct: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122
           M+TASHNPP DNGVK+V+P G ML Q WE   T LAN +A +SF     ++  +  +   
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLAN-SATQSFTAFLAYLQNLVSELGL 119

Query: 123 PFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKY 182
              +   SL +  DSRES PRL   L+N +  + N  I +YGL+TTPQLHF+TS    K 
Sbjct: 120 D-TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTS----KR 174

Query: 183 NKNTNDVISVDN--YYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240
           N+  ND  ++D   YY  F ++W     L    S      L ID+ANGIG P+V +++ST
Sbjct: 175 NELPNDT-AIDRFFYYKEFLSAWDDITALCGIQSLPY--KLEIDAANGIGAPRVKEMLST 231

Query: 241 WPSTLRGNVSIIXXXXXXXXXXXXDCGADYVKTNQKLPKGIQ-NPSNLNLHCSFDGDADR 299
                 G   ++             CGADYVKTNQ+LP GIQ N     + CSFDGDADR
Sbjct: 232 H-KFFDGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADR 290

Query: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359
           IVFY+  + + +F LLDGDK+ATLFAKF  ++L   NL ++L LGVVQTAYANGSST+Y+
Sbjct: 291 IVFYFC-DSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYI 349

Query: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVL--------QN 411
             VL +PV+CT TGVKHLHHEA   YDIG+YFEANGHGTV+FS++F +V+        Q+
Sbjct: 350 ERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQS 408

Query: 412 EPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471
           +    + + L  F  +INQTVGDA++DM+GV+ VLS+ K TP +W+Q Y DLPNKL KV+
Sbjct: 409 DSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVL 468

Query: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531
           VPDR+VF TTN ERQL SP+GLQ KI+  V++    RSFVRASGTEDAVRVYAEA+T+EE
Sbjct: 469 VPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREE 528

Query: 532 TEKLSQEVCKFV 543
            + L+  V + V
Sbjct: 529 ADSLASRVSQVV 540

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  498 bits (1282), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 264/540 (48%), Positives = 350/540 (64%), Gaps = 26/540 (4%)

Query: 23  YTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTASHNPPLDNGVKVVEPT 82
           Y YGTAGFR +A  L  V+FATG++AC RS+ L G  VGVM+TASHNPP DNGVK+V+P 
Sbjct: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80

Query: 83  GAMLIQEWEPLTTKLANIAAN---ESFEKVYDFILEVSKDPKFPFQENKPSLIIGHDSRE 139
           G ML  EWE   T LAN A+    E  + ++  +  +  D        +  +++  DSR 
Sbjct: 81  GEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLDLAL-----RARVVVARDSRA 135

Query: 140 SSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNKNTNDVISVDNYYNYF 199
           S P+L   L++    + + ++ + G++TTPQLHF+T   N    + +   +  D YY +F
Sbjct: 136 SGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACN---ERGSAAGVREDLYYAHF 192

Query: 200 NASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTLRGNVSIIXXXXXXX 259
            A+  +   L+   +      L++D+ANG+G  K  +L    P   +  VSII       
Sbjct: 193 VAALEELAALHGLETLPF--PLVVDTANGVGALKARELFRRSP-LFKNRVSIINDNWSQH 249

Query: 260 XXXXXDCGADYVKTNQKLPKGIQ-NPSNLNLHCSFDGDADRIVFYYISEVDQKFHLLDGD 318
                 CGADYVKT Q LP+GI  +    +L CS+DGDADR++FYYI +  ++FHLLDGD
Sbjct: 250 ELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYI-DGQERFHLLDGD 308

Query: 319 KIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNVLKVPVSCTKTGVKHLH 378
           KI+TL AKFL + L    + D + LGVVQTAYANGSST YL+ VL+VPVSCT TGVKHLH
Sbjct: 309 KISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLH 368

Query: 379 HEASTKYDIGIYFEANGHGTVLFSERF----QQVLQNEPKTTAT-----QTLLLFQKIIN 429
            EA  KYD+GIYFEANGHGTV+FSE F    ++ L+N P  +A      QTL  F  +IN
Sbjct: 369 REAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALEN-PALSAKARLSLQTLKTFANLIN 427

Query: 430 QTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFITTNQERQLTS 489
           QT+GDA+ADML VI +LS+   +P  WD+ Y DLPN L KV+VPDRS+F TTN E+QLTS
Sbjct: 428 QTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTS 487

