Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F001906.9ON41141121000.0
NDAI0K029006.9ON43843114690.0
ZYRO0F00462g6.9ON39339413540.0
TDEL0G046206.9ON39239713410.0
Kpol_1045.786.9ON39240112471e-171
Suva_5.126.9ON40140512111e-165
Smik_5.316.9ON42740611921e-162
CAGL0B03575g6.9ON41939611811e-160
TPHA0M001906.9ON39140811731e-159
SAKL0E00814g6.9ON39840311721e-159
Skud_5.336.9ON40140111711e-159
YEL056W (HAT2)6.9ON40139911681e-159
KNAG0E009806.9ON41440411651e-158
Ecym_30126.9ON39737511461e-155
KLLA0D00814g6.9ON40839911081e-149
Kwal_56.223456.9ON39638210991e-148
KAFR0L003206.9ON39138510871e-146
ACR017W6.9ON42337710891e-146
KLTH0C11550g6.9ON39838310861e-146
TBLA0A071206.9ON4073929771e-129
Kpol_1024.398.548ON4174303081e-30
YBR195C (MSI1)8.548ON4224113081e-30
NDAI0C055108.548ON4194303037e-30
AEL250C8.548ON4174103002e-29
KLTH0E12694g8.548ON4184052975e-29
Ecym_70428.548ON4144202965e-29
Skud_2.3218.548ON4224282967e-29
TBLA0H036508.548ON4194182967e-29
TPHA0L017208.548ON4194102967e-29
Smik_2.3358.548ON4224182941e-28
Kwal_27.120708.548ON4184072913e-28
KLLA0E23541g8.548ON4174032825e-27
KAFR0I008408.548ON4134102817e-27
SAKL0H09900g8.548ON4254272792e-26
CAGL0M05291g8.548ON4194202738e-26
Suva_4.4498.548ON4244192731e-25
TDEL0B029808.548ON4124112712e-25
KNAG0A036708.548ON4264252702e-25
ZYRO0A13068g8.548ON3974012595e-24
NCAS0B021708.548ON4144262605e-24
Suva_13.3112.401ON5103971765e-13
KAFR0A003802.401ON5164011749e-13
TPHA0G026502.401ON5164011749e-13
KLTH0E09394g2.401ON5223961703e-12
CAGL0K03861g2.401ON5133941641e-11
YMR131C (RRB1)2.401ON5114001632e-11
Kwal_47.178272.401ON5233971622e-11
Skud_13.2912.401ON5093981613e-11
Kpol_1041.202.401ON5153991614e-11
TDEL0G033402.401ON5144001604e-11
Smik_13.3292.401ON5093991588e-11
Sklu_YGOB_Anc_2.4012.401ON5204011588e-11
KNAG0E021802.401ON5174021552e-10
Kwal_33.151365.201ON4731751533e-10
TBLA0B092502.401ON5263991534e-10
KLLA0F17237g2.401ON5233961491e-09
KLTH0B03410g5.201ON4771741481e-09
NCAS0F019702.401ON5114041463e-09
Ecym_60672.401ON5222881444e-09
TPHA0C008608.316ON3783091435e-09
NDAI0H027502.401ON5124041427e-09
ADR242C2.401ON5214001411e-08
ZYRO0A08690g2.401ON5164021401e-08
CAGL0D05588g5.201ON4771281373e-08
SAKL0H15708g8.316ON3682981329e-08
KLLA0F15598g5.201ON4781731339e-08
Suva_4.537.310ON12712151331e-07
TBLA0H002303.22ON13332081322e-07
ZYRO0F05808g7.310ON12822051322e-07
AEL269C7.534ON4552291302e-07
KAFR0J009805.201ON4801621302e-07
Kpol_1060.246.276ON4861711284e-07
KNAG0A012303.22ON13212011294e-07
Ecym_42498.316ON3742421266e-07
Smik_4.457.310ON12702051277e-07
NCAS0G011206.276ON4941691251e-06
Kpol_1038.203.22ON13132051261e-06
KNAG0I010508.288ON11591511251e-06
Kpol_1019.307.310ON12522161251e-06
Suva_10.645.201ON4901641212e-06
KAFR0E012303.259ON3692451202e-06
Ecym_21396.276ON4352981213e-06
SAKL0A02970g6.276ON4152481213e-06
Skud_4.637.310ON12732051213e-06
TBLA0C009902.663ON3931511203e-06
AAL157C5.201ON4791391204e-06
NDAI0B051901.247ON6681961204e-06
NCAS0E037507.310ON12762171205e-06
Smik_12.525.201ON4891301195e-06
KLLA0E08449g2.283ON4222041185e-06
YDL195W (SEC31)7.310ON12732141196e-06
KNAG0I009208.316ON3812381177e-06
YLL011W (SOF1)5.201ON4891301178e-06
TPHA0F007704.122ON6311241188e-06
KAFR0E039005.429ON4392361179e-06
KLLA0F05159g7.310ON12311881171e-05
TPHA0A003803.22ON13102071171e-05
Kpol_1048.598.544ON8502401161e-05
NDAI0F012406.276ON5241671152e-05
AAR078W7.356ON5621731152e-05
Suva_2.3038.316ON3772621142e-05
KLLA0D04840g1.399ON3031821132e-05
TDEL0F044308.316ON3672311123e-05
Kwal_0.2121.399ON3031541113e-05
Ecym_71055.201ON4841741133e-05
Skud_12.565.201ON4891301123e-05
AGL190W8.316ON3702381104e-05
Kpol_487.71.399ON3031981105e-05
KAFR0F010606.276ON5531731115e-05
ZYRO0F09922g5.429ON4552201105e-05
KLTH0H12122g1.399ON3031541095e-05
TDEL0C023607.310ON12642661116e-05
KAFR0I028603.22ON13652071117e-05
KLLA0A08822g4.122ON5821231107e-05
KLTH0G12430g8.316ON3672381088e-05
NCAS0B036908.288ON11451391099e-05
Skud_4.4018.316ON3762501089e-05
ADL186C3.22ON13612051091e-04
TBLA0C050107.356ON5721681081e-04
Kpol_1036.658.316ON3712611071e-04
CAGL0M02277g8.672ON4271841071e-04
KNAG0A012503.25ON4522071071e-04
TPHA0B011201.247ON7191931071e-04
KNAG0I028406.340ON5192111062e-04
Ecym_55285.429ON4712011062e-04
Kpol_1061.364.122ON5891231062e-04
Kpol_1028.546.325ON9052151072e-04
Skud_11.2711.247ON6462181062e-04
CAGL0H03729g1.399ON3031541052e-04
ADR090W7.310ON12332401072e-04
Smik_15.163.22ON13262051072e-04
Skud_3.1336.325ON9162161062e-04
YPL247C6.276ON5231781062e-04
Kwal_27.120538.544ON7552401062e-04
Kwal_56.238958.316ON3672381052e-04
KLLA0E07965g2.663ON3901461052e-04
NCAS0B035508.316ON3752401052e-04
CAGL0M04081g3.25ON4552211052e-04
NDAI0J018504.122ON5751321052e-04
ZYRO0E08184g6.276ON5062001052e-04
Smik_6.4516.276ON5231781053e-04
SAKL0A01738g6.325ON9092141053e-04
KLTH0H02772g6.276ON4202521043e-04
ZYRO0D05852g8.316ON3712441043e-04
CAGL0F06853g2.663ON3881491043e-04
Kwal_27.115502.283ON4071551043e-04
NDAI0G038303.25ON5102081043e-04
TBLA0F041306.340ON5142431043e-04
SAKL0F15972g7.534ON4701671034e-04
KLLA0B02827g4.275ON9422091044e-04
Ecym_46447.338ON2952121024e-04
SAKL0F11506g7.356ON5681751034e-04
NDAI0J010408.316ON3982021034e-04
SAKL0H16390g8.288ON11401371044e-04
Suva_11.2681.247ON6452151034e-04
KAFR0L013907.322ON12061181045e-04
TBLA0A038908.316ON3622411025e-04
YKR036C (CAF4)1.247ON6432321035e-04
Suva_15.223.22ON13362051035e-04
SAKL0E07766g2.283ON3981411025e-04
KAFR0C038302.663ON3811281016e-04
NCAS0A042702.431ON3182391016e-04
CAGL0A00605g4.122ON6401561026e-04
KLTH0E12606g8.544ON7552441026e-04
KAFR0L013207.310ON12402091026e-04
NDAI0I004606.325ON9172161026e-04
SAKL0H22396g4.122ON5551881027e-04
KAFR0A064804.122ON5681801017e-04
NDAI0J011808.288ON11341391028e-04
ZYRO0B02486g7.356ON5751701018e-04
Ecym_56352.663ON3851471008e-04
CAGL0J01265g2.469ON5171751018e-04
KLTH0F16192g5.429ON4621961008e-04
KNAG0B028007.310ON13071971018e-04
KLLA0E04093g8.316ON3722471000.001
TPHA0B005904.309ON588921000.001
NCAS0F018502.431ON318239990.001
TPHA0D038306.325ON9121551010.001
Suva_3.936.325ON9202161010.001
TPHA0C033702.283ON413165990.001
TPHA0E017905.429ON441197990.001
KLLA0E19515g7.356ON5721701000.001
Kwal_56.236858.288ON11021371000.001
SAKL0F10384g7.310ON12611861000.001
KNAG0C049505.429ON440198990.001
NCAS0C044503.25ON461230990.001
SAKL0H09988g8.544ON749174990.001
Kwal_56.244787.310ON1296184990.001
Smik_11.2981.247ON662218990.002
KAFR0L015207.356ON584173980.002
Smik_13.2772.469ON513212980.002
KLTH0E08162g4.122ON55661980.002
Skud_16.326.276ON522178980.002
CAGL0E02805g4.106ON84058980.002
YMR093W (UTP15)2.469ON513212980.002
TDEL0G021402.283ON392137970.002
TPHA0D035906.276ON598181980.002
NDAI0C001702.663ON401148970.002
KLLA0F19734g8.288ON1133150980.002
Kpol_297.72.431ON318242960.002
NCAS0F033405.429ON448188970.002
KLTH0C00616g2.663ON407155970.002
Smik_16.795.104ON593215970.002
YJL112W (MDV1)1.247ON714202970.002
TBLA0D040208.288ON1178150980.002
KNAG0D007406.276ON504172970.002
TDEL0F022304.122ON556124970.002
ZYRO0D08206g6.340ON515253970.003
TPHA0C010508.288ON1124138970.003
TBLA0G014904.122ON732155970.003
TPHA0I018808.544ON1034147970.003
KLLA0E21187g5.429ON429193960.003
KAFR0I028403.25ON456208960.003
KLLA0E23453g8.544ON826240970.003
Smik_7.2874.122ON566134970.003
YDR142C (PEX7)8.316ON375262960.003
YBR103W (SIF2)3.344ON535170960.003
TDEL0B059701.399ON303256950.003
Smik_11.101.534ON717105960.003
NCAS0H035302.663ON384147960.003
KNAG0B027207.322ON1204119970.003
CAGL0K00275g1.534ON715109960.003
CAGL0H00781g6.276ON513175960.003
Ecym_80617.310ON1228187960.003
NCAS0C027108.435ON815269960.003
KLTH0G13068g8.288ON1101137960.004
TDEL0A074006.325ON901216960.004
KLLA0D02530g4.309ON70797960.004
TDEL0B075802.663ON390152950.004
KNAG0I025406.325ON918216960.004
KLLA0D12760g6.276ON49359950.004
Suva_14.3112.283ON389183950.004
TPHA0L016908.544ON83297960.004
SAKL0G02398g5.429ON471218950.004
Suva_2.2918.288ON1151149960.004
NCAS0G036001.399ON327260940.004
YGR225W (AMA1)5.104ON593216950.004
Suva_7.1526.135ON612106950.004
KLTH0H01122g7.356ON579161950.004
TBLA0D026308.67ON862119950.004
TBLA0F024007.338ON298274930.005
Kwal_26.75702.431ON21892920.005
Kpol_1011.68.67ON762103950.005
Suva_3.1096.340ON515235940.005
TDEL0A004103.22ON1262203950.005
SAKL0C13266g3.25ON459213940.005
Suva_8.915.634ON87863950.005
Kpol_1058.318.67ON675120940.005
SAKL0G19668g2.663ON394152940.005
ZYRO0A12980g8.544ON824146950.005
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00190
         (411 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   813   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     570   0.0  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   526   0.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   521   0.0  
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   484   e-171
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   471   e-165
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   463   e-162
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   459   e-160
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   456   e-159
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   456   e-159
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   455   e-159
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   454   e-159
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   453   e-158
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   446   e-155
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   431   e-149
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   427   e-148
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   423   e-146
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   424   e-146
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   422   e-146
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   380   e-129
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   123   1e-30
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   123   1e-30
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   121   7e-30
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   120   2e-29
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   119   5e-29
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   118   5e-29
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   118   7e-29
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   118   7e-29
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   118   7e-29
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   117   1e-28
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   116   3e-28
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   113   5e-27
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   112   7e-27
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   112   2e-26
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   109   8e-26
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   109   1e-25
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   108   2e-25
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   108   2e-25
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   104   5e-24
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   104   5e-24
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    72   5e-13
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    72   9e-13
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    72   9e-13
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    70   3e-12
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    68   1e-11
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    67   2e-11
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    67   2e-11
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    67   3e-11
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    67   4e-11
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    66   4e-11
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    65   8e-11
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    65   8e-11
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    64   2e-10
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    64   3e-10
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    64   4e-10
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    62   1e-09
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    62   1e-09
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    61   3e-09
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    60   4e-09
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    60   5e-09
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    59   7e-09
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    59   1e-08
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    59   1e-08
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    57   3e-08
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    55   9e-08
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    56   9e-08
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    56   1e-07
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    55   2e-07
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    55   2e-07
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    55   2e-07
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    55   2e-07
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    54   4e-07
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    54   4e-07
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    53   6e-07
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    54   7e-07
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    53   1e-06
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    53   1e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    53   1e-06
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    53   1e-06
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    51   2e-06
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    51   2e-06
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    51   3e-06
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    51   3e-06
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    51   3e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    51   3e-06
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    51   4e-06
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    51   4e-06
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    51   5e-06
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    50   5e-06
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    50   5e-06
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    50   6e-06
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    50   7e-06
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    50   8e-06
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    50   8e-06
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    50   9e-06
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    50   1e-05
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    50   1e-05
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    49   1e-05
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    49   2e-05
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    49   2e-05
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    49   2e-05
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    48   2e-05
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    48   3e-05
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    47   3e-05
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    48   3e-05
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    48   3e-05
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    47   4e-05
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    47   5e-05
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    47   5e-05
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    47   5e-05
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    47   5e-05
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    47   6e-05
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    47   7e-05
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    47   7e-05
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    46   8e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    47   9e-05
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    46   9e-05
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    47   1e-04
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    46   1e-04
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    46   1e-04
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    46   1e-04
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    46   1e-04
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    46   1e-04
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    45   2e-04
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    45   2e-04
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    45   2e-04
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    46   2e-04
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    45   2e-04
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    45   2e-04
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    46   2e-04
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    46   2e-04
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    45   2e-04
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    45   2e-04
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    45   2e-04
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    45   2e-04
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    45   2e-04
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    45   2e-04
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    45   2e-04
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    45   2e-04
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    45   2e-04
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    45   3e-04
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    45   3e-04
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    45   3e-04
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    45   3e-04
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    45   3e-04
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    45   3e-04
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      45   3e-04
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    45   3e-04
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    44   4e-04
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    45   4e-04
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    44   4e-04
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    44   4e-04
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    44   4e-04
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    45   4e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    44   4e-04
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    45   5e-04
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    44   5e-04
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    44   5e-04
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    44   5e-04
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    44   5e-04
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    44   6e-04
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    44   6e-04
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    44   6e-04
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    44   6e-04
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    44   6e-04
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       44   6e-04
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    44   7e-04
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    44   7e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    44   8e-04
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    44   8e-04
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    43   8e-04
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    44   8e-04
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    43   8e-04
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    44   8e-04
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    43   0.001
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    43   0.001
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    43   0.001
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    44   0.001
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    44   0.001
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    43   0.001
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    43   0.001
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    43   0.001
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    43   0.001
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    43   0.001
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    43   0.001
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      43   0.001
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    43   0.001
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    43   0.001
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    43   0.002
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    42   0.002
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    42   0.002
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    42   0.002
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    42   0.002
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    42   0.002
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    42   0.002
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    42   0.002
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    42   0.002
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    42   0.002
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    42   0.002
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    42   0.002
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    42   0.002
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    42   0.002
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    42   0.002
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    42   0.002
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    42   0.002
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    42   0.002
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    42   0.002
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    42   0.003
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    42   0.003
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    42   0.003
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    42   0.003
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    42   0.003
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    42   0.003
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    42   0.003
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    42   0.003
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    42   0.003
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    42   0.003
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    41   0.003
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    42   0.003
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     42   0.003
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    42   0.003
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    42   0.003
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    42   0.003
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    42   0.003
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    42   0.003
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    42   0.004
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    42   0.004
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    42   0.004
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    41   0.004
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    42   0.004
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    41   0.004
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    41   0.004
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    42   0.004
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    41   0.004
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    42   0.004
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    41   0.004
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    41   0.004
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    41   0.004
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    41   0.004
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    41   0.004
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    40   0.005
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    40   0.005
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    41   0.005
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    41   0.005
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    41   0.005
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    41   0.005
Suva_8.91 Chr8 complement(165427..168063) [2637 bp, 878 aa] {ON}...    41   0.005
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    41   0.005
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    41   0.005
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    41   0.005
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    41   0.005
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    41   0.005
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    41   0.005
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    41   0.005
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    40   0.005
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    41   0.006
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    41   0.006
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    41   0.006
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    40   0.006
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    41   0.006
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    41   0.006
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    40   0.006
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    41   0.006
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    41   0.006
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    41   0.007
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    41   0.007
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    40   0.007
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    40   0.007
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    40   0.007
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    40   0.007
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    40   0.007
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    40   0.007
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    40   0.008
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    40   0.008
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    40   0.008
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    40   0.008
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    40   0.008
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    40   0.008
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    40   0.008
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    40   0.008
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    40   0.008
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    40   0.008
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    40   0.008
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    40   0.009
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    40   0.009
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    40   0.009
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    40   0.009
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    40   0.009
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    40   0.009
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    40   0.009
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    40   0.009
Skud_15.203 Chr15 complement(362659..365292) [2634 bp, 877 aa] {...    40   0.009
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    40   0.010
YOR038C Chr15 complement(402761..405388) [2628 bp, 875 aa] {ON} ...    40   0.010
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    40   0.010
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    40   0.010
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    40   0.010
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    40   0.011
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    40   0.011
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    40   0.011
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    40   0.011
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    40   0.012
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    40   0.012
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    40   0.012
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    40   0.012
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.012
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    40   0.012
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    40   0.012
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    40   0.012
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    40   0.012
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    40   0.013
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    40   0.013
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    40   0.013
Smik_15.217 Chr15 complement(368813..371440) [2628 bp, 875 aa] {...    40   0.014
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    39   0.014
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    39   0.014
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    39   0.014
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    39   0.014
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    40   0.014
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    40   0.014
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    40   0.015
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    40   0.015
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    39   0.015
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    40   0.015
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    39   0.015
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    39   0.015
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    39   0.015
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    40   0.016
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    40   0.016
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    40   0.016
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    40   0.016
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    39   0.017
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    39   0.017
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    39   0.017
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    39   0.017
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    39   0.017
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    39   0.018
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    39   0.018
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    39   0.018
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    39   0.019
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    39   0.019
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    39   0.019
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    39   0.019
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    39   0.020
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    39   0.021
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    39   0.021
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    39   0.022
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    39   0.022
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    39   0.022
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    39   0.022
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    39   0.023
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    39   0.023
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    39   0.023
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    39   0.024
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    39   0.024
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    39   0.024
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    39   0.024
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    39   0.024
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    39   0.024
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    39   0.025
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    39   0.025
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    38   0.026
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    39   0.026
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    39   0.026
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    39   0.027
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    39   0.027
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             39   0.027
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    39   0.029
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    39   0.029
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    39   0.029
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    38   0.029
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     39   0.029
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    39   0.029
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    39   0.030
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    38   0.030
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    39   0.031
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     38   0.031
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    39   0.032
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    39   0.034
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    39   0.034
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    38   0.035
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    38   0.035
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    38   0.035
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    39   0.036
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    39   0.036
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     38   0.036
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    38   0.036
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    38   0.036
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.037
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    38   0.038
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    38   0.038
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    38   0.038
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    38   0.039
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    38   0.039
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    38   0.039
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    38   0.040
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    38   0.040
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    38   0.041
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    38   0.041
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    38   0.041
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    38   0.042
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    38   0.042
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    38   0.043
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    38   0.043
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    38   0.044
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    38   0.044
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    38   0.045
YDL156W Chr4 (174918..176486) [1569 bp, 522 aa] {ON}  CMR1DNA-bi...    38   0.045
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    38   0.045
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    38   0.046
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    38   0.046
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    38   0.047
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    38   0.048
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    38   0.051
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    38   0.051
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    38   0.052
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     38   0.054
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    38   0.054
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    38   0.054
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    38   0.054
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    38   0.055
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    37   0.055
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    38   0.056
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    38   0.056
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    38   0.056
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    37   0.057
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    37   0.057
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    38   0.057
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    38   0.057
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    38   0.057
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      37   0.059
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    37   0.059
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    38   0.060
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    38   0.061
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    37   0.063
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    37   0.064
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    38   0.064
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    38   0.064
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       37   0.064
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    37   0.065
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    37   0.066
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    37   0.068
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    37   0.069
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    37   0.071
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    37   0.072
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    37   0.072
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    37   0.073
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    37   0.076
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    37   0.076
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    37   0.077
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    37   0.079
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    37   0.081
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    37   0.082
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    37   0.082
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    37   0.084
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    37   0.085
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    37   0.086
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    37   0.089
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    37   0.089
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    37   0.089
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    37   0.090
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    37   0.093
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    37   0.093
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    37   0.093
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    37   0.095
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    37   0.096
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    37   0.098
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    37   0.098
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    37   0.099
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    37   0.10 
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    37   0.10 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    37   0.10 
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    37   0.10 
CAGL0L09757g Chr12 complement(1048895..1049875) [981 bp, 326 aa]...    37   0.11 
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    37   0.11 
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    36   0.11 
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    37   0.11 
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    37   0.11 
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     37   0.11 
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    36   0.11 
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    37   0.11 
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    37   0.12 
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    37   0.12 
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    37   0.12 
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    37   0.12 
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    37   0.13 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    37   0.14 
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    36   0.14 
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    37   0.14 
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    36   0.14 
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    36   0.15 
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      36   0.15 
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    37   0.15 
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    36   0.16 
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    36   0.16 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    36   0.16 
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    36   0.17 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    36   0.17 
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    36   0.17 
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    36   0.18 
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    36   0.18 
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    36   0.19 
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    36   0.19 
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    36   0.19 
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    36   0.20 
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    36   0.21 
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    35   0.21 
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    36   0.21 
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    35   0.21 
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    36   0.21 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    35   0.22 
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    36   0.23 
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    36   0.23 
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    36   0.23 
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    35   0.23 
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    35   0.24 
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    36   0.24 
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    36   0.24 
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    35   0.24 
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    36   0.25 
TBLA0A07380 Chr1 complement(1829567..1832275) [2709 bp, 902 aa] ...    36   0.25 
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    35   0.25 
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    35   0.26 
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    35   0.26 
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    35   0.27 
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    35   0.27 
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    35   0.28 
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    35   0.28 
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    35   0.29 
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    35   0.29 
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    35   0.29 
KLLA0E21847g Chr5 complement(1948687..1951230) [2544 bp, 847 aa]...    35   0.30 
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    35   0.30 
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    35   0.30 
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    35   0.31 
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    35   0.31 
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    35   0.31 
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    35   0.32 
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    35   0.32 
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    35   0.32 
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    35   0.33 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   0.33 
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    35   0.34 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    35   0.34 
Kwal_14.1675 s14 (419094..420215) [1122 bp, 373 aa] {ON} YBR234C...    35   0.36 
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    35   0.36 
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    35   0.36 
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    35   0.36 
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    35   0.37 
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    35   0.37 
TDEL0H02670 Chr8 complement(447727..449049) [1323 bp, 440 aa] {O...    35   0.37 
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    35   0.37 
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    35   0.38 
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    35   0.38 
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    35   0.38 
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    35   0.38 
Smik_2.377 Chr2 complement(671569..672723) [1155 bp, 384 aa] {ON...    35   0.40 
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    35   0.40 
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    35   0.40 
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    35   0.41 
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    35   0.42 
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              35   0.42 
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    35   0.42 
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    34   0.44 
YBR234C Chr2 complement(685438..686592) [1155 bp, 384 aa] {ON}  ...    35   0.44 
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       35   0.44 
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    35   0.44 
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    34   0.48 
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    35   0.48 
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    35   0.49 
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    34   0.49 
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    35   0.50 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    34   0.50 
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    35   0.54 
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     35   0.55 
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    34   0.55 
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    35   0.57 
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    33   0.58 
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    34   0.59 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     34   0.60 
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    34   0.60 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    34   0.63 
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    34   0.63 
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    34   0.63 
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    34   0.63 
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    34   0.63 
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    34   0.67 
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    34   0.67 
Skud_2.366 Chr2 complement(654186..655340) [1155 bp, 384 aa] {ON...    34   0.68 
Smik_4.81 Chr4 (151682..153250) [1569 bp, 522 aa] {ON} YDL156W (...    34   0.70 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    34   0.71 
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    34   0.73 
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    34   0.73 
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    34   0.74 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    34   0.74 
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    34   0.75 
SAKL0G01694g Chr7 (142556..145099) [2544 bp, 847 aa] {ON} simila...    34   0.76 
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    34   0.76 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    34   0.77 
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    34   0.78 
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    34   0.83 
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     34   0.84 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    33   0.85 
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    33   0.87 
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    33   0.87 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    33   0.89 
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    33   0.90 
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    33   0.95 
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    33   0.95 
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    34   0.98 
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    33   0.98 
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    33   1.00 
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    34   1.0  
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    33   1.0  
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    33   1.0  
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    33   1.0  
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    33   1.0  
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    33   1.0  
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    33   1.0  
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    33   1.0  
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    33   1.0  
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    33   1.1  
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    33   1.1  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    33   1.1  
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    33   1.1  
AFL022W Chr6 (397359..398474) [1116 bp, 371 aa] {ON} Syntenic ho...    33   1.1  
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    33   1.1  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    33   1.1  
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    33   1.1  
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    33   1.1  
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    33   1.1  
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    33   1.2  
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    33   1.2  
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    33   1.2  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    33   1.2  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    33   1.2  
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    33   1.2  
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    33   1.2  
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    33   1.2  
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    33   1.2  
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    33   1.2  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    33   1.3  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    33   1.3  
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    33   1.3  
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    33   1.3  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    33   1.3  
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    33   1.3  
AEL154C Chr5 complement(339962..342628) [2667 bp, 888 aa] {ON} S...    33   1.3  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    33   1.3  
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    33   1.3  
KLLA0F10615g Chr6 (978492..979604) [1113 bp, 370 aa] {ON} highly...    33   1.3  
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    33   1.3  
KAFR0C06010 Chr3 complement(1196930..1199554) [2625 bp, 874 aa] ...    33   1.4  
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    33   1.4  
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    33   1.4  
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    33   1.4  
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    33   1.4  
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    33   1.4  
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    33   1.5  
Ecym_2274 Chr2 (539468..540592) [1125 bp, 374 aa] {ON} similar t...    33   1.5  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    33   1.5  
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    33   1.5  
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    33   1.5  
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    33   1.5  
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    33   1.5  
ZYRO0C11308g Chr3 complement(874724..877390) [2667 bp, 888 aa] {...    33   1.5  
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    33   1.5  
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    33   1.5  
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    33   1.6  
NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.1...    33   1.6  
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    33   1.6  
TPHA0J01960 Chr10 complement(442993..444126) [1134 bp, 377 aa] {...    33   1.7  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    33   1.7  
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    33   1.7  
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    33   1.7  
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    33   1.7  
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    33   1.7  
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    33   1.7  
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    33   1.7  
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    33   1.7  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    33   1.7  
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    33   1.8  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    33   1.8  
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    33   1.8  
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      33   1.9  
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    33   1.9  
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    33   1.9  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    33   1.9  
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    33   1.9  
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    33   1.9  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    33   1.9  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    33   1.9  
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    33   2.0  
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    33   2.0  
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    32   2.0  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    32   2.0  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    33   2.1  
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    32   2.1  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    32   2.1  
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    33   2.1  
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    32   2.1  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    33   2.1  
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    33   2.1  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    33   2.1  
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    32   2.1  
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    33   2.1  
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    32   2.3  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    32   2.3  
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    33   2.3  
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    32   2.3  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    32   2.3  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    32   2.3  
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    32   2.4  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    32   2.4  
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    32   2.4  
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    32   2.4  
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    32   2.4  
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    32   2.4  
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    32   2.4  
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     32   2.5  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   2.5  
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    32   2.5  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    32   2.5  
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    32   2.6  
Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar...    32   2.6  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    32   2.6  
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    32   2.7  
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    32   2.8  
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    32   2.9  
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    32   2.9  
TPHA0C00290 Chr3 (46991..49915) [2925 bp, 974 aa] {ON} Anc_5.634...    32   2.9  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    32   2.9  
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    32   2.9  
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    32   2.9  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    32   2.9  
KNAG0B03080 Chr2 (593481..596162) [2682 bp, 893 aa] {ON} Anc_5.6...    32   2.9  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    32   3.0  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    32   3.0  
CAGL0K07095g Chr11 (698857..699972) [1116 bp, 371 aa] {ON} highl...    32   3.1  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    32   3.1  
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    32   3.1  
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    32   3.2  
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    32   3.2  
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    32   3.3  
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    32   3.3  
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    32   3.6  
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    32   3.6  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    32   3.7  
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    32   3.8  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    32   3.8  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    32   3.8  
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    32   3.9  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    32   4.0  
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    32   4.0  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    31   4.0  
ACR088W Chr3 (515561..518113) [2553 bp, 850 aa] {ON} Syntenic ho...    32   4.0  
NCAS0D03400 Chr4 complement(635698..636840) [1143 bp, 380 aa] {O...    32   4.1  
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    32   4.2  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    32   4.3  
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    32   4.4  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    32   4.5  
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    31   4.5  
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    31   4.6  
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    32   4.6  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    31   4.8  
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    32   4.8  
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    31   4.8  
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    32   4.8  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    32   5.0  
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    32   5.1  
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    31   5.4  
TDEL0A01650 Chr1 (298190..299332) [1143 bp, 380 aa] {ON} Anc_6.1...    31   5.4  
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    31   5.5  
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               31   5.6  
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    31   5.7  
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    31   5.8  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    31   6.1  
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    31   6.1  
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    31   6.2  
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    31   6.2  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    31   6.2  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    31   6.4  
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    31   6.4  
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    31   6.5  
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    31   6.5  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    31   6.8  
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    31   7.1  
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    31   7.2  
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    31   7.5  
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    31   7.7  
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    31   7.8  
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    31   7.9  
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    30   8.0  
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    31   8.0  
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    30   8.1  
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    30   8.2  
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    30   8.2  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    30   8.2  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    31   8.3  
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               30   9.1  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    30   9.2  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    30   9.2  
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    30   9.4  
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    30   9.7  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    30   9.8  
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    30   9.9  