Query: 490 PVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVCKFVLSSVSN 549
           P GLQE ID  V    +GRSFVRASGTEDAVR+YAEAA+Q++ ++L+ +V   V+ S ++
Sbjct: 488 PAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVESTND 547

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (65%)

Query: 56  CGTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87
            G  VGVM+TASHNP +DNG KV    G  +I
Sbjct: 155 VGASVGVMITASHNPKMDNGYKVYYSNGCQII 186

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 57  GTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           G  VGVM+TASHNP +DNG KV    G  +I
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 57  GTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           G  VG+M+TASHNP +DNG KV    G  +I
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVMVTASHNP +DNG KV    G  +I
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAAN-ESFEKVYDF 112
           VGVM+TASHNP +DNG KV    G  +I   +   +   +I AN E +  V+DF
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISD--SIDANLEPWANVWDF 202

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 58  TPVGVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAAN-ESFEKVYD 111
           T  GVM+TASHNP +DNG KV    G  +I   + L  +  +I AN E + + +D
Sbjct: 157 TSCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIGR--HIDANLEPWTRAWD 209

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVM+TASHNP LDNG KV    G  +I
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 56  CGTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87
            G   GVM+TASHNP +DNG KV    G  +I
Sbjct: 151 LGASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVMVTASHNP +DNG KV    G  +I
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           +GVM+TASHNP +DNG KV    G  +I
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%)

Query: 55  LCGTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           L    +GVM+TASHNP +DNG KV    G  +I
Sbjct: 152 LYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 154 VGVMITASHNPKMDNGYKVYFANGCQII 181

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLA-NIAAN-ESFEKVYD 111
           G+M+TASHNP +DNG KV    G  +I    P   +++ +I AN E +++ +D
Sbjct: 157 GIMITASHNPKMDNGYKVYYSNGCQII---PPHDQRISQSILANLEPWDRAWD 206

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 52  SMVLCGTPVGVMVTASHNPPLDNGVKVVEPTGAML 86
           S +  G   G+M+TASHNP +DNG KV    G  +
Sbjct: 155 SNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
            G+M+TASHNP +DNG KV    G  +I
Sbjct: 155 AGIMITASHNPKMDNGYKVYYSNGCQII 182

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87
           VGVM+TASHNP +DNG KV       +I
Sbjct: 153 VGVMITASHNPKMDNGYKVYYDNACQII 180

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 61  GVMVTASHNPPLDNGVKVVEPTGAMLI 87
           GVM+TASHNP  DNG KV    G  +I
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184

>TDEL0H00940 Chr8 complement(154307..155845) [1539 bp, 512 aa] {ON}
           Anc_1.212 YKR058W
          Length = 512

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 8/88 (9%)

Query: 155 IYNADIHNYGLVTTPQLHFITSLWNAKY----NKNTNDVISVDN--YYNYFNASWSKFQE 208
           IYN  + NYG   +P L +  S     +    NK     +S +N  Y+  +N  +  FQE
Sbjct: 214 IYNVTMPNYGYQNSPALKYFKSQVKLVHFIGENKPWKGWVSSENNAYHTRWNRLYRDFQE 273

Query: 209 LYDFNSFKSFENLIIDSANGIGGPKVTD 236
            Y    F  FE + I+  +   GP   D
Sbjct: 274 EYGLLHF--FEEMSIEPPSAPCGPNAVD 299

>Skud_5.176 Chr5 complement(275089..276417) [1329 bp, 442 aa] {ON}
           YER061C (REAL)
          Length = 442

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 30/149 (20%)

Query: 75  GVKVVEPTGAMLIQEWEPLTTK---LANIAANESFEKVYDF-------ILEVSKDPKFPF 124
           G+  V P G  L + W+ L +    L +I +  ++EK Y          + V K P+   
Sbjct: 9   GLGCVTPLGRTLNESWKNLLSSKSGLTSITSLPNYEKDYKAKKKSIPSTITVGKIPEDLH 68

Query: 125 QENK---PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAK 181
            EN      L  G D R +S    KL + TA E     +HN GL+   ++   TSL N  
Sbjct: 69  DENSTIHKLLFTGQDERRTSG-FIKLAIRTAYEA----LHNAGLLNPNEITVNTSLCN-- 121

Query: 182 YNKNTNDVISVDNYYNYFNASWSKFQELY 210
                     +DN+     +     Q++Y
Sbjct: 122 ----------LDNFGCLIGSGIGSIQDVY 140