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/411 (95%), Positives = 392/411 (95%)

Query: 1   MDALMEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQE 60
           MDALMEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQE
Sbjct: 1   MDALMEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQE 60

Query: 61  KSAQAPNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXX 120
           KSAQAPNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGE          
Sbjct: 61  KSAQAPNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKII 120

Query: 121 XXXXXXXXXTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSF 180
                    TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSF
Sbjct: 121 KKFKHEEEITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSF 180

Query: 181 NCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED 240
           NCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED
Sbjct: 181 NCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED 240

Query: 241 STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300
           STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS
Sbjct: 241 STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG 360
           MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG
Sbjct: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG 360

Query: 361 HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
           HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE
Sbjct: 361 HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/431 (64%), Positives = 338/431 (78%), Gaps = 23/431 (5%)

Query: 4   LMEKMAA-------VQGEEE----DPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSL 52
           L+EK+AA       +  +EE    D NKEL+IDEEY+LW+SNVPLMYDFVSET+LTWP+L
Sbjct: 8   LLEKLAADPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTL 67

Query: 53  SLEWLPQEKSAQ-APNRQELIIGTHTSGEEDNYLKIAAIDLPNDII-PSTEKLEDQQKG- 109
           ++EWLP   S+    NRQELI+GTHTSGEEDNYLKIAAIDLP++++ PST  L+ Q++  
Sbjct: 68  TVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDD 127

Query: 110 ------EXXXXXXXXXXXXXXXXXXXTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSG 163
                 +                   TRAR+MPQN++++ATINGSG VF+Y++S DK S 
Sbjct: 128 EDEDDQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSA 187

Query: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS---SPIYVWSSVHSDI 220
           L+ST  +HKENGYGLSFN ND GKLLSGSDDGTIALW++  +++    P+ +W SVH+DI
Sbjct: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280
           VNDCKW+ F+ NVF SVSEDSTLQLHDQRE++T  +  K   PFNTLAFSKHSQYL AAA
Sbjct: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGV 340
           GTDS VYL+D R++S PL+SM GH+ ++TN+EFSP  DG+L++SG DRR I+WDI DIG 
Sbjct: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGA 367

Query: 341 EQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVG 400
           EQIPDDAEDGAPEV+MIHAGHRSA+NDFS+NPNIPWLMAS+EEENIIQVWKCSHKLP VG
Sbjct: 368 EQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVG 427

Query: 401 GTPTVSVSQLE 411
           GTP VSVS LE
Sbjct: 428 GTPEVSVSILE 438

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/394 (62%), Positives = 302/394 (76%), Gaps = 7/394 (1%)

Query: 18  PNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHT 77
           P K LSIDEEY+LW+SNVPLMYDFVSET LTWPSL+LEWLP  +S+   NRQE+I+GTHT
Sbjct: 7   PEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS---NRQEMILGTHT 63

Query: 78  SGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQ 137
           S EE NYLKIAAI LP++++P  E  E+    E                   TRARYMPQ
Sbjct: 64  SDEEQNYLKIAAIYLPDEVVPDAEPKEE----EEVLKSNVKIIKKFEHENEVTRARYMPQ 119

Query: 138 NSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           + NL+ATI+G G ++LY+R+ +  SGL+STF++H ENGYGLSFN N+ GKLLSGSDD  I
Sbjct: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNI 179

Query: 198 ALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQ 257
            LW+V   +  PI  ++  HSDIVNDCKW NFD N+FGSVSEDSTLQLHDQR +D    +
Sbjct: 180 VLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEK 239

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317
            +   P+NTLAFS HS  LFAAAGTDS VYL+DRR  S+PLH M GH+ AVT++EF P +
Sbjct: 240 VQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE 299

Query: 318 DGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377
           DG+L+++G DRR I+WD+ +IG EQ+PDDA+DG+PEV+MIHAGHRS+INDFSMNPNIPWL
Sbjct: 300 DGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWL 359

Query: 378 MASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
            A++EEENI+QVWK S KLPR+GGTP+V    LE
Sbjct: 360 TATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/397 (63%), Positives = 301/397 (75%), Gaps = 7/397 (1%)

Query: 15  EEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIG 74
           EE  +K LSIDEEYELWRSNVPLMYDFVSET LTWP+L+LEWLP    +   NRQELI+G
Sbjct: 3   EEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHS---NRQELILG 59

Query: 75  THTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARY 134
           THTS EE NYLKIAAIDLP++I+P  E   D+++ +                   TRARY
Sbjct: 60  THTSEEEPNYLKIAAIDLPDEIVPGKE---DRER-DGFTKSNIKIIKKFKHEQEVTRARY 115

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDD 194
           MPQ+SNL+ATINGSG VFLYDRSKD   GL+S+  +H++NGYGLSFN  D GKLLSGSDD
Sbjct: 116 MPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDD 175

Query: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254
             IALW++  +++ P+  W S H D VNDCKW   + N FGSVSED TLQLHDQR KD+ 
Sbjct: 176 SKIALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSV 235

Query: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314
           T + K    FNT+AFSKHS  LFAAAGTDS +YL+D R     LH+M+GH+  VTN+EF 
Sbjct: 236 TDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295

Query: 315 PDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNI 374
             +DGI+M+SGEDRR I+WD+ +IG EQ+PDDA+DG+PEV+MIHAGHRS +NDFSMNPNI
Sbjct: 296 AAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNI 355

Query: 375 PWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
           PWLMAS+EEENI+QVWKCS KLPRVGG P V  S LE
Sbjct: 356 PWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 225/401 (56%), Positives = 302/401 (75%), Gaps = 11/401 (2%)

Query: 11  VQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQE 70
            Q E+E+P   L++D+EYELW++NVPLMYDFVSETRLTWPSL+ +WLP    ++   RQ 
Sbjct: 3   AQREQEEP---LTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY 56

Query: 71  LIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXT 130
           +I+GTHTSGEE +YLK+AA+DLP++++ + E  +D ++ +                    
Sbjct: 57  MILGTHTSGEEVDYLKVAALDLPDEVV-TGEANDDNRRTKSNIKIVKKFEHDGEI----N 111

Query: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLS 190
           RARYMP++SN++ATING G V +YDRSK +  GL +T +YHKENGYGLSFN N + +L+S
Sbjct: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171

Query: 191 GSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE 250
           GSDD TIALW++++ + SP  VW ++HSDIVNDC W +FD N+FGSVSEDSTL+LHD+R 
Sbjct: 172 GSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS 231

Query: 251 KDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTN 310
                +  +  A FNTLAFSKHS  LFAAAG D+++YL+DRR  ++PLH MAGH+ A+T 
Sbjct: 232 TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITC 291

Query: 311 MEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSM 370
           ++F P +DGIL++ G DRR I+WD+ +IG EQ PD+A+DG+PE+LMIHAGHRSAINDF++
Sbjct: 292 LQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTL 351

Query: 371 NPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
           +P IPWL AS EE+N++QVWKCS  L RVGGTP +    L+
Sbjct: 352 HPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  471 bits (1211), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 236/405 (58%), Positives = 291/405 (71%), Gaps = 16/405 (3%)

Query: 16  EDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPN----RQEL 71
           E   K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSL+++WLP     Q P     +QEL
Sbjct: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP--TPVQEPEGGFIKQEL 59

Query: 72  IIGTHTSGEEDNYLKIAAIDLPNDII----PSTEKLEDQQKGEXXXXXXXXXXXXXXXXX 127
           IIGTHTSGEE+NYLK A I+LP +I+    P  E  ED +                    
Sbjct: 60  IIGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEE 119

Query: 128 XXTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGK 187
             TRARYMPQN   VATING G VF+Y RS+    GL ST ++H+ENGY LSF+    G 
Sbjct: 120 EITRARYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGL 175

Query: 188 LLSGSDDGTIALWNVN-NSNSS-PIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL 245
           LLSGSDD T+ALW+VN NS+S+ PI  WS +HSDIVND KW NF+ ++FG+VSEDS L++
Sbjct: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235

Query: 246 HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHD 305
           +D R ++T T   K   PFNTLAFS HS  L AAAGTDSHVYL+D R++  PLH M+GH+
Sbjct: 236 NDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHE 295

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAI 365
            AVTN+EFSP  DG++++SG D R I+WD+  IG EQ PDDAEDG PE++M+HAGH+SA+
Sbjct: 296 DAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAV 355

Query: 366 NDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQL 410
           NDF +N  IPWL+AS+EEENI+QVWKCSH LP VGG P VS+  +
Sbjct: 356 NDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  463 bits (1192), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 288/406 (70%), Gaps = 16/406 (3%)

Query: 9   AAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQ--EKSAQAP 66
           AA++ +E    K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSLS++WLP   +++    
Sbjct: 25  AAMETQE----KALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGF 80

Query: 67  NRQELIIGTHTSGEEDNYLKIAAIDLPNDII----PSTEKLEDQQKGEXXXXXXXXXXXX 122
            RQELIIGTHTSGEE+NYLK A I++P +I+    P  E  ED +               
Sbjct: 81  IRQELIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAK 140

Query: 123 XXXXXXXTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNC 182
                  TRARYMPQN + VAT+NG G VFLY RS     GL ST ++HK+NGY LSFN 
Sbjct: 141 YVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNA 196

Query: 183 NDAGKLLSGSDDGTIALWNV--NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED 240
              G+LLSGSDD T+ALW V  N+++ SP+  W+ +HSDIVND KW NF+  +FG+VSED
Sbjct: 197 LVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSED 256

Query: 241 STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300
           S L+++D R  +      K   PFNTLAFS HS  L AAAG DSHVYL+D R++  PLH 
Sbjct: 257 SLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHH 316

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG 360
           M+GH+ AVTN+EFS   DG++++SG D R I+WD+  IG EQ PDDAEDG PE++M+HAG
Sbjct: 317 MSGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAG 376

Query: 361 HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVS 406
           HRS++NDF +N  IPWL+ASSEEENI+QVWKCSH LP VGG P V+
Sbjct: 377 HRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVN 422

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  459 bits (1181), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 215/396 (54%), Positives = 287/396 (72%), Gaps = 4/396 (1%)

Query: 19  NKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTS 78
           N+ +++DEEYELW+SNVP++YDFVSETRLTWP+L++EWLPQ+    A  RQ+LI+GTHTS
Sbjct: 25  NEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTS 84

Query: 79  GEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXX-XXXXXTRARYMPQ 137
           GEE NYLKI A+DLP ++  +++K  +  + +                    TRARYMPQ
Sbjct: 85  GEEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQ 144

Query: 138 NSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           + N++ATING GK+F+YDRSK+    L+ST EYH ENGYGL+FN N+   LLSGSDD  I
Sbjct: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204

Query: 198 ALWNVNN--SNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFT 255
           ALW+++N   N  P   +   H+DI+ND KW + + ++FGSVSEDST++L D+R      
Sbjct: 205 ALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQII- 263

Query: 256 SQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSP 315
                  P+NTLAFS  S  LFAAAGTD+ VYL+D RD+S PL++M GH+ AVT +EF P
Sbjct: 264 HNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP 323

Query: 316 DQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIP 375
           + DGIL +SG DRR I+WD+ +IG EQ  D+ EDG PEVLMIHAGH+++IND ++NPNI 
Sbjct: 324 NNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNIN 383

Query: 376 WLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
           WL+AS+EE+NI+Q+WKCS  +PR+GG P V +S L+
Sbjct: 384 WLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  456 bits (1173), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 223/408 (54%), Positives = 293/408 (71%), Gaps = 18/408 (4%)

Query: 5   MEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQ 64
           MEK+     ++E+P   L++D+EY+LW+SNVPL+YDFVSETRLTWPSL+L+WLP +K++ 
Sbjct: 1   MEKVE----QQEEP---LTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS- 52

Query: 65  APNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXX 124
              RQ LI+GT TSG E +YLKIAA+DLP++II         +K +              
Sbjct: 53  --TRQHLILGTLTSGAETDYLKIAALDLPDEIIIG-------KKSDKVVKSNLKVVKKFA 103

Query: 125 XXXXXTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCND 184
                 RARYMPQN+N++AT+NG G +F+YD S+DK S L+ST +YHK+N YGL+FN N 
Sbjct: 104 HDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNA 163

Query: 185 AGKLLSGSDDGTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243
            G+L+SGSDD TIALW+  N     PI  W++ HSDIVNDC+W  F+ N+FGSVSEDSTL
Sbjct: 164 EGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTL 223

Query: 244 QLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAG 303
           QL D+R       +      +N++AFS  S+ LFAAAGT +++YL+D R+  + LHSM G
Sbjct: 224 QLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTG 283

Query: 304 HDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRS 363
           H+  VT++EFS D+DGIL++   DRR I+WD+ +IG EQ PD+A+DG PEV+MIHAG RS
Sbjct: 284 HEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRS 343

Query: 364 AINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
           AIND S +P+IPWL AS EE NI+QVWKCS KLPR+ GTP VS+S LE
Sbjct: 344 AINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  456 bits (1172), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 227/403 (56%), Positives = 289/403 (71%), Gaps = 15/403 (3%)

Query: 16  EDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGT 75
           E+ NK LSI+EEYELW++NVPLMYDFVSET+LTWPSL+++WLP   S+    +QE+I+GT
Sbjct: 4   EEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSS---TKQEMILGT 60

Query: 76  HTSGEEDNYLKIAAIDLPNDIIPS-------TEKLEDQQKGEXXXXXXXXXXXXXXXXXX 128
           HTSGE+DNYLKIA+I+LP DI+ +       + +  +QQ+                    
Sbjct: 61  HTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRN---VQSRIKITKKIKHEEE 117

Query: 129 XTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKL 188
            TRAR+MPQ+ N +ATING GKVFL+DRSKDK+  LVS   +HK+NGYGLSFN    G+L
Sbjct: 118 ITRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGEL 177

Query: 189 LSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQ 248
           LS SDDGTIALWNV  +N+SP     + H DIVNDC W  F+ N+FGSVSED TLQ+HD+
Sbjct: 178 LSCSDDGTIALWNVMGTNTSPSKA-VTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236

Query: 249 REKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAV 308
           R   T   +  + +PFNTL FSKHSQ LFAAAGTDS VYL+D R+ +  LH+M+GH+ +V
Sbjct: 237 RTNST-VHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSV 295

Query: 309 TNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDF 368
           T++EFSP +DGIL +SG DRR ++WD+  IG EQ  +DA DG PE++M+HAGH+SA+NDF
Sbjct: 296 TSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDF 355

Query: 369 SMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
           S N NIPWLMAS EE+NI+ VWK S KL   G      +  LE
Sbjct: 356 SFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 224/401 (55%), Positives = 284/401 (70%), Gaps = 16/401 (3%)

Query: 16  EDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPN----RQEL 71
           E   K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSL+++WLP     Q P     +QEL
Sbjct: 2   EGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP--TPVQQPKGGFIKQEL 59

Query: 72  IIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXX----XXXXXXXXXXXXXX 127
           IIGTHTSGEE+NYLK A I+LP +++ +    E  + G+                     
Sbjct: 60  IIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEE 119

Query: 128 XXTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGK 187
             TRARYMPQ+ N+VATING G VFLY RS     GL ST ++HK+NGY LSF+    G 
Sbjct: 120 EITRARYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGH 175

Query: 188 LLSGSDDGTIALWNVNNSNSS--PIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL 245
           LLSGSDD ++ALW+V+  + S  PI  W  +HSDIVND KW NF+ ++FG+VSEDS L++
Sbjct: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235

Query: 246 HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHD 305
           +D R ++T     K   PFNTLAFS HS  + AAAG DSHVYL+D R++  PLH M+GH+
Sbjct: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAI 365
            AVTN+EFSP  DG++++SG D R I+WD+  IG EQ PDDAEDG PE++M+HAGHRSA+
Sbjct: 296 DAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAV 355

Query: 366 NDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVS 406
           NDF +N  +PWL+AS+EEENI+QVWKCSH LP VGG P ++
Sbjct: 356 NDFDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKIN 396

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  454 bits (1168), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 222/399 (55%), Positives = 284/399 (71%), Gaps = 12/399 (3%)

Query: 16  EDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQ--EKSAQAPNRQELII 73
           E+  K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSL+++WLP   ++      +QELII
Sbjct: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61

Query: 74  GTHTSGEEDNYLKIAAIDLPNDII----PSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXX 129
           GTHTSGEE+NYLK A I+LP +I+    P  E  E+ Q                      
Sbjct: 62  GTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEI 121

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189
           TRARYMPQ+ N+VATING G VFLY RS+    GL ST ++HK+NGY LSF+    G+LL
Sbjct: 122 TRARYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRLL 177

Query: 190 SGSDDGTIALWNVNNSN--SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
           SGSDD T+ALW V +    + P+  W+ +HSDI+ND KW NF+ ++FG+VSEDS L+++D
Sbjct: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237

Query: 248 QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGA 307
            R  +T     K   PFNTLAFS HS  L AAAG DS+VYL+D R++  PLH M+GH+ A
Sbjct: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297

Query: 308 VTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAIND 367
           V N+EFS   DG++++SG D R ++WD+  IG EQ PDDAEDG PE++M+HAGHRS++ND
Sbjct: 298 VNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357

Query: 368 FSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVS 406
           F +NP IPWL+AS+EEENI+QVWKCSH LP VGG P V+
Sbjct: 358 FDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVN 396

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  453 bits (1165), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 284/404 (70%), Gaps = 12/404 (2%)

Query: 11  VQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPN--- 67
           +Q    D N+ L   EEY+LW+SNVP+MYDFVSETRL WPSL+++WLP      APN   
Sbjct: 20  LQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPH----SAPNPVT 75

Query: 68  RQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXX 127
           RQELI+GTHTS EE NYLKIA +DLP ++  ++   E     E                 
Sbjct: 76  RQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTE---SDEEQVRSNIRVTRKFKHDS 132

Query: 128 XXTRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGK 187
             TRARYMPQ+ N++ATI+G+G V++YDRS ++ +  + T +YH +NGYGL+FN    G 
Sbjct: 133 EVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGH 191

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
           LLSGSDD  +ALW+V +  + P+  W ++HSDIVNDC+W NF  ++FG+VSEDS+LQ+HD
Sbjct: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251

Query: 248 QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGA 307
            RE     +      PFNTL+FS HS+ L A  G +S VYL+DRR +  PLH M+GH  A
Sbjct: 252 TRESKPVAT-INGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDA 310

Query: 308 VTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAIND 367
           VT+++FS   DGI++++G D+R IIWDI DIG EQ+ +DAED   EV+MIHAGHRS IND
Sbjct: 311 VTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPIND 370

Query: 368 FSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411
           F++NP+IPWL+AS+EEENI+Q+WKCSHKLPR+ GTP V V  L+
Sbjct: 371 FAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  446 bits (1146), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 269/375 (71%), Gaps = 6/375 (1%)

Query: 22  LSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGEE 81
           L++D+EYELW+SNV LMYDFVSET+LTWPSLS++WLP   +     +QE+I+GTHTSG+E
Sbjct: 14  LTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGDE 73

Query: 82  DNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNSNL 141
           +NYLKIAAIDLP +++     L D+                        RARYMP+N  +
Sbjct: 74  NNYLKIAAIDLPYEVV----GLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKI 129

Query: 142 VATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWN 201
           +ATING GK+F+YDRSK K  GL  T  YHK+NGYGL+FN    G+LLS SDD T+ALW+
Sbjct: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189

Query: 202 VNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVD 261
           +N S   P+ +  + H+DIVND KW  FD N+FG+VSED TLQ+HD+R          V+
Sbjct: 190 IN-STDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE 247

Query: 262 APFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGIL 321
            P N LAFSKHS+ L AAAGTD+ VYL+D R +S PLH+MAGH  AVT++EFS  +DGIL
Sbjct: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307

Query: 322 MTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASS 381
            +SG DRR  IWD+  IG EQ  +DA+DG PE++M+HAGHRSAINDFS NP +PWL+AS+
Sbjct: 308 CSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASA 367

Query: 382 EEENIIQVWKCSHKL 396
           EE+N++QVWK S KL
Sbjct: 368 EEDNVVQVWKISKKL 382

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  431 bits (1108), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/399 (53%), Positives = 282/399 (70%), Gaps = 11/399 (2%)

Query: 14  EEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLP-----QEKSAQAPNR 68
           E E+P +  +I+EEY+LW SNVP+MYDFVSETRLTWPSL+++WLP     +E   Q   R
Sbjct: 3   EVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLR 62

Query: 69  QELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXX-- 126
           QEL+IGT T+  E NYLKIAAIDLP ++  S   + D  K                    
Sbjct: 63  QELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHE 122

Query: 127 XXXTRARYMPQNSNLVATINGSGKVFLYDRS-KDKHSGLVSTFEYHKENGYGLSFNCNDA 185
              TRARYMPQ+ N++AT+NG+G V+++DR+ K+K  G +++F YHKENGYGL+FN   +
Sbjct: 123 QEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVS 182

Query: 186 GKLLSGSDDGTIALWNVNNS-NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
           G+LLS SDDGT+ALW+V ++ N SP   +  VH+DIVNDCKW  F  ++FG+VSED+TL 
Sbjct: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241

Query: 245 LHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGH 304
           +HD    D    +  V + FNTLAFSK S+ L AAAGTDS+VYL+D R + +PLHSMAGH
Sbjct: 242 IHDTN-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGH 300

Query: 305 DGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSA 364
           + +VT++EFSP QDG+L +SG DRR I+WD+ +IG EQ PDDA DG PE+ M+H GHRS 
Sbjct: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSP 360

Query: 365 INDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTP 403
           +N+FS N N+PWLM S EEEN++Q+WK ++K+ R    P
Sbjct: 361 VNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  427 bits (1099), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/382 (54%), Positives = 274/382 (71%), Gaps = 7/382 (1%)