>KLTH0H07040g Chr8 complement(621645..625103) [3459 bp, 1152 aa]
           {ON} similar to uniprot|P21339 Saccharomyces cerevisiae
           YOR188W MSB1 Protein involved in positive regulation of
           both 1 3-beta-glucan synthesis and the Pkc1p- MAPK
           pathway potential Cdc28p substrate multicopy suppressor
           of temperature-sensitive mutations in CDC24 and CDC42
           and of mutations in BEM4
          Length = 1152

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 304 YISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTN-V 362
           +I   D  FHLL           F+SN LK+ N+   LK  +  + Y    ST Y +  +
Sbjct: 234 WIPASDAMFHLL-----LAFIRSFISNDLKDANIPTSLKTILFNSTYPPKGSTAYDSETI 288

Query: 363 LKVPVSCTKT 372
           L VP+   KT
Sbjct: 289 LTVPIVSLKT 298

>Kpol_1055.60 s1055 (156928..163149) [6222 bp, 2073 aa] {ON}
           (156928..163149) [6222 nt, 2074 aa]
          Length = 2073

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 4/122 (3%)

Query: 270 YVKTNQKLPKGIQNPSNLNLHCSFDGDADRI-VFYYISEVDQKFHLLDGDKIATLFAKFL 328
           ++K+N  L K ++N     +   F G  +    F  + E+ Q + +L  D I    A  L
Sbjct: 161 FLKSNSALFKSVENGDLTKIIAIFGGQGNTDDYFEELRELYQTYDVLISDVIQ-FSADTL 219

Query: 329 SNLLKETNLTDKLKLGV--VQTAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYD 386
             L+K T  T+K+      +     N S T  L  +L +P+SC   GV  L H A T   
Sbjct: 220 IQLIKTTKDTEKIYTQGFNILKWLRNPSLTPDLDYLLSIPISCPLIGVIQLIHYALTARL 279

Query: 387 IG 388
           +G
Sbjct: 280 LG 281

>Skud_8.228 Chr8 complement(395979..400541) [4563 bp, 1520 aa] {ON}
            YHR164C (REAL)
          Length = 1520

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%)

Query: 345  VVQTAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKY 385
            V+ T+Y + +  N LT ++K  ++ T+ G+KH  H  + KY
Sbjct: 1096 VLLTSYTHSAVDNILTKLIKTTINITRLGLKHKVHPDTQKY 1136

>TBLA0D01490 Chr4 (369657..370982) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%)

Query: 467 LAKVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYA 524
             + IV DR + ITT   ++LT P+G+Q K+       T+G++         ++R Y 
Sbjct: 138 FPRSIVSDRDIRITTGVYKELTEPLGIQLKLSSTNHPQTDGQTDATNKTLGRSLRSYC 195

>KLTH0D15070g Chr4 complement(1235757..1241909) [6153 bp, 2050 aa]
           {ON} highly similar to uniprot|P07149 Saccharomyces
           cerevisiae YKL182W FAS1 Beta subunit of fatty acid
           synthetase which catalyzes the synthesis of long-chain
           saturated fatty acids contains acetyltransacylase
           dehydratase enoyl reductase malonyl transacylase and
           palmitoyl transacylase activities
          Length = 2050

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 7/92 (7%)

Query: 302 FYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKL---KLGVVQ-TAYANGSSTN 357
           F  + E+ Q +H +  D + T  +K L+ L++ T+ T+K+      V+Q   +   +  N
Sbjct: 173 FEELRELYQTYHSIISDVVETAASK-LAELVRSTDDTEKVYTQGFDVLQWLQHPEKTPDN 231

Query: 358 YLTNVLKVPVSCTKTGVKHLHHEASTKYDIGI 389
             T +L +P+SC   GV  L H A T   +G+
Sbjct: 232 --TYLLSIPISCPLIGVIQLVHYAVTARVLGL 261

>Smik_11.48 Chr11 (86169..92324) [6156 bp, 2051 aa] {ON} YKL182W
           (REAL)
          Length = 2051

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 11/123 (8%)

Query: 272 KTNQKLPKGI-QNPSNLNLHCSFDGDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSN 330
           K+N  L K + +N + L       G+ D   F  + ++ Q +H+L GD I    A+ LS 
Sbjct: 140 KSNSSLFKAVSENSAQLVAIFGGQGNTDD-YFEELRDLYQTYHVLVGDLIK-FSAETLSE 197