Query: 17  DPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTH 76
           +P +ELSID+EY+LW+SNVPLMYDFVSETRL WPSL+++WLP+   A+    QEL++GTH
Sbjct: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPR---AEDSTEQELLVGTH 61

Query: 77  TSGEEDNYLKIAAIDLPNDIIPSTEKL--EDQQKGEXXXXXXXXXXXXXXXXXXXTRARY 134
           TS  E NYLKIA I+LP +I+ +   +   D    +                   TRARY
Sbjct: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARY 121

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDD 194
            P +SNL+ATI+G+G VFLYDR+KD  + L   + YHKENGYGL+F+    G+L+S SDD
Sbjct: 122 APFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDD 181

Query: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254
           G+IA+W++ +  + P  V +S+HSDIVN+CKW   D N++GSVSEDS L +HD+R +   
Sbjct: 182 GSIAIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240

Query: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314
               + + PFNT+AFSKHS  LFAAAGTD+ VYLFD R  +  LHSM+GH  AVT++EF+
Sbjct: 241 QKLLQKE-PFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFA 299

Query: 315 PDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNI 374
             +DGIL + G DRR ++WD+  IG EQ  +DA+DG PE+LM+HAGH+SAINDFS +PN+
Sbjct: 300 HHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNV 359

Query: 375 PWLMASSEEENIIQVWKCSHKL 396
           PWLMAS EEENI+Q+WK S KL
Sbjct: 360 PWLMASVEEENIVQIWKPSRKL 381

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 282/385 (73%), Gaps = 13/385 (3%)

Query: 20  KELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAP-NRQELIIGTHTS 78
           +ELSIDEEY+LW+SNVPLMYDFVSET+LTWPSL++EWLP +   QAP  +QE+IIGTHTS
Sbjct: 8   RELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHD--PQAPLTQQEMIIGTHTS 65

Query: 79  GEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQN 138
            +E NY+KIA+I+LPN++I      +     +                   TR+RYM Q+
Sbjct: 66  DQEPNYVKIASIELPNEVI------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQD 119

Query: 139 SNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIA 198
            N+++TI+G+G V ++DR  +     V T+ YHK+NGYGLSFN    G+LLS +DDG IA
Sbjct: 120 PNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177

Query: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED-STLQLHDQREKDTFTSQ 257
           ++++N  +  P+  W S  + I+ND KW +FD  +FG+VSE+ +TL ++D R KD  TS 
Sbjct: 178 MYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTS- 236

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317
            +++ PFN+LAFSKHS+ LF+AAGTD +VYL+D R+  + LHSM+GH+G VTN+EF    
Sbjct: 237 IEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSV 296

Query: 318 DGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377
           DGIL++S EDRR IIWD+ +IG EQ+ +DA+D  PE++MIHAGHRS++NDFS+N +IPWL
Sbjct: 297 DGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWL 356

Query: 378 MASSEEENIIQVWKCSHKLPRVGGT 402
           +AS+EEENIIQVWK S +LPR+  +
Sbjct: 357 IASTEEENIIQVWKSSSRLPRISNS 381

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  424 bits (1089), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 269/377 (71%), Gaps = 8/377 (2%)

Query: 20  KELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSG 79
           + L+++EEYELW SNVP+MY+FVSET+LTWPSL+++WLP +   Q+P  Q LI GTHT+G
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSD--GQSP-EQSLIFGTHTAG 96

Query: 80  EEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNS 139
           EE NYLK+A I+LP  I    +  E+    E                    RARYMP NS
Sbjct: 97  EEVNYLKVATINLPAGIAGLDQGDEED---EANDHSSFAIANKFPHIEEVIRARYMPANS 153

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N++ATING G + ++DR+ ++    VST  +HKENGYGL+FN + +G+LLSGSDD T+AL
Sbjct: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213

Query: 200 WNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFK 259
           W++  +   P  + +S H DIVND KW  F+ NVFG+VSED TLQ+HD+R +     +  
Sbjct: 214 WDIEAAKK-PKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLP 271

Query: 260 VDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDG 319
             +PFNTL+FSKHS+ L AAAG DS +YL+D RD+S PLH M+GH  +VT +EFSP  DG
Sbjct: 272 TASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDG 331

Query: 320 ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMA 379
           I+ +SG DRRAIIWD+  IG EQ  DDA+DGAPE++M+HAGHRS +N+FS NP IPWL+A
Sbjct: 332 IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLA 391

Query: 380 SSEEENIIQVWKCSHKL 396
           S+EE+N+IQ WK S KL
Sbjct: 392 STEEDNVIQAWKVSMKL 408

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  422 bits (1086), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 209/383 (54%), Positives = 272/383 (71%), Gaps = 9/383 (2%)

Query: 18  PNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHT 77
           P  E+S+DEEY+LW+SNVPLMYDFVSET+L WPSL+++WLP   S    N QELI+GTHT
Sbjct: 6   PENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLP---SNDRSNEQELILGTHT 62

Query: 78  SGEEDNYLKIAAIDLPNDIIP----STEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRAR 133
           SG E NYLKIA++ LP++++     S    +D ++                     TRAR
Sbjct: 63  SGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRAR 122

Query: 134 YMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSD 193
           Y P N NL+ATI+GSGKVFLYDRSKD  S L + F +HKENGYGL+F+    G+LLS SD
Sbjct: 123 YAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSD 182

Query: 194 DGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDT 253
           DG+IA+W+V +  ++P+ V +S H++IVN+CKW      +FGSVS+DSTL +HD+R  D 
Sbjct: 183 DGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR-IDK 240

Query: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
              +     P+NTLAFSKHS  LFAAAGTDS V L+D R    P+HSM+GH  +VT++EF
Sbjct: 241 PVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEF 300

Query: 314 SPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPN 373
           +P +DGIL +   DRR +IWD+  IG EQ  +DA+DG PE+LM+HAGH+S +NDFS +PN
Sbjct: 301 APHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPN 360

Query: 374 IPWLMASSEEENIIQVWKCSHKL 396
           IPWLMAS EEEN++Q+WK S KL
Sbjct: 361 IPWLMASVEEENVVQIWKASKKL 383

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  380 bits (977), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 196/392 (50%), Positives = 262/392 (66%), Gaps = 20/392 (5%)

Query: 14  EEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAP-NRQELI 72
           EEE+P   L+ D+EYELW+SNVPL+YDFVSET+L WPSL++EWLP  ++   P N Q L+
Sbjct: 15  EEEEP---LTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLL 71

Query: 73  IGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRA 132
           +GTHTSGEE NYLKIA I LP+ II   EK ED    +                   TRA
Sbjct: 72  LGTHTSGEEQNYLKIAEITLPDQII--NEKTEDN--SDKHVKSNIRIIKKFKHELEVTRA 127

Query: 133 RYMPQNSNLVATINGSGKVFLYDRSKDKHSG--LVSTFEYHKENGYGLSFNCNDAGKLLS 190
            YMPQ+S ++ATING G VF+YD S D++    ++S   +HKENGYGL+FN  D GKLLS
Sbjct: 128 HYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLS 187

Query: 191 GSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE 250
            SDDG++A WN+  S    I + +   + I+ND +W+ F+ N+FG V+E S L L D R 
Sbjct: 188 SSDDGSVAYWNIQKS----IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRN 243

Query: 251 KDT---FTSQFKVDAP--FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHD 305
            +      S   +  P  FN +AFS HS+YL AA+G DS +YL+D R++++PLH M GH+
Sbjct: 244 NNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHE 303

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDG-APEVLMIHAGHRSA 364
            +VT+++F    DGI+++ G D+R  +WD+  IG EQ  D+ EDG  PE+LMIHAGHRS 
Sbjct: 304 DSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSP 363

Query: 365 INDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
           INDFSM+ N+ WL AS EE+NI+QVWK ++ L
Sbjct: 364 INDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 106/430 (24%), Positives = 182/430 (42%), Gaps = 65/430 (15%)

Query: 5   MEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQ 64
            E+ +A+  E +D          Y  W+ N  L+Y++++     WPSL+ ++ P   +  
Sbjct: 11  FEQSSAIPKERQD---------RYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKN 61

Query: 65  APNRQELIIGTHTSGEEDNYLKIAAID---------LPNDIIPSTEKLEDQQKGEXXXXX 115
             +R  L   T +   ED  L I  I          L N  +   E   D    +     
Sbjct: 62  DSHRILLSSFTSSLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKN 121

Query: 116 XXXXXXXXXXXXXXTRARYMPQNSNLVATINGSGKVFLYDRSK------DKHSGLVSTFE 169
                          RARY+PQN +L+A  +  G V+++DR+K       + SG   +++
Sbjct: 122 LTTELVIRFPNGDCNRARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQ 181

Query: 170 -----------YHKEN-GYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSS------PIY 211
                       + EN    + +N    G L+    DG +  W++     S      P Y
Sbjct: 182 AKLAVNNNSQSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEY 241

Query: 212 VWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREK----DTFTSQFKVDAPFNTL 267
            +    S   ND  W     ++F + SED+ L L D R++    D  TS  K     N  
Sbjct: 242 NYKLDESG-CNDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHK--GGINAC 298

Query: 268 AFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGED 327
            F+  +  L A+  +  ++ L+D R    P++ +  H  +++ +E++P+   +L ++G+D
Sbjct: 299 RFNPRNSLLLASGDSIGNICLWDIRKKETPIN-ILDHGSSISTIEWNPNLSTVLASAGQD 357

Query: 328 RRAI-IWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENI 386
              + +WD               G+ + + IH GH   +ND S N + PWLM S  ++N 
Sbjct: 358 DGLVKLWDA--------------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNS 403

Query: 387 IQVWKCSHKL 396
           IQ+WK +H L
Sbjct: 404 IQIWKPAHNL 413

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 99/411 (24%), Positives = 178/411 (43%), Gaps = 55/411 (13%)

Query: 22  LSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGEE 81
           + + E Y  W+ N  L+YD+++     WPSL+ ++ P   +    +R  L   T +   E
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKPE 76

Query: 82  DNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXX--------TRAR 133
           D  + I+ I     I  S+    D  + E                            RAR
Sbjct: 77  DETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECNRAR 136

Query: 134 YMPQNSNLVATINGSGKVFLYDRSKD-----KHSGLVSTFEYHKENGYG----------- 177
           Y+PQN +++A  +  G ++++DR+K      + S +   FE      +G           
Sbjct: 137 YLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTS 196

Query: 178 ---------LSFNCNDAGKLLSGSDDGTIALWNVNN-SNSSPI--YVWSSVHSD--IVND 223
                    L++N      LLS   +G + +W++   S+ +PI      S++SD   VND
Sbjct: 197 SADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVND 256

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTF--TSQFKVDAPFNTLAFSKHSQYLFAAAG 281
             W     ++F + +E + + L D R K     +++ K D   N+  F+  +  + A+A 
Sbjct: 257 VTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILASAD 316

Query: 282 TDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIWDICDIGV 340
           ++  + L+D R++++   +   H  +V+ +E+SP+ D +L T+G ED    +WD      
Sbjct: 317 SNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT----- 371

Query: 341 EQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
                       E +  H GH   +ND S + + PWLM S   +N + +WK
Sbjct: 372 ---------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  121 bits (303), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 104/430 (24%), Positives = 193/430 (44%), Gaps = 56/430 (13%)

Query: 5   MEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQ 64
           M   +  Q +   PN    + + Y  W+ N  L+YD+++     WPSL+ ++ P   +  
Sbjct: 1   MATESTAQEQSTIPN---DLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTS 57

Query: 65  APNRQELIIGTHTSGE--EDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXX 122
             +R  ++I + TS +  ED  + I+ I     +  ++    D  + E            
Sbjct: 58  DTHR--ILISSFTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSK 115

Query: 123 XXXXXXX--------TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGL---------- 164
                           RARY+PQN +++A  + +G V+++DR+K   S +          
Sbjct: 116 HLVNDLTIKFPNGDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYD 175

Query: 165 ------VSTFEYHKEN---GYGLSFNCNDAGKLLSGSDDGTIALWNVNNS-NSSPIYVWS 214
                   T E   EN      L++N    G L S    G + +W++    +S+P+    
Sbjct: 176 AVLFNNSETVEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKP 235

Query: 215 SVHSDI----VNDCKWSNFDLNVFGSVSEDSTLQLHDQR--EKDTFTSQFKVDAPFNTLA 268
            ++       VND  W     ++F +  E  TL L DQR  ++ +  +Q + +   N+  
Sbjct: 236 VLNIQFDALGVNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCK 295

Query: 269 FSKHSQYLFAAAGTDSHVYLFDRRDISR-PLHSMAGHDGAVTNMEFSPDQDGILMTSGE- 326
           F+  +  L A+A ++  V ++D R++ + P+ S+  H  +++ +E++P+ D I+ T+G+ 
Sbjct: 296 FNYQNNMLLASADSEGLVNMWDIRNLDQYPIKSI-NHGSSISTIEWNPNLDTIIATAGQN 354

Query: 327 DRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENI 386
           D    +WD+ +               E+L +H GH   +ND S + +  WLM S   +N 
Sbjct: 355 DGLVKLWDVSNTD------------NELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNS 402

Query: 387 IQVWKCSHKL 396
           IQ+WK +H L
Sbjct: 403 IQIWKPAHNL 412

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  120 bits (300), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 101/410 (24%), Positives = 181/410 (44%), Gaps = 54/410 (13%)

Query: 24  IDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGE--E 81
           + + Y  W+ N  L+YD+++     WPSL+ +++P  +     ++  L++ + TS +  E
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPT--DKHRLLLSSFTSSQLPE 78

Query: 82  DNYLKIAAIDLPNDIIPSTE----------KLEDQQKGEXXXXXXXXXXXXXXXXXXXTR 131
           D  + I+ +     +  S+           K+++Q K                      R
Sbjct: 79  DEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAK--LPNKNLVETVRIQFPSGDCNR 136

Query: 132 ARYMPQNSNLVATINGSGKVFLYDRSKD-----KHSGLVSTFEYH-----------KENG 175
           A YMPQN +++  I  +G V ++DR+K      K  G  +++E                 
Sbjct: 137 ACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEA 196

Query: 176 YGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIV------NDCKWSNF 229
             L++N   AG + S   +G I +W++     S   + S+    I+      ND  W   
Sbjct: 197 LSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTI-SNPELRILQDKAGTNDVSWMVH 255

Query: 230 DLNVFGSVSEDSTLQLHDQREKDTF--TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY 287
             ++  +  E +T+ L D R  D F  T         N L F+  +  L  AA ++  + 
Sbjct: 256 HSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIA 315

Query: 288 LFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDIGVEQIPDD 346
           L+D R  S+PL S+  H  +V+ ++++P+   I+ T+G+    I IWD       + P+D
Sbjct: 316 LWDCRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSREPED 369

Query: 347 AEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
           +      +L +H GH   +ND + N + PWLM S   +N + VWK +  L
Sbjct: 370 S------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  119 bits (297), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 95/405 (23%), Positives = 174/405 (42%), Gaps = 47/405 (11%)

Query: 26  EEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGEEDNYL 85
           + Y  W+ N  L YD+++     WPSL+ +  P    A   +R  L   T +   ED  L
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDESL 82

Query: 86  KIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXX--------XXXXTRARYMPQ 137
            +A +     I  S+    D ++ E                            +ARY P 
Sbjct: 83  YVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKARYCPS 142

Query: 138 NSNLVATINGSGKVFLYDRSKDK----------------HSGLVSTFEYHKENGYGLSFN 181
           N +L+ + + +G ++++DR+K                  H  L ++ E HK     L++N
Sbjct: 143 NPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLAWN 202

Query: 182 CNDAGKLLSGSDDGTIALWNVNNSN-SSPIYV----WSSVHSDIVNDCKWSNFDLNVFGS 236
               G L +    G + +W++   + +SP  +     S+V     N+  W     ++   
Sbjct: 203 WQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLAY 262

Query: 237 VSEDSTLQLHDQREKDTFTSQFKVDAP-----FNTLAFSKHSQYLFAAAGTDSHVYLFDR 291
            SED+ + + D R  +    Q     P      NT  F+ H   L  +A +   + L+D 
Sbjct: 263 CSEDNLVGIMDIRNPEK--GQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDI 320

Query: 292 RDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGA 351
           R+ ++PL ++  H+ +++ ++++P +  +L T G+D           G+ +I D ++   
Sbjct: 321 RNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDG----------GLVKIWDLSQPEG 369

Query: 352 PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
            E++  H GH   +ND S +P+  W+M S   +N IQVW+ S+ L
Sbjct: 370 QELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  118 bits (296), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 94/420 (22%), Positives = 191/420 (45%), Gaps = 50/420 (11%)

Query: 2   DALMEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEK 61
           D L+E   +      +P     + + Y  W+ N  L+Y++++     WPSL+ +++P   
Sbjct: 4   DLLIETAPSFSSSIPEP-----LQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMD 58

Query: 62  SAQAPNRQELIIGTHTSGE--EDNYLKIAAIDLPNDIIPST------EKLEDQQKGEXXX 113
            A   ++  +++ + TS +  ED  + I+ I     I  S+      E++E +   +   
Sbjct: 59  IAS--DKHRILLSSFTSAQLPEDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKL 116

Query: 114 XXXXXXXXXXXX-XXXXTRARYMPQNSNLVATINGSGKVFLYDRSK---DKHSGLVSTFE 169
                             RARYMPQN +++A+ +  G V+++DR+K   ++   L +TF+
Sbjct: 117 SKNLTETIKIQFPEGDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFK 176

Query: 170 YHKE----------NGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSS------PIYVW 213
           Y  E              L++N   +G L +   DG + +W++   N +      P   W
Sbjct: 177 YDMELKEVESGCNYEASSLAWNYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRW 236

Query: 214 SSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV--DAPFNTLAFSK 271
             V  +  N+  W     ++     E + L + D R   TF+++         N + F+ 
Sbjct: 237 Q-VDKEGANEVSWMVHHSSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNY 295

Query: 272 HSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI 331
            + +L  +A ++  + + D R +  P+ + + H  AV+ ++++P    ++ ++G++    
Sbjct: 296 DNDFLLCSADSEGTLNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQND--- 351

Query: 332 IWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
                  G+ +I D A++  P ++ IH GH   +ND + N + PW+M S   +N + +WK
Sbjct: 352 -------GLVKIWDLAQEDDP-LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWK 403

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  118 bits (296), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 106/428 (24%), Positives = 184/428 (42%), Gaps = 59/428 (13%)

Query: 8   MAAVQGEEEDPNKELSID--EEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQA 65
           M+   GE       +S D  E Y  W+ N  L+YD+++     WPSL+ ++ P   +   
Sbjct: 1   MSQRAGEATKEASYISADLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLN 60

Query: 66  PNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXX 125
            +R  L   T +   ED  + I+ I     I  ++    D  + E               
Sbjct: 61  EHRILLSSFTSSQKPEDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLV 120

Query: 126 --------XXXXTRARYMPQNSNLVATINGSGKVFLYDRSKD-----KHSGLVSTFEYHK 172
                        RARY+PQN +++A  +  G ++++DR+K      + S +   FE   
Sbjct: 121 DDIRIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKL 180

Query: 173 ENGYG--------------------LSFNCNDAGKLLSGSDDGTIALWNVNN-SNSSPI- 210
              +G                    L++N      LLS   +G I +W++   S+ +PI 
Sbjct: 181 LGSHGVIQDVETMDTSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPII 240

Query: 211 -YVWSSVHSD--IVNDCKWSNFDLNVFGSVSEDSTLQLHDQR-EKDTFTSQFKVDAP-FN 265
                S+ SD   VND  W     ++F + +E + + L D R +K+   S  K+     N
Sbjct: 241 DVPLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVN 300

Query: 266 TLAFSKHSQYLFAAAGTDSHVYLFDRRDISR-PLHSMAGHDGAVTNMEFSPDQDGILMTS 324
           +  F+  +  + A+A ++  + L+D R+++  P+ +M  H  +V+ +E+SP+ D +L T+
Sbjct: 301 SCKFNYKNSLILASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATA 359

Query: 325 G-EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEE 383
           G ED    +WD                  E +  H GH   +ND S + + PWLM S   
Sbjct: 360 GQEDGLVKLWDTT--------------REESIFTHGGHMFGVNDISWDVHDPWLMCSVAN 405

Query: 384 ENIIQVWK 391
           +N + +WK
Sbjct: 406 DNSVHIWK 413

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  118 bits (296), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 184/418 (44%), Gaps = 61/418 (14%)

Query: 24  IDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGE--E 81
           + + Y  W+ N  L+YD+++     WPSL+ ++ P    +   +R  L++ T TS +  +
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHR--LLLSTFTSSQIPD 70

Query: 82  DNYLKIAAIDLPNDIIPSTEKLEDQQKGEXX--------XXXXXXXXXXXXXXXXXTRAR 133
           D  + I+ I   N +  S+    D  + E                            +AR
Sbjct: 71  DESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKAR 130

Query: 134 YMPQNSNLVATINGSGKVFLYDR------------------SKDKHSGLVSTFEYHKENG 175
           YMPQN +++   + +G ++++DR                  SK   + L    ++  E+G
Sbjct: 131 YMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDG 190

Query: 176 --------YGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIY-----VWSSVHSDI-V 221
                     +++N    G+LLS   +G I LW+     SS        +W +   D+  
Sbjct: 191 TKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGC 250

Query: 222 NDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTS--QFKVDAPFNTLAFSKHSQYLFAA 279
           N+  W N   ++F +  E++ + + D R++    S  Q   +   N+  F+  +  L A+
Sbjct: 251 NEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLAS 310

Query: 280 AGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIWDICDI 338
             ++  + L+D R +++P+ ++  H  +++ +E+SP  + ++ + G ED    +WDI + 
Sbjct: 311 GDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISN- 368

Query: 339 GVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
                         E + IH GH   IND S + + PWL+ S   +N IQ+WK +  L
Sbjct: 369 ------------EEEPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHL 414

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  118 bits (296), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 94/410 (22%), Positives = 180/410 (43%), Gaps = 55/410 (13%)

Query: 24  IDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSG---- 79
           + E Y  W+ N  L+YD+++     WPSLS ++     +    +R  +++ + TSG    
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHR--ILLSSFTSGLMPE 80

Query: 80  -EEDNYLKIAAID-LP----NDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRAR 133
            E  N + I+ +  +P    N+      + +     +                    RAR
Sbjct: 81  QESINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRAR 140

Query: 134 YMPQNSNLVATINGSGKVFLYDRSKDKHS------------------GLVSTFEYHKENG 175
           Y+PQN +++A  +  G V++++R+K   +                    V + + +    
Sbjct: 141 YLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEA 200

Query: 176 YGLSFNCNDAGKLLSGSDDGTIALWNV---NNSNSSPIYVWSSVHSDI--VNDCKWSNFD 230
             + +N    G L +   DG I  W++   +N+N++      S+  D    ND  W    
Sbjct: 201 LSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLH 260

Query: 231 LNVFGSVSEDSTLQLHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY 287
            ++  +  E + L ++D    RE  T +S    D   N   F+  +  + A+A T  +V+
Sbjct: 261 DSLLAACGESNKLIIYDIRGSREHTTISSGIHEDG-INACRFNYANNLIVASADTVGNVH 319

Query: 288 LFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDIGVEQIPDD 346
           ++D R  +  + ++  H  +++ +E++P+ D IL T+G+D   + +WD+ D         
Sbjct: 320 IWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD--------- 369

Query: 347 AEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
                 E++  H GH   +ND S N + PWLM S   +N +Q+W+ +H L
Sbjct: 370 -----SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  117 bits (294), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 103/418 (24%), Positives = 184/418 (44%), Gaps = 57/418 (13%)

Query: 16  EDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGT 75
           E  N   ++ E Y  W+ N  L+Y++++     WPSL+ ++ P   +    +R  L   T
Sbjct: 11  EASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFT 70

Query: 76  HTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXX------ 129
            +   ED  + I+ I     I  S+    D  + E                         
Sbjct: 71  SSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNG 130

Query: 130 --TRARYMPQNSNLVATINGSGKVFLYDRSKD-----KHSGLVSTFEYHKENGYG----- 177
              RARY+PQN +++A  +  G ++++DR+K      + S +   FE      +G     
Sbjct: 131 ECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDV 190

Query: 178 ---------------LSFNCNDAGKLLSGSDDGTIALWNVNN-SNSSPI--YVWSSVHSD 219
                          +++N      LLS   +G + +W++   S+ +PI      S++SD
Sbjct: 191 ETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSD 250

Query: 220 I--VNDCKWSNFDLNVFGSVSEDSTLQLHDQR-EKDTFTSQFKV-DAPFNTLAFSKHSQY 275
              VND  W     ++F + +E +T+ L D R +K+   S  +  +   N+  F+  +  
Sbjct: 251 GSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSL 310

Query: 276 LFAAAGTDSHVYLFDRRDISR-PLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIW 333
           + A+A ++  + L+D R+++  PL +M  H G+V+ +E+SP+ D +L T+G ED    +W
Sbjct: 311 ILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVKLW 369

Query: 334 DICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
           D                  E +  H GH   +ND S + + PWLM S   +N + +WK
Sbjct: 370 DT--------------SREENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  116 bits (291), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 98/407 (24%), Positives = 173/407 (42%), Gaps = 51/407 (12%)

Query: 26  EEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGEEDNYL 85
           + Y  W+ N  L+Y++++     WPSL+ +  P    A   +R  L   T +   ED  +
Sbjct: 23  QRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSFTSSQLPEDEAI 82

Query: 86  KIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXX--------XXXXTRARYMPQ 137
            +A +     I  S+    D  + E                            +ARY P 
Sbjct: 83  YVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNKARYCPS 142

Query: 138 NSNLVATINGSGKVFLYDRSKDK----------------HSGLVSTFEYHKENGYGLSFN 181
           N +L+++ + +G V+++DR+K                  H  L ++ E  +     L++N
Sbjct: 143 NPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNLAWN 202

Query: 182 CNDAGKLLSGSDDGTIALWNVNNSN-SSPIYVWSSVHSDIV------NDCKWSNFDLNVF 234
               G L +    G + +W++   + +SP  +    HS ++      ND  W     ++ 
Sbjct: 203 WQQQGLLATCYSGGEVCVWDLAKYDKASPTLI--DPHSSLLADPQGSNDISWMVNHDSLL 260

Query: 235 GSVSEDSTLQLHDQR----EKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
               E + L + D R       +F++    +   N   F+ +   L  +A +   + L+D
Sbjct: 261 AYCGEGNALGVLDTRITKQPPQSFSNPHHSNG-VNACQFNYYKDLLLCSADSAGRINLWD 319

Query: 291 RRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDIGVEQIPDDAED 349
            RD S P+ S+  H G+V+ ++++P    IL T+G+D   + IWD+    V+Q       
Sbjct: 320 IRDFSSPIRSL-DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQ-PVDQ------- 370

Query: 350 GAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
              E+   H GH   +ND S +PN PW+M S   +N IQ+WK S  L
Sbjct: 371 ---ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  113 bits (282), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 95/403 (23%), Positives = 175/403 (43%), Gaps = 39/403 (9%)

Query: 24  IDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGE--E 81
           + + Y  W+ N  L+YD+++     WPSLS ++ P        ++Q +++ + TS +  +
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTN--DKQRILLSSFTSQQLPQ 77

Query: 82  DNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXX--------TRAR 133
           D  + I +I   N +  S+    D  + E                            R R
Sbjct: 78  DESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCR 137

Query: 134 YMPQNSNLVATINGSGKVFLYDRSKDKHSGLVST---FEYHKENG--------YGLSFNC 182
           YMPQN +++ T + +G V+++DR+K  H   +ST   FE    N           L++N 
Sbjct: 138 YMPQNPDIIGTASSNGSVYIFDRTK--HGNKISTGRKFEIECRNNGDDEQDESLSLAWNY 195

Query: 183 NDAGKLLSGSDDGTIALWNVNNSNSSPIYVW-----SSVHSDIVNDCKWSNFDLNVFGSV 237
              G L +   +G + +W++   + S   +      S + ++ VND  W     ++  S 
Sbjct: 196 QLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASC 255

Query: 238 SEDSTLQLHDQREK---DTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDI 294
            E + + L D R+    DT       D   N + F+  +  +     +   + ++D RD 
Sbjct: 256 GESNVIGLIDIRQDTKMDTLHRTTHTDG-INAIEFNYKNDMILCTGDSQGQLKIWDIRDF 314

Query: 295 SRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPE 353
             P+     G    ++ ++++P    IL T+  D+++ +  I D   EQ   +AE+    
Sbjct: 315 KEPIKEWEHGDQDPISAIQWNPQIPQILATA--DQQSGLVKIWDASGEQEDSNAENNM-- 370

Query: 354 VLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
           +L +H GH   +ND S + + PW M S   +N I +WK +  L
Sbjct: 371 LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  112 bits (281), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 96/410 (23%), Positives = 181/410 (44%), Gaps = 54/410 (13%)

Query: 24  IDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGE--E 81
           + E Y  W+ N  L+Y +++     WPSL+ ++ P   +    +R  +++ T TS +  E
Sbjct: 16  LQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHR--ILLSTFTSSQLPE 73

Query: 82  DNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXX--------TRAR 133
           D  L IA +   N +  S+    D  + E                            RAR
Sbjct: 74  DESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFPNGDCNRAR 133

Query: 134 YMPQNSNLVATINGSGKVFLYDRSKDKHSGLVS---TFE-------------YHKENGYG 177
           Y+PQN +L+A  + +G +++++R+K     L S   +FE              +      
Sbjct: 134 YLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEAVS 193

Query: 178 LSFNCNDAGKLLSGSDDGTIALWNVNN-SNSSPIYVWSSV----HSDIVNDCKWSNFDLN 232
           +++N    G L S    G+I +W++   S S P    + +      +  N+  W     +
Sbjct: 194 IAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNHDS 253

Query: 233 VFGSVSEDSTLQLHDQREKDTFTSQFKV----DAPFNTLAFSKHSQYLFAAAGTDSHVYL 288
           +F + SE + L L D R K+      +         N+  F+ ++  L A+A +   + +
Sbjct: 254 IFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKINM 313

Query: 289 FDRRDISR-PLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDIGVEQIPDD 346
           +D R + + P+ S   H+ +++ +E++P+ + IL+T+G+D   + IWD  +         
Sbjct: 314 WDIRKLDKEPIKSF-NHNSSISTLEWNPNLETILVTAGQDDGLVKIWDTAN--------- 363

Query: 347 AEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
                 + + +H GH   +ND S + + PWL++S   +N I VWK +  L
Sbjct: 364 -----GQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNL 408

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  112 bits (279), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 100/427 (23%), Positives = 181/427 (42%), Gaps = 53/427 (12%)

Query: 8   MAAVQGEEED----PNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSA 63
           MA V   EE     P     +   Y  W+ N  L+YD+++     WPSL+ ++ P   + 
Sbjct: 10  MAEVITTEEHGLDLPTIPEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT 69

Query: 64  QAPNRQELIIGTHTSGE--EDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXX 121
              +R  L++ + TS +  ED  + ++ +     +  S+    D  + E           
Sbjct: 70  NDQHR--LLLSSFTSSQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPS 127

Query: 122 XXXXXXXXTR--------ARYMPQNSNLVATINGSGKVFLYDRSKDK------HSG---- 163
                             ARY+PQN +++A  + +G ++++DR+K        H G    
Sbjct: 128 KNLIKELNISFPMGDCNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMF 187

Query: 164 ----LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN-SNSSPIYVWSSVHS 218
                 S+ E H+E    L++N    G L +    G + +W+V   S + P+   +    
Sbjct: 188 ELEFQSSSLEEHQE-VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTH 246

Query: 219 DI----VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFK----VDAPFNTLAFS 270
           +      ND  W     ++     E +++ + D R +    S  K         N+  F+
Sbjct: 247 NADPRGCNDVSWMVNHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFN 306

Query: 271 KHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGE-DRR 329
            H+  L  +  +   V L+D RD+  PL S+  H  +++  +++P+   IL T+ + D  
Sbjct: 307 YHNDMLLCSGDSTGRVNLWDIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQSDGL 365

Query: 330 AIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQV 389
             +WDI           A++   E+L +H GH   +ND S N + PWLM S   +N +Q+
Sbjct: 366 VKLWDI-----------AQEPGEELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQL 414

Query: 390 WKCSHKL 396
           W+ +  L
Sbjct: 415 WRPARNL 421

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  109 bits (273), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 102/420 (24%), Positives = 183/420 (43%), Gaps = 55/420 (13%)

Query: 11  VQGEEEDPNKEL--SIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNR 68
           ++  EE P   +   +   Y  W+ N  L+YD+++     WPSL+ ++ P   ++   +R
Sbjct: 6   IEDIEEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHR 65

Query: 69  QELIIGTHTSGE--EDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXX 126
             L++ + TS +  ED  + I+ I     +  S+    D  + E                
Sbjct: 66  --LLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTT 123

Query: 127 XXX--------TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVST----FEYHKEN 174
                       R+RY+PQN +L+A  +  G V++++++K  +S L S     F+    +
Sbjct: 124 EVSIRFPNGDCNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFS 183

Query: 175 G-------------YGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWS-----SV 216
           G               LS+N +  G L      G   +W+V   + S I +       + 
Sbjct: 184 GSHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTF 243

Query: 217 HSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR---EKDTFT-SQFKVDAPFNTLAFSKH 272
            S+  ND  W     ++F +  E + L L D R   EK+  + S +K +   NT  F+  
Sbjct: 244 DSNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPG 303

Query: 273 SQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAI 331
           +  L A+A T   + L+D R + +   S   H  +++ +E++P+   +  ++G ED    
Sbjct: 304 NSLLVASADTCGRINLWDIRKLDQEPISTMQHGSSISTIEWNPNIGVVFASAGQEDGLVK 363

Query: 332 IWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
           +WD   +G E             + +H GH   +ND S + + PWLMAS   +N IQ+W+
Sbjct: 364 LWD-ASVGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWR 409

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  109 bits (273), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 94/419 (22%), Positives = 171/419 (40%), Gaps = 55/419 (13%)

Query: 19  NKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTS 78
           N  + + E Y  W+ N  L+YD+++     WPSL+ ++ P   +    +R  L   T + 
Sbjct: 14  NIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQ 73

Query: 79  GEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXX--------T 130
             ED  + I+ I     I  S+    D  + E                            
Sbjct: 74  KPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDCN 133

Query: 131 RARYMPQNSNLVATINGSGKVFLYDR----------SKDKHSGLVSTFEYHK-------- 172
           RARY+PQN +++A  +  G ++++DR          SK+ H      F  H         
Sbjct: 134 RARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAM 193

Query: 173 -------ENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN-SNSSPIY--VWSSVHSDI-- 220
                       L++N      LLS   +G + +W++   S+ +P+      S+ SD   
Sbjct: 194 DTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASG 253

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVD--APFNTLAFSKHSQYLFA 278
           VND  W     ++F + +E + + L D R K       + +     N+  F+  +  + A
Sbjct: 254 VNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLA 313

Query: 279 AAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGE-DRRAIIWDICD 337
           +A ++  + L+D R ++    +   H  +++ +E++P+   +L T+G+ D    +WD   
Sbjct: 314 SADSNGRLNLWDIRKMNESPITTMEHGASISTLEWNPNFSTVLATAGQQDGLVKLWDT-- 371

Query: 338 IGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
                          E +  H GH   +ND S + + PWLM S   +N + +WK +  L
Sbjct: 372 ------------AREETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAENL 418