Query: 331 LLKETNLTDKL---KLGVVQ--TAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKY 385
           L++ T   +K+    L +++     +N    +YL   L +P+SC   GV  L H   T  
Sbjct: 198 LIRTTLDAEKVFTQGLNILEWLETPSNTPDKDYL---LSIPISCPLIGVIQLAHYVVTAK 254

Query: 386 DIG 388
            +G
Sbjct: 255 LLG 257

>CAGL0L05302g Chr12 complement(590178..591812) [1635 bp, 544 aa]
           {ON} similar to uniprot|P36076 Saccharomyces cerevisiae
           YKL088w
          Length = 544

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 19/99 (19%)

Query: 303 YYISEVDQKFHLLDG--DKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLT 360
           Y++ + D+KFH+L G    +AT+    + + L +    DK+ + ++ T  A      +  
Sbjct: 260 YFLRQDDKKFHILIGATGSVATIKVPLIIDKLLKLYTPDKISIQLIVTKPA-----EHFL 314

Query: 361 NVLKVPV------------SCTKTGVKHLHHEASTKYDI 387
           N LK+               C K G   LHHE     DI
Sbjct: 315 NGLKISTHVKIWREEDVWSDCKKMGDMILHHELRKWADI 353

>Suva_11.42 Chr11 (85423..91578) [6156 bp, 2051 aa] {ON} YKL182W
           (REAL)
          Length = 2051

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 55/123 (44%), Gaps = 11/123 (8%)

Query: 272 KTNQKLPKGIQNPSNLNLHCSFDGDADRI-VFYYISEVDQKFHLLDGDKIATLFAKFLSN 330
           K+N  L K +    N  L   F G  +    F  + ++ Q +H+L GD I    A  LS 
Sbjct: 140 KSNSALFKAVSE-GNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIK-FSADTLSE 197

Query: 331 LLKETNLTDKL---KLGVVQ--TAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKY 385
           L++ T   +K+    L +++     +N    +YL   L +P+SC   GV  L H   T  
Sbjct: 198 LIRTTLDAEKVFTQGLNILEWLETPSNTPDKDYL---LSIPISCPLIGVIQLAHYVVTAK 254

Query: 386 DIG 388
            +G
Sbjct: 255 LLG 257

>YKL182W Chr11 (100671..106826) [6156 bp, 2051 aa] {ON}  FAS1Beta
           subunit of fatty acid synthetase, which catalyzes the
           synthesis of long-chain saturated fatty acids; contains
           acetyltransacylase, dehydratase, enoyl reductase,
           malonyl transacylase, and palmitoyl transacylase
           activities
          Length = 2051

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 7/121 (5%)

Query: 272 KTNQKLPKGIQNPSNLNLHCSFDGDADRI-VFYYISEVDQKFHLLDGDKIATLFAKFLSN 330
           K+N  L + +    N  L   F G  +    F  + ++ Q +H+L GD I    A+ LS 
Sbjct: 140 KSNSALFRAVGE-GNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIK-FSAETLSE 197

Query: 331 LLKETNLTDKL---KLGVVQTAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDI 387
           L++ T   +K+    L +++    N S+T     +L +P+SC   GV  L H   T   +
Sbjct: 198 LIRTTLDAEKVFTQGLNILE-WLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLL 256

Query: 388 G 388
           G
Sbjct: 257 G 257

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 47/115 (40%), Gaps = 8/115 (6%)

Query: 328 LSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDI 387
           L+ L+K     +KLKL        +  S N + N+  +     K G K   H+A+   D 
Sbjct: 468 LNKLIKRRK--EKLKLRDEMKDRKSQVSQNRMKNLASLAEDNVKQGAKRSRHQATIDNDP 525

Query: 388 GIYFEANGHGTVLFS------ERFQQVLQNEPKTTATQTLLLFQKIINQTVGDAM 436
              F AN    ++++      E F++ L+ E K       LL +   N T  D +
Sbjct: 526 NDTFGANDEDWLIYTDITQNPEAFEEALEYEYKDIVELERLLLEHDPNFTEEDTL 580

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,651,861
Number of extensions: 2630814
Number of successful extensions: 8388
Number of sequences better than 10.0: 76
Number of HSP's gapped: 8530
Number of HSP's successfully gapped: 76
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)