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  108 bits (271), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/411 (23%), Positives = 177/411 (43%), Gaps = 61/411 (14%)

Query: 26  EEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGE--EDN 83
           + Y  W+ N  L+YD+++     WPSL+ E+ P   +    +R  L++ + TS +  ED 
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHR--LLLSSFTSSQLPEDE 74

Query: 84  YLKIAAIDLP--------NDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYM 135
            + I+ I           N+      + + +   +                    RARY+
Sbjct: 75  SIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARYL 134

Query: 136 PQNSNLVATINGSGKVFLYDRSKDKHSGLVST----FEYHKENG------------YGLS 179
           PQN ++++  +  G ++++DR+K   +   ST    +E   E                L 
Sbjct: 135 PQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSLD 194

Query: 180 FNCNDAGKLLSGSDDGTIALWNV------NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNV 233
           +N    G L S    G + +W++      N +  +PI           ND  W     ++
Sbjct: 195 WNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDSL 254

Query: 234 FGSVSEDSTLQLHDQREKDTFTSQFKVDAP------FNTLAFSKHSQYLFAAAGTDSHVY 287
             +  E +T+ ++D R K    SQ     P       N+  F+ H+ YL A+A +   V+
Sbjct: 255 LAACGESNTVAIYDTRSK----SQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVH 310

Query: 288 LFDRRDISR-PLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIWDICDIGVEQIPD 345
           ++D R + + P+ S++ H  +++ ++++P+   I+  +G ED    +WD           
Sbjct: 311 MWDIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD----------- 358

Query: 346 DAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
            A +G  +++  H GH   +ND + N + PWLM S   +N I +W+ S  L
Sbjct: 359 -ASNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/425 (22%), Positives = 180/425 (42%), Gaps = 58/425 (13%)

Query: 24  IDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGE--E 81
           +   Y  W+ N  L+YD+++     WPSL+ ++ P   +    +R  +++ ++TS +  E
Sbjct: 15  LQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHR--ILLSSYTSCQLPE 72

Query: 82  DNYLKIAAIDLP--------NDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRAR 133
           D  + +A+I           N+      + +  +  +                    RAR
Sbjct: 73  DENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFPRGDCNRAR 132

Query: 134 YMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYG---------------- 177
           YMPQN +++A  + +G V++++R+K     +        E  YG                
Sbjct: 133 YMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARR 192

Query: 178 ---------LSFNCNDAGKLLSGSDDGTIALW-----NVNNSNSSPI-YVWSSVHSDIVN 222
                    L++N +  G L      G + +W     NV+N+  S   +  S+  S  VN
Sbjct: 193 TPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVN 252

Query: 223 DCKWSNFDLNVFGSVSEDS-TLQLHDQREKDTFT---SQFKVDAPFNTLAFSKHSQYLFA 278
           D  W +   ++  +  E S +L L D R ++      +QFK +   N   F+  +  L A
Sbjct: 253 DVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEG-INACKFNWENNLLLA 311

Query: 279 AAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDI 338
           +  +     L+D R +S        H G+V+ +E++P    +L T+G+            
Sbjct: 312 STDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSD---------- 361

Query: 339 GVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPR 398
           G+ +I D + +   + + +H+GH   +ND + + + PWLM S   +N + VWK +  L +
Sbjct: 362 GLIKIWDTSLEIEDKTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLVQ 421

Query: 399 VGGTP 403
              +P
Sbjct: 422 RCTSP 426

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  104 bits (259), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 96/401 (23%), Positives = 160/401 (39%), Gaps = 45/401 (11%)

Query: 26  EEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGEEDNYL 85
           + Y LW+ N  L+YD+++     WPSLS ++ P   ++   +R      T +   +D  +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDENV 69

Query: 86  KIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXX--------TRARYMPQ 137
            IA+I     +  S+    D  + E                            RA Y+PQ
Sbjct: 70  TIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPHGDCNRATYLPQ 129

Query: 138 NSNLVATINGSGKVFLYDRSKDKHSG---LVSTFEYH---KENG------YGLSFNCNDA 185
           N +L++T +  G V+++DR+K   S    L   FE       NG        L +N    
Sbjct: 130 NPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNRQIE 189

Query: 186 GKLLSGSDDGTIALWNV------NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSE 239
           G L S   +G + +W++      N   S P   +    S   ND  W      +     E
Sbjct: 190 GILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLLSIARE 249

Query: 240 DSTLQLHDQREKDTFTSQFKVD---APFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISR 296
           D+ + L D R               +  N   F+     L A A  D  V L+D R +  
Sbjct: 250 DNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDIRKLHN 309

Query: 297 PLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIWDICDIGVEQIPDDAEDGAPEVL 355
           P+ ++   +  ++ +E++P    +L T G ED    +W+            A +G  ++L
Sbjct: 310 PIKTI-NCESPLSALEWNPQLPTVLATGGQEDGLVKLWN------------ASNG--QLL 354

Query: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396
             H GH   +ND + +P+  WLM S   +N   +WK + +L
Sbjct: 355 FTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  104 bits (260), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 98/426 (23%), Positives = 184/426 (43%), Gaps = 53/426 (12%)

Query: 8   MAAVQGEEEDPNKELSID--EEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQA 65
           M+A++ EE  P   +  D  + Y  W+ N  L+YD+++     WPSL+ ++     +   
Sbjct: 1   MSAIE-EEHVPQSSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSD 59

Query: 66  PNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXX 125
            +R  L   T +   ED  + IA +     +  ++    D  + E               
Sbjct: 60  THRILLSAFTSSQLPEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLT 119

Query: 126 XXXXTR--------ARYMPQNSNLVATINGSGKVFLYDRSKD-----KHSGLVSTFE--- 169
                R        ARY+PQN +++A  +  G ++++DR+K      + S  +  +E   
Sbjct: 120 NDISIRFPDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAAL 179

Query: 170 YHKENGY----------GLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWS---SV 216
           Y    G            +S+N    G L S    G I LW++   ++S + + +   +V
Sbjct: 180 YCPPKGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNV 239

Query: 217 HSDI--VNDCKWSNFDLNVFGSVSEDSTLQLHDQR-EKDTFTSQFKV-DAPFNTLAFSKH 272
             D   VND  W     ++  +  E + + L D R   +   S  K+ +   N+  F+ H
Sbjct: 240 DFDALGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSH 299

Query: 273 SQYLFAAAGTDSHVYLFDRRDI-SRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI 331
              L  +  ++  + L+D R +   P+ ++  H  +++ +E++P+ + I+ ++G+D   +
Sbjct: 300 CDSLLISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLV 358

Query: 332 -IWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
            +WD+                 E++  H GH   +ND S N +  WLM S   +N +QVW
Sbjct: 359 KLWDV--------------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVW 404

Query: 391 KCSHKL 396
           K +H L
Sbjct: 405 KPAHNL 410

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 83/397 (20%), Positives = 165/397 (41%), Gaps = 43/397 (10%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    + WP L+L+ +P     +  N  + I+    T +S +++N L + A+ +
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMP----QNSNLVATING 147
           L   ++    + +D++  +                    R +  P        L AT++ 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 148 SGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSGS 192
           +G V++YD +    +     ++  K                GYGL ++     G LLSG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 193 DDGTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREK 251
             G I L   + S   +    ++  +++ + D +WS  +  VF + + D  +++ D R K
Sbjct: 294 CSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRSK 353

Query: 252 D--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRR-------DISRPLHSMA 302
                 S    +   N +++S    YL A+   +    ++D R       D  +P+    
Sbjct: 354 KHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQYD 413

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDA------EDGAPEVL 355
            H GA+T++ F+P  + I+    ED    +WD+  +   E+I   A      +D  P++L
Sbjct: 414 FHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQDIPPQLL 473

Query: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
            +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 474 FVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWKT 507

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 90/401 (22%), Positives = 169/401 (42%), Gaps = 52/401 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNR-QELIIGTHT--SGEEDNYLKIAAI-D 91
           P +YD +    + WP L+L+ +P    +Q  N  Q L++ T T  S +++N L + ++  
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXT-RARYMP-QNSN---LVATIN 146
           L   ++   +++   ++ E                   T R R  P   SN   L AT++
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATMS 238

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKEN--------------GYGLSFN-CNDAGKLLSG 191
            +G+V+++D      +     ++  K +              GY L ++     G LL+G
Sbjct: 239 ENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALLTG 298

Query: 192 SDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
              G I L   N S    +  P  V    ++  V D +WS  +  VF S   D  +++ D
Sbjct: 299 DCSGQIYLTQRNTSKWVTDKQPFTVG---NNKSVEDIQWSRTEATVFASCGCDGYVRIWD 355

Query: 248 QREKDTFTSQFKVDAP---FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RP 297
            R K        V A     N +++++   YL A+   +    ++D R  +       +P
Sbjct: 356 TRSKQ-HKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINNVQP 414

Query: 298 LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDA------EDG 350
           +     H GA+T++ F+P ++ I+  + ED    +WD+  +   E+I   A      E  
Sbjct: 415 VAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELESI 474

Query: 351 APEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
            P++L +H   +  + D   +  IP  + S+  +  + +WK
Sbjct: 475 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 85/401 (21%), Positives = 164/401 (40%), Gaps = 50/401 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAID- 91
           P +Y+ +    L WP L+L+ +P    ++  N  + I+    T  S ++DN L +  +  
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXT--RARYMP----QNSNLVATI 145
           L   ++   + ++++   E                   T  R R  P    Q   L +T+
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTSTM 238

Query: 146 NGSGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLS 190
           + +G+VF+YD +    +     ++  K                GYGL ++     G LL+
Sbjct: 239 SENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALLT 298

Query: 191 GSDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLH 246
           G   G + L   + S    + +P  V    ++  + D +WS  +  VF +   D  +++ 
Sbjct: 299 GDCSGMVYLTQRHTSKWVTDKTPFTVG---NNKSIEDIQWSRTESTVFATAGCDGYIRIW 355

Query: 247 DQREKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS------RPL 298
           D R K      S    +   N +++++   YL A+        ++D R  S       P+
Sbjct: 356 DTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPV 415

Query: 299 HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPD------DAEDGA 351
                H GA+T++ F+P  + I+  + ED    +WD+  +   E+I        + E   
Sbjct: 416 AQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQIP 475

Query: 352 PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           P++L +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 476 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 513

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/396 (21%), Positives = 164/396 (41%), Gaps = 43/396 (10%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQE---LIIGTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    L WP LSL+ +P +  ++  N  +   L   T  S ++DN L +  +  
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNS----NLVATING 147
           L   ++      E+    E                    R +  P  S     L AT++ 
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMSE 245

Query: 148 SGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSGS 192
           +G+V+++D      +  +  ++  K                GY L ++  N +G LL+G 
Sbjct: 246 NGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTGD 305

Query: 193 DDGTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREK 251
             G + L   + S   +    +S+ ++  + D ++S  +  VF S   D  +++ D R K
Sbjct: 306 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSK 365

Query: 252 DTFTS-QFKVDAP-FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RPLHSMA 302
               +   K  A   N +++++   YL A+   +    ++D R  S        P+    
Sbjct: 366 KHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSPVAQYN 425

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDA------EDGAPEVL 355
            H GA+T++ F+P  D I+  + ED    +WD+  +   E+I   A      ++  P++L
Sbjct: 426 FHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQEIPPQLL 485

Query: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
            +H   +  + D   +  IP  + S+  +  + +WK
Sbjct: 486 FVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 80/394 (20%), Positives = 166/394 (42%), Gaps = 41/394 (10%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    + WP LSL+ +P    ++  N  + I+    T  S +++N L + ++ +
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNSN--LVATINGSG 149
           L   ++   E+ E+++  +                    +       S   L AT++ +G
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENG 238

Query: 150 KVFLYDRSKDKHSGLVSTFEYHKEN--------------GYGLSFN-CNDAGKLLSGSDD 194
           +V+++D            ++  K++              GYGL ++    +G LLSG   
Sbjct: 239 EVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCS 298

Query: 195 GTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD- 252
           G I L   + S   +    +S  ++  + D +WS  +  VF +   D  +++ D R K  
Sbjct: 299 GQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKKH 358

Query: 253 -TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RPLHSMAGH 304
               S    +   N +++++   YL A+   +    ++D R  +       +P+     H
Sbjct: 359 KPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFH 418

Query: 305 DGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA------PEVLMI 357
            GA+T++ F+P ++ I+    ED    +WD+  +   E+I    E+        P++L +
Sbjct: 419 KGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLFV 478

Query: 358 HAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
           H   +  I D   +  IP  + S+  +  + +WK
Sbjct: 479 H--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/400 (20%), Positives = 163/400 (40%), Gaps = 49/400 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    + WP L+L+ +P    ++  N  + I+    T +S +++N L + A+ +
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMP----QNSNLVATING 147
           L   ++    + ED ++ +                    R +  P        L AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 148 SGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSGS 192
           +G V++Y+ +    +     ++  K                GYGL ++     G LLSG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 294

Query: 193 DDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQ 248
             G I     + S    +  P  V    ++  + D +WS  +  VF +   D  +++ D 
Sbjct: 295 CSGQIYFTQRHTSRWVTDKQPFTV---SNNKSIEDIQWSRTESTVFATAGCDGYIRIWDT 351

Query: 249 REKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRR-------DISRPLH 299
           R K      S    +   N +++S    YL A+   +    ++D R       D  +P+ 
Sbjct: 352 RSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVA 411

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDA------EDGAP 352
               H GA+T++ F+P  + I+    ED    +WD+  +   E+I   A      ++  P
Sbjct: 412 QYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPP 471

Query: 353 EVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           ++L +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 472 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 508

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/397 (20%), Positives = 163/397 (41%), Gaps = 45/397 (11%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQE---LIIGTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    L WP LSL+ +P    ++  N  +   L   T  S ++DN L +  +  
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNS----NLVATING 147
           L   ++   E  +++   E                    R +  P  S     L A+++ 
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMSE 246

Query: 148 SGKVFLYDRS--------------KDKHSGLVSTFEYHKENGYGLSFN-CNDAGKLLSGS 192
           +G+V+++D                K     + +   +    GY L ++  N +G LL+G 
Sbjct: 247 NGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGD 306

Query: 193 DDGTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREK 251
             G + L   + S   +    +S+ ++  + D ++S  +  VF +   D  +++ D R K
Sbjct: 307 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSK 366

Query: 252 DTFTSQFKVDAP---FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RPLHSM 301
                   V A     N +++++   YL A+   +    ++D R  S        P+   
Sbjct: 367 K-HKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQY 425

Query: 302 AGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA------PEV 354
           + H GA+T++ F+P  D I+  + ED    +WD+  +   E+I   A +        P++
Sbjct: 426 SFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 485

Query: 355 LMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
           L +H   +  + D   +  IP  + S+  +  + +WK
Sbjct: 486 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 519

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 83/398 (20%), Positives = 160/398 (40%), Gaps = 48/398 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAIDL 92
           P +Y+ +    + WP L+L+ +P    ++  N  + I+    T +S + +N L + A+  
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 93  PNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNSN----LVATINGS 148
               +   +  ED  + E                    R +  P  ++    L AT++ +
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATMSEN 233

Query: 149 GKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSGSD 193
           G V++YD +    +     ++  K                GYGL ++     G LLSG  
Sbjct: 234 GDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSGDC 293

Query: 194 DGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249
            G I     + S    +  P  V    ++  + D +WS  +  VF +   D  +++ D R
Sbjct: 294 SGQIYFTQRHTSRWVTDKQPFTV---SNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 350

Query: 250 EKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRR-------DISRPLHS 300
            K      S    +   N +++S    YL A+   +    ++D R       D  +P+  
Sbjct: 351 SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQ 410

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPD------DAEDGAPE 353
              H GA+T++ F+P  + I+    ED    +WD+  +   E+I        + ++  P+
Sbjct: 411 YDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPPQ 470

Query: 354 VLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
           +L +H   +  + D   +  IP  + S+  +  + VWK
Sbjct: 471 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/399 (19%), Positives = 164/399 (41%), Gaps = 48/399 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    L WP ++L+ +P    ++  N  + I+    T  + ++DN L +  +  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNSN----LVATING 147
           L   ++   E+ E+ +                       R R  P  S+    L AT++ 
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATMSE 239

Query: 148 SGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSGS 192
           +G+V+++D +    +     ++  K                GY L ++    +G LL+G 
Sbjct: 240 NGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLTGD 299

Query: 193 DDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQ 248
             G +     + S    +  P  V    ++  + D +WS  +  VF +   D  +++ D 
Sbjct: 300 CSGQVYFTQRHTSKWVTDKQPFTV---SNNKSIEDIQWSRTEATVFATAGCDGYIRVWDT 356

Query: 249 REKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS------RPLHS 300
           R K      S    +   N +++++   YL A+   +    ++D R  S      +P+  
Sbjct: 357 RSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVAQ 416

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDIC----DIGVEQIPDDAEDGA---PE 353
              H GA+T++ F P  + I+  + ED    +WD+     D  ++Q   + ++ A   P+
Sbjct: 417 YDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIPPQ 476

Query: 354 VLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           +L +H   +  + D   +  IP  + S+  +  + +WK 
Sbjct: 477 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKT 512

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 82/400 (20%), Positives = 161/400 (40%), Gaps = 49/400 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAIDL 92
           P +Y+ +    + WP L+L+ +P     +  N  + I+    T  S +++N L +  +  
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 93  PNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRAR-----YMPQNSNLVATING 147
            N  +   +  E++   +                   T  R     +      L AT++ 
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMSE 237

Query: 148 SGKVFLYDRS--------------KDKHSGLVSTFEYHKENGYGLSFN-CNDAGKLLSGS 192
           +G+V+++D                K     L +   +    GYGL ++     G LL+G 
Sbjct: 238 NGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTGD 297

Query: 193 DDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQ 248
             G + L   + S    +  P + +S+  S  + D +WS  +  VF +   D  +++ D 
Sbjct: 298 CSGQVYLTQRHTSKWVTDKQP-FTFSNNKS--IEDIQWSRTESTVFATSGCDGYIRIWDT 354

Query: 249 REKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RPLH 299
           R K      S        N +++++   YL A+   D    ++D R +S       +P+ 
Sbjct: 355 RSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQPVA 414

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA------P 352
               H GA+T++ F+P  + I+  + ED    +WD+  +   E+I   A +        P
Sbjct: 415 QYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPP 474

Query: 353 EVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           ++L +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 475 QLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWKT 511

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 81/399 (20%), Positives = 160/399 (40%), Gaps = 48/399 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAIDL 92
           P +Y+ +    + WP L+L+ +P    ++  N  + I+    T +S +++N L + A+  
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 93  PNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMP----QNSNLVATINGS 148
               +   E  E+ ++ +                    R +  P        L AT++ +
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSEN 233

Query: 149 GKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSGSD 193
           G V++YD +    +     ++  K                GYGL ++     G LLSG  
Sbjct: 234 GDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLLSGDC 293

Query: 194 DGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249
            G +     + S    +  P  V    ++  + D +WS  +  VF +   D  +++ D R
Sbjct: 294 SGQVYFTQRHTSRWVTDKQPFTV---SNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTR 350

Query: 250 EKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRR-------DISRPLHS 300
            K      S    +   N +++S    YL A+   +    ++D R       D  +P+  
Sbjct: 351 SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQPVAQ 410

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPD------DAEDGAPE 353
              H GA+T++ F+P  + I+    ED    +WD+  +   E+I        + ++  P+
Sbjct: 411 YDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPPQ 470

Query: 354 VLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           +L +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 471 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 506

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 83/401 (20%), Positives = 164/401 (40%), Gaps = 51/401 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    + WP ++L+ +P    ++  N  + I+    T  S ++DN L +  +  
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMPQNSN------LVATI 145
           L   +       +++++ +                    R +  P  S+      L AT+
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEILTATM 241

Query: 146 NGSGKVFLYDRSKD----KHSGL---------VSTFEYHKE-NGYGLSFN-CNDAGKLLS 190
           + +G+V+++D +      K  G          + T + H    GY L ++     G LL+
Sbjct: 242 SENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGALLT 301

Query: 191 GSDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLH 246
           G   G + L   + S    +  P  V    ++  V D +WS  +  VF S   D  +++ 
Sbjct: 302 GDCSGQVYLTQRHTSKWISDKEPFTV---ANNQSVEDIQWSRTESTVFASCGCDGYIRVW 358

Query: 247 DQREKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RP 297
           D R K      S    +   N +++S+   YL A+   +    ++D R  S        P
Sbjct: 359 DTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNSNNTSP 418

Query: 298 LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA----- 351
           +     H GA+T++ F+P  + I+  + ED    +WD+  +   E+I   A +       
Sbjct: 419 VAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 478

Query: 352 -PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
            P++L +H   +  + D   +  IP  + S+  +  + +WK
Sbjct: 479 PPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 85/402 (21%), Positives = 167/402 (41%), Gaps = 52/402 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAIDL 92
           P +Y+ +    L WP ++L+ +P +  ++  N  + I+    T  S +++N L + ++  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 93  PNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXT--RARYMPQNSN----LVATIN 146
            N  +  +E+ ED+ +                     T  R +  P  S     L AT++
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSG 191
            +G+V+++D +    +     ++  K                GY L ++     G LL+G
Sbjct: 240 ENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALLTG 299

Query: 192 SDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
              G I     + S    +  P   +++ ++  V D +WS  +  VF S   D  +++ D
Sbjct: 300 DCSGQIYFTQRHTSKWITDKQP---FTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWD 356

Query: 248 QREKDTFTSQFKVDAP---FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RP 297
            R K        V A     N +++S+   YL A+   +    ++D R  S       +P
Sbjct: 357 TRSK-KHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQP 415

Query: 298 LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPD------DAEDG 350
           +     H GA+T++ F+P  D I+  + ED    +WD+  +   E+I        + E  
Sbjct: 416 VAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKI 475

Query: 351 APEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
            P++L +H   +  + D   +  IP  + S+  +  + +WK 
Sbjct: 476 PPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWKT 514

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 66/128 (51%), Gaps = 7/128 (5%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           + +S+    +FA+AG D ++ ++D R    +P  S+   +  V  + +S ++ G L+ SG
Sbjct: 333 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWS-EKIGYLLASG 391

Query: 326 EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEEN 385
           +D    +W + D+  +  PD+  D  P  +  +  H+ AI   + NP    ++A + E+N
Sbjct: 392 DDNG--LWGVWDLR-QFSPDNINDVQP--VAQYDFHKGAITSINFNPLDDSIIAVASEDN 446

Query: 386 IIQVWKCS 393
            + +W  S
Sbjct: 447 TVTLWDLS 454

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 88/175 (50%), Gaps = 11/175 (6%)

Query: 162 SGLVSTFEYHKENGY-GLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI 220
           +GL+ TF  H E+ + G+  + +++  +  G++   I LW+   S       W +   D 
Sbjct: 165 NGLIKTF--HGEHAFLGIDHHRSNSNFVTGGAE---INLWDSTRSRPITNLSWGA---DN 216

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280
           V+  K++  + ++F S   D+++ L+D R  ++ T +F      N L ++    Y F  A
Sbjct: 217 VSTVKFNQNETDIFASAGSDNSVVLYDLRT-NSPTQKFVQKMRTNALCWNPMEAYNFVVA 275

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
             D + Y +D R++SR LH    H  AV +++FSP  D I+ T   D+   I+ +
Sbjct: 276 NEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIV-TGSYDKTIRIYQV 329

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 81/183 (44%), Gaps = 22/183 (12%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYV--WSSVHSDIVNDCKWS- 227
           H++  Y ++ N +   KL + S DG +  WN++       +   +  +H   V     S 
Sbjct: 66  HRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLSQ 125

Query: 228 NFDLNVFGSVSEDSTLQLHDQREKDTFTSQF---KVDAPFNTLAFSKHSQYLFAAAGTDS 284
           N + N   S  +D T++L      D F+S+    +V    N L  + H ++ F   G D 
Sbjct: 126 NKNENYMLSCGDDRTVKLWSV-NTDDFSSERGDEEVIKSGNGLIKTFHGEHAF--LGIDH 182

Query: 285 H------------VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAII 332
           H            + L+D    SRP+ +++     V+ ++F+ ++  I  ++G D   ++
Sbjct: 183 HRSNSNFVTGGAEINLWDSTR-SRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVL 241

Query: 333 WDI 335
           +D+
Sbjct: 242 YDL 244

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 85/399 (21%), Positives = 168/399 (42%), Gaps = 48/399 (12%)

Query: 38  MYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAI-DLP 93
           +Y+ +    L+WP +SL+ +P     +  N  + I+    T  S ++DN L I  +  L 
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 94  NDIIPSTEKLEDQQKGEXXXXXXXX---XXXXXXXXXXXTRARYMPQNSN-----LVATI 145
             ++   +   D +  E                       R +  P  +N     L AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 146 NGSGKVFLYDRSKDKHSGLVSTFEYHKEN--------------GYGLSFN-CNDAGKLLS 190
           + +G+V+++D      S  +  ++  K++              G+GL ++    +G LL+
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 191 GSDDGTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249
           G   G I L + + S   +    +S  ++  + D +WS  +  VF +   D  +++ D R
Sbjct: 309 GDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTR 368

Query: 250 EKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY-LFDRRDIS------RPLHS 300
            K      S    +   N +++++  +YL A+ G D  V+ ++D R  S       P+  
Sbjct: 369 SKKHKPAISTRASNVDVNVISWNEKMEYLLAS-GDDKGVWGVWDLRQFSPSQENASPVAQ 427

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPD------DAEDGAPE 353
              H GA+T++ F+P  +  +  + ED    +WD+  +   E+I        + E   P+
Sbjct: 428 YDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKELEQIPPQ 487

Query: 354 VLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           +L +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 488 LLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWKT 523

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/396 (19%), Positives = 157/396 (39%), Gaps = 43/396 (10%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNR-QELIIGTHTSGEEDNYLKIAAI---D 91
           P +Y+ +    + WP ++L+ +P    +   N  Q L++ T T   + N  ++  +    
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATATQASKKNQNELMVLKMSQ 186

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYMP----QNSNLVATING 147
           L   ++   E   + +  +                    R +  P        L +T++ 
Sbjct: 187 LAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLKVSPFANAAQEVLCSTMSE 246

Query: 148 SGKVFLYDRSKDKHSGLVSTFEYHKE---------NGYGLSFNCND------AGKLLSGS 192
           +G+V+++D +    +     ++  K+         N   +    ND       G +LSG 
Sbjct: 247 NGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGAMLSGD 306

Query: 193 DDGTIALWNVNNSN-SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREK 251
             G + L   + S   +    ++  ++  + D +WS  +  VF S   D  +++ D R K
Sbjct: 307 CSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRSK 366

Query: 252 D--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RPLHSMA 302
                 S    +   N +++S+   YL A+   D    ++D R  +        P+    
Sbjct: 367 KHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASPVAQYQ 426

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA------PEVL 355
            H GA+T++ F+P  + I+  + ED    +WD+  +   E+I   A +        P++L
Sbjct: 427 FHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLL 486

Query: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
            +H   +  + D   +  IP  + S+  +  + VWK
Sbjct: 487 FVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 519

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 64/128 (50%), Gaps = 7/128 (5%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           L +S+    +FA+ G D ++ ++D R    +P  S+   +  V  + +S ++ G L+ SG
Sbjct: 339 LQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWS-EKIGYLLASG 397

Query: 326 EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEEN 385
           +D     W + D+  +  P +A   +P  +  +  H+ AI   S NP    ++A + E+N
Sbjct: 398 DDDGT--WGVWDLR-QFTPQNASTASP--VAQYQFHKGAITSISFNPLDESIIAVASEDN 452

Query: 386 IIQVWKCS 393
            + +W  S
Sbjct: 453 TVTLWDLS 460

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 87/174 (50%), Gaps = 11/174 (6%)

Query: 163 GLVSTFEYHKENGY-GLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIV 221
           GL+ TF  H +  + G+  + +    + +G++   I LW+ + S  +    W +   D V
Sbjct: 165 GLIKTF--HGDYAFLGIDHHRSKPYFVTAGAE---INLWDSSRSRPTANLSWGA---DNV 216

Query: 222 NDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAG 281
           +  K++  + ++F S   D+++ L+D R  ++ T +F      N L ++    Y F  A 
Sbjct: 217 STVKFNQNETDIFASAGSDNSVVLYDLRT-NSPTQKFTQRMRTNALCWNPMEAYNFVVAS 275

Query: 282 TDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
            D + Y +D R++SR LH    H  AV +++FSP  D I+ T   D+   I+ +
Sbjct: 276 EDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIV-TGSYDKTIRIYQV 328

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 77/183 (42%), Gaps = 23/183 (12%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYV--WSSVHSDIVNDCKWS- 227
           H++  Y ++ N +   KL S S DG +  WN++       +   +  VH   V     S 
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWNMSTREEICSFKAHYGLVHGLCVTPQHLSA 125

Query: 228 NFDLNVFGSVSEDSTLQL--------------HDQREKDTFTSQFKVDAPFNTLAFSKH- 272
           N + N   S  +D T++L               +Q   D     F  D  F  L    H 
Sbjct: 126 NKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAF--LGIDHHR 183

Query: 273 SQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAII 332
           S+  F  AG + +++   R   SRP  +++     V+ ++F+ ++  I  ++G D   ++
Sbjct: 184 SKPYFVTAGAEINLWDSSR---SRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVL 240

Query: 333 WDI 335
           +D+
Sbjct: 241 YDL 243

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 80/404 (19%), Positives = 161/404 (39%), Gaps = 54/404 (13%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNR-QELIIGTHTSGEEDNYLKIAAIDLPN 94
           P +Y+ +    + WP ++L+ +P    ++  N  Q L++ T T        ++  + L N
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 95  DIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXX-------XXTRARYMPQNSN----LVA 143
            ++ +  K +++++ E                           R +  P  S+    L A
Sbjct: 172 -LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAA 230

Query: 144 TINGSGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKL 188
           T++ +G+V+++D      +     ++  K                GY L ++     G L
Sbjct: 231 TMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGAL 290

Query: 189 LSGSDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
           L+G   G I     + S    +  P  V    ++  + D +WS  +  VF S   D  ++
Sbjct: 291 LTGDCSGQIYFTQRHTSKWITDKQPFTV---ANNQSIEDIQWSRTESTVFASAGCDGYIR 347

Query: 245 LHDQREKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS------- 295
           + D R K      S    +   N +++S+   YL A+   +    ++D R  S       
Sbjct: 348 IWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSV 407

Query: 296 RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA--- 351
           +P+     H GA+T++ F+P  + I+    ED    +WD+  +   E+I   A +     
Sbjct: 408 QPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQ 467

Query: 352 ---PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
              P++L +H   +  + D   +  IP  + S+  +  + +WK 
Sbjct: 468 QIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKT 508

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 65/129 (50%), Gaps = 9/129 (6%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           + +S+    +FA+AG D ++ ++D R    +P  S+   +  V  + +S ++ G L+ SG
Sbjct: 327 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWS-EKLGYLLASG 385

Query: 326 EDRRAI-IWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEE 384
           +D     +WD+        P++A  G+ + +  +  H+ AI   S NP    ++A   E+
Sbjct: 386 DDNGTWGVWDLRQFS----PENA--GSVQPVAQYDFHKGAITSISFNPLDESIIAVGSED 439

Query: 385 NIIQVWKCS 393
           N + +W  S
Sbjct: 440 NTVTLWDLS 448

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 121/288 (42%), Gaps = 43/288 (14%)

Query: 141 LVATINGSGKVFLYDRS--------------KDKHSGLVSTFEYHKENGYGLSFN-CNDA 185
           L AT++ +G+ ++YD                K     L S   +    GYGL ++     
Sbjct: 239 LAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGYGLDWSPLIKT 298

Query: 186 GKLLSGSDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDS 241
           G +L+G   G + L     S    +  P  V ++     + D +WS  ++ VF +   D 
Sbjct: 299 GSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKS---IEDIQWSRAEMTVFATCGVDG 355

Query: 242 TLQLHDQREKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY-LFDRRDIS--- 295
            +++ D R K      S    D   N +++++   YL A+ G DS  + ++D R  S   
Sbjct: 356 HIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLAS-GDDSGTWGVWDLRQFSAQN 414

Query: 296 ----RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDG 350
                P+     H  A+T++ F+P  + I+  + ED    +WD+  +   E+I     + 
Sbjct: 415 TEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQTAET 474

Query: 351 A------PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           A      P++L +H   +  + D   +  IP  + S+  +  + +WK 
Sbjct: 475 AELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWKT 519

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           + +S+    +FA  G D H+ ++D R    +P  S+   D  V  M ++ ++ G L+ SG
Sbjct: 338 IQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWN-EKIGYLLASG 396

Query: 326 EDRRAI-IWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEE 384
           +D     +WD+     +    + E   P  +  +  H++AI   S NP    ++A + E+
Sbjct: 397 DDSGTWGVWDLRQFSAQ----NTEKTTP--VAQYNFHKAAITSISFNPLDESIIAVASED 450

Query: 385 NIIQVWKCS 393
           N + +W  S
Sbjct: 451 NTVTLWDLS 459

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 123/309 (39%), Gaps = 64/309 (20%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D +  K+   +  F+ HK+     ++N    G  +S S DG + +
Sbjct: 75  NQVLVAQGDGSLRLFDTTLQKYP--IGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKM 132

Query: 200 W--------------------------------NVNNSNSSPIYVWSSVHSDIVNDCKWS 227
           W                                +VNN+ S+PI      + D V   ++S
Sbjct: 133 WSPLREQSLLTLLPKSSEQSSKINHNQIAKIPPHVNNNQSTPIL----QNKDCVYQAQFS 188

Query: 228 NFDLNVFGSVSEDSTLQLHDQREK------DTFTSQFKVDAPFNTLAFSKHSQYLFAAAG 281
             D N+    S +S + L D RE+      ++F +   ++    TL F+K+   + A++G
Sbjct: 189 PHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETL--TLDFNKYRPTVLASSG 246

Query: 282 TDSHVYLFDRRDI------------SRPL---HSMAGHDGAVTNMEFSPDQDGILMTSGE 326
            D+ + ++D R I            S P+        HD AV  + +SP Q  +L+++  
Sbjct: 247 ADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSY 306

Query: 327 DRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNI---PWLMASSEE 383
           D  + +W        +I        P   +I   H      F  + ++   P  +A++  
Sbjct: 307 DMTSKVWKDFSFDGSKITGKTNSIDPGSGLIKTFHHHTEFVFGADWSLWGQPGFIATTGW 366

Query: 384 ENIIQVWKC 392
           ++ + +W C
Sbjct: 367 DSKVYIWNC 375

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 80/195 (41%), Gaps = 39/195 (20%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKE-NGYGLSFNCNDAGKLL 189
           +A++ P ++NL+A  +G+  + L+D  +  +    ++F  H       L FN      L 
Sbjct: 184 QAQFSPHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETLTLDFNKYRPTVLA 243

Query: 190 SGSDDGTIALWNV-----NNSN------SSPIYV--WSSVHSDIVNDCKWSNFDLNVFGS 236
           S   D +I +W++     NNSN      S+PI +      H   V    WS    N+  S
Sbjct: 244 SSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLS 303

Query: 237 VSEDSTLQLHDQREKDTFTSQFKVDAPFNTL--------AFSKHSQYLFAA--------- 279
            S D T ++     KD      K+    N++         F  H++++F A         
Sbjct: 304 TSYDMTSKVW----KDFSFDGSKITGKTNSIDPGSGLIKTFHHHTEFVFGADWSLWGQPG 359

Query: 280 ----AGTDSHVYLFD 290
                G DS VY+++
Sbjct: 360 FIATTGWDSKVYIWN 374

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 86/404 (21%), Positives = 171/404 (42%), Gaps = 54/404 (13%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNR-QELIIGTHT--SGEEDNYLKIAAI-D 91
           P +Y+ +    + WP L+L+ +P    ++  N  Q L++ T T  S +++N L + ++ +
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXX---XXXXTRARYMP-QNSN---LVAT 144
           L   ++   ++ ++ +  E                       R +  P  NS+   L AT
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTAT 232

Query: 145 INGSGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFNCN-DAGKLL 189
           ++ +G+V+++D      +     ++  K                GY L ++ +   G LL
Sbjct: 233 MSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALL 292

Query: 190 SGSDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL 245
           +G   G I     + S    +  P  V    ++  + D +WS  +  VF S   D  +++
Sbjct: 293 TGDCSGQIYFTQRHTSKWVTDKQPFTV---SNNKSIEDIQWSRTEGTVFASAGCDGYIRI 349

Query: 246 HDQREKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY-LFDRRDIS------- 295
            D R K      S    +   N +++S    YL A+ G D+ V+ ++D R  S       
Sbjct: 350 WDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLAS-GDDNGVWGVWDLRQFSPDTANSV 408

Query: 296 RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA--- 351
           +P+     H GA+T++ F+P  + I+  + ED    +WD+  +   E+I   A +     
Sbjct: 409 QPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 468

Query: 352 ---PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
              P++L +H   +  + D   +  IP  + S+  +  + +WK 
Sbjct: 469 QIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWKT 509

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (50%), Gaps = 7/128 (5%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           + +S+    +FA+AG D ++ ++D R    +P  S+   +  V  + +S D+ G L+ SG
Sbjct: 328 IQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWS-DKLGYLLASG 386

Query: 326 EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEEN 385
           +D    +W + D+  +  PD A    P  +  +  H+ AI   S NP    ++A + E+N
Sbjct: 387 DDNG--VWGVWDLR-QFSPDTANSVQP--VAQYDFHKGAITSISFNPLDESIVAVASEDN 441

Query: 386 IIQVWKCS 393
            + +W  S
Sbjct: 442 TVTLWDLS 449

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/400 (20%), Positives = 154/400 (38%), Gaps = 49/400 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELII---GTHTSGEEDNYLKIAAIDL 92
           P +Y+ +    L WP ++L+ +P    ++  N  + I+    T  S ++DN L +  +  
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 93  PNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXTRARYM------PQNSNLVATIN 146
               +   E    +   +                   T  R             L AT++
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAATMS 244

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKE--------------NGYGLSFN-CNDAGKLLSG 191
            +G+  ++D      +     ++  K                GYGL ++     G LL+G
Sbjct: 245 ENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALLTG 304

Query: 192 SDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
              G + L    +S    +  P  V    ++  + D KWS  +  VF +   D  +++ D
Sbjct: 305 DCSGRVFLTQRTSSKWITDKQPFTV---DNNKSIEDIKWSPSENTVFATCGVDGHVRIWD 361

Query: 248 QREKDTFTS-QFKV-DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISR------PLH 299
            R K    +   KV D   N +++++   YL A    +    ++D R  S       P+ 
Sbjct: 362 IRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPVA 421

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDA------EDGAP 352
               H GA+T++ F+P  + I+  + ED    +WD+  +   E+I   A      +   P
Sbjct: 422 QYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQIPP 481

Query: 353 EVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
           ++L +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 482 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 518

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 55/128 (42%), Gaps = 8/128 (6%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFD-RRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           + +S     +FA  G D HV ++D R    +P  S+   D  V  M ++     +L T  
Sbjct: 338 IKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGD 397

Query: 326 EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEEN 385
           ++    +WD+     +Q       G    +  +  H+ AI   S NP    ++A + E+N
Sbjct: 398 DNGTWGVWDLRQFSNQQ-------GGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDN 450

Query: 386 IIQVWKCS 393
            + +W  S
Sbjct: 451 TVTLWDLS 458

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/402 (19%), Positives = 163/402 (40%), Gaps = 51/402 (12%)

Query: 36  PLMYDFVSETRLTWPSLSLEWLPQEKSAQA---PNRQELIIGTHTSGEEDNYLKIAAI-D 91
           P +Y+ +    + WP ++L+ +P    ++    P    L   T  + ++DN L +  +  
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 92  LPNDIIPSTEKLEDQQKGEXXXXXXXXXXXXXXXXXXXT--RARYMPQNSN----LVATI 145
           L   ++    +  D+   +                   T  R +  P  ++    L AT+
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTATM 237

Query: 146 NGSGKVFLYDRSKDKHSGLVSTFEYHKEN--------------GYGLSFN-CNDAGKLLS 190
             +G+V+++D      +     ++  K +              GYGL ++     G LL+
Sbjct: 238 CENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLT 297

Query: 191 GSDDGTIALWNVNNS----NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLH 246
           G   G I L   + S    +  P   +++ ++  V D +WS  +  VF +   D  +++ 
Sbjct: 298 GDCSGQIFLTQRHTSKWITDKQP---FTAANNQSVEDIQWSPTESTVFATSGTDGYVRIW 354

Query: 247 DQREKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-------RP 297
           D R K      S    +   N +++++   YL A+   +    ++D R  S       +P
Sbjct: 355 DTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQP 414

Query: 298 LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDIC----DIGVEQIPDDAEDG--- 350
           +     H G +T++ F+P  D ++  + ED    +WD+     D  ++Q   + ++    
Sbjct: 415 VAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEYKELQKI 474

Query: 351 APEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKC 392
            P++L +H   +  + D   +  IP  + S+  +  + VWK 
Sbjct: 475 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 513

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           + +S     +FA +GTD +V ++D R    +P  S    +  V  + ++ ++ G L+ SG
Sbjct: 332 IQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWN-EKLGYLLASG 390

Query: 326 EDRRAI-IWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEE 384
           +D  +  +WD+        P ++E   P  +  +  HR  I   S NP    ++A + E+
Sbjct: 391 DDNGSWGVWDLRQFS----PANSEGVQP--VAQYDFHRGPITSISFNPLDDSVVAVASED 444

Query: 385 NIIQVWKCS 393
           N + +W  S
Sbjct: 445 NTVTLWDLS 453

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 4/128 (3%)

Query: 197 IALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTS 256
           I LW++N S       W +   D +N  K++  D NV GS   D+++ L+D R  ++ T 
Sbjct: 198 INLWDINRSKPLSDLSWGA---DNINTVKFNQNDANVLGSAGSDNSIVLYDLRT-NSATQ 253

Query: 257 QFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPD 316
           +       N++ ++    + F  A  D + Y +D R++SR L+    H  AV +++ SP 
Sbjct: 254 KIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPT 313

Query: 317 QDGILMTS 324
            + ++  S
Sbjct: 314 GEEVVTAS 321

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 81/186 (43%), Gaps = 26/186 (13%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDC------ 224
           H++  Y L+ + ND  K+ SGS DG I  W++  S+   I  + + +  I   C      
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDM--SSREQIASFKAHYGTITGLCITPKVN 123

Query: 225 --KWSNFDLNVFGSVSEDSTLQL---------HDQREKDTFTSQFKVDAPFNTLAFS--K 271
               S+ + N   S S+D T++L         H   ++   T    +   +   AF    
Sbjct: 124 IDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLD 183

Query: 272 HSQYL--FAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRR 329
           HS+    F   G   +++  +R   S+PL  ++     +  ++F+ +   +L ++G D  
Sbjct: 184 HSRMTSNFVTGGPRINLWDINR---SKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNS 240

Query: 330 AIIWDI 335
            +++D+
Sbjct: 241 IVLYDL 246

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

Query: 145 INGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVN- 203
           + G  ++ L+D ++ K    +S   +  +N   + FN NDA  L S   D +I L+++  
Sbjct: 192 VTGGPRINLWDINRSK---PLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRT 248

Query: 204 NSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFK 259
           NS +  I     V +  VN   W+  +   F   SED     +D R      + FK
Sbjct: 249 NSATQKI-----VQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFK 299

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 120/298 (40%), Gaps = 47/298 (15%)

Query: 132 ARYMPQNSNLVATINGS-------GKVFLYDRSKDKHSGLVSTFEYHKENG-YGLSFNCN 183
            +Y P   N +A   GS       GK+F+ D   D H  +V +  +  ++G + +++N  
Sbjct: 14  VQYSPFYDNKLAVATGSNFGLVGNGKLFILD--IDPHGRMVESNSFLTQDGLFDVAWNEG 71

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243
            A ++L+   DG++ L+++N     PI ++   H   V  C W+  +   F S S D T+
Sbjct: 72  HANQVLAAQGDGSLRLFDINLPQY-PISIFQE-HQKEVFSCNWNLVNKQTFVSSSWDGTV 129

Query: 244 QLHDQREKDTFTSQFKVDAPFNTLA-----------------------------FSKHSQ 274
           ++     +++ T+   +    + L                              FS H  
Sbjct: 130 KIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDP 189

Query: 275 YLFAAAGTDSHVYLFD-RRDISRPLHSMAGHDGAVT-NMEFSPDQDGILMTSGEDRRAII 332
            L      +S+V LFD R+  +    +   H G  T   +F+  +  I+ T G D+   I
Sbjct: 190 NLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKI 249

Query: 333 WDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           WD+  +     P        E+     GH  AI   S +P+   L+ S+  +   +VW
Sbjct: 250 WDLRMVRKFSNPLQQPMSINEI----PGHELAIRKVSWSPHHSNLVLSTSYDMTCRVW 303

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 99/239 (41%), Gaps = 48/239 (20%)

Query: 138 NSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           ++N V    G G + L+D +  ++   +S F+ H++  +  ++N  +    +S S DGT+
Sbjct: 72  HANQVLAAQGDGSLRLFDINLPQYP--ISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTV 129

Query: 198 ALWN------------------------------VNNSNSSPIYVWSSVHSDIVNDCKWS 227
            +W+                               N  N S I    S + D +   ++S
Sbjct: 130 KIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSII----SKNKDCIYQAQFS 185

Query: 228 NFDLNVFGSVSEDSTLQLHDQRE-KDTFTSQFKVDAPFNTLA--FSKHSQYLFAAAGTDS 284
             D N+    + +S + L D R+  +T    F       TL   F+K+  ++ A  G D 
Sbjct: 186 PHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDK 245

Query: 285 HVYLFDRRDI---SRPLHS------MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
            V ++D R +   S PL        + GH+ A+  + +SP    +++++  D    +WD
Sbjct: 246 LVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVWD 304

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 82/173 (47%), Gaps = 9/173 (5%)

Query: 163 GLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVN 222
           G++ TF  H E+ +    +       ++G     I LW+ N S       W +   D +N
Sbjct: 164 GIIKTF--HGEHAFQSLDHHRQKSNFVTGG--AQIELWDTNRSKPISNLSWGA---DNIN 216

Query: 223 DCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT 282
             +++  ++++  S   D+++ L+D R  ++ T +       N++ ++    + F  A  
Sbjct: 217 HVRFNQNEVDILASTGSDNSVVLYDLRT-NSPTQKIVQTMRTNSICWNPVEAFNFVIANE 275

Query: 283 DSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           D + Y +D R++S+ LH    H  AV +++FSP  D ++ T   D+   I+ +
Sbjct: 276 DHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPTGDEVV-TGSYDKTIRIYQV 327

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 77/180 (42%), Gaps = 18/180 (10%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSN--SSPIYVWSSVHSDIVNDCKWSN 228
           H++  Y ++ N N   KL + S DG I  WN++     SS    +  V    V     S 
Sbjct: 66  HRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLSP 125

Query: 229 FDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNT---LAFSKHSQYLFAA------ 279
              N   S  +D T++L      D   S  K D   NT   +  + H ++ F +      
Sbjct: 126 QRENFMLSCGDDKTVKLWSVNSDD--FSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQ 183

Query: 280 ----AGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
                   + + L+D  + S+P+ +++     + ++ F+ ++  IL ++G D   +++D+
Sbjct: 184 KSNFVTGGAQIELWD-TNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYDL 242

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 103/215 (47%), Gaps = 19/215 (8%)

Query: 138 NSNLVATINGSGKVFLYDRSKDKHSGLVST--FEYHKENGYGLSFNCNDAGKLLSGSDDG 195
           N+  +A    +G + LY    D H  +VST  F  H  +   + FN      L SG ++G
Sbjct: 73  NNKTIAGALDNGTLELYSIG-DAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNG 131

Query: 196 TIALWNVNN-----SNSSPIYVWSSVHS-DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249
            I +W++N      S+ +P+    S+ S D VN   W+    +VF S    +   + D +
Sbjct: 132 EIFIWDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 250 EKD-----TFTS-QFKVDAPFNTLAF-SKHSQYLFAAAGTDS--HVYLFDRRDISRPLHS 300
            K      ++TS    +    + + +  K+S  +  A G+D+   + ++D R+ + PL +
Sbjct: 192 AKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQT 251

Query: 301 MA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           ++ GH   + ++++    + +L++SG D   ++W+
Sbjct: 252 LSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 68/167 (40%), Gaps = 9/167 (5%)

Query: 233 VFGSVSEDSTLQLHDQREKDT--FTSQFKVDAPFNTLAFSKHSQYLFAAA--GTDSHVYL 288
           V  + S DS+L+L      D+    +  +VD+ FN L +S +++ +  A   GT     +
Sbjct: 32  VDANFSTDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWSHNNKTIAGALDNGTLELYSI 91

Query: 289 FDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAE 348
            D  D        + H  +V  ++F+  QD +L + G +    IWD+      + P    
Sbjct: 92  GDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNK--CTESPSSYT 149

Query: 349 DGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHK 395
              P   M        +N  + N ++  + AS+   N   +W    K
Sbjct: 150 PLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 87/208 (41%), Gaps = 32/208 (15%)

Query: 140 NLVATINGSGKVFLYD--RSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N VA  + S  + +YD  RSK  ++ LVS+F+ H  +     FN      ++SG  DG I
Sbjct: 193 NYVAVSSNSTVISIYDINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCI 252

Query: 198 ALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQ 257
            +W++ ++N +   V  S  SD V D KW                +  H+      F+S 
Sbjct: 253 KIWDLRSNNPNRCDVSISTSSDSVRDVKW----------------MPYHN------FSS- 289

Query: 258 FKVDAPFNTLAFSKHSQ--YLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSP 315
                P   L  S  +   Y FA+      +  FD R  ++    +  H G    + + P
Sbjct: 290 ----TPTGGLEASSENSMGYKFASIHDSGLLLKFDIRQPNQVEQKINAHTGPGLCLNWHP 345

Query: 316 DQDGILMTSGEDRRAIIWDICDIGVEQI 343
           + + I  T G D +  +W++ D  +  I
Sbjct: 346 NLNYI-TTGGRDGKLCVWNLGDRNISDI 372

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 96/205 (46%), Gaps = 19/205 (9%)

Query: 146 NGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVN-- 203
           NGS ++F Y+    K     + F+ HK       FN      L +G   G I +W+VN  
Sbjct: 83  NGSVELFSYNADSLKSE---AKFQRHKTTAKVARFNAKQFNVLATGGTKGEIFIWDVNKC 139

Query: 204 --NSNS-SPIYVWSSVHS-DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD-----TF 254
             N N  +P+   +S+   + +    W+    +VF S    S   + D + K      ++
Sbjct: 140 LENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLKAKKEVIHLSY 199

Query: 255 TS-QFKVDAPFNTLAF-SKHSQYLFAAAGTDS--HVYLFDRRDISRPLHSMA-GHDGAVT 309
           TS    + AP + + +  K+S  +  A G+D+   + ++D R+ + PL  ++ GH   V 
Sbjct: 200 TSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLSQGHSKGVL 259

Query: 310 NMEFSPDQDGILMTSGEDRRAIIWD 334
           ++++    + +L++SG D   ++W+
Sbjct: 260 SLDWCNQDENLLLSSGRDNTVVLWN 284

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 14/127 (11%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSD-DGTIALWNVNNSNSSPIYVWSSVHSDIVND 223
           +S  E+H +N   ++          +GSD D +I +W++ N+N+ P+ V S  HS  V  
Sbjct: 210 LSVVEWHPKNSTRVA--------TATGSDNDPSILVWDLRNANT-PLQVLSQGHSKGVLS 260

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDA--PFNTLAFSKHSQYLFAAAG 281
             W N D N+  S   D+T+ L + +E    T QF   +   F T  F+  +  +FA+A 
Sbjct: 261 LDWCNQDENLLLSSGRDNTVVLWNPQEGQELT-QFPTRSNWVFKT-KFASQAPDIFASAS 318

Query: 282 TDSHVYL 288
            D+ V +
Sbjct: 319 FDNKVQV 325

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 95/229 (41%), Gaps = 47/229 (20%)

Query: 161 HSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI 220
           H G +   ++H            D   LLSG  D  + LW++ +++   +      H+  
Sbjct: 214 HEGKIGGLDWHP-----------DGNHLLSGGGDNLVKLWDMTSNSFEEL----RGHAGR 258

Query: 221 VNDCKW---------SNFDLN-VFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFS 270
           V+  K          ++FDL  +   +     LQL +   K  +T  F+ D         
Sbjct: 259 VSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGA------- 311

Query: 271 KHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRA 330
                L A+AG D+   ++D R    P+  + GH GA++ +++SP+    L T+G D   
Sbjct: 312 -----LLASAGLDAVCAIWDLRS-GEPIMKLEGHAGAISGVDWSPNGYQ-LATAGADGTV 364

Query: 331 IIWDICDIGVEQIPDDAEDGAPEV--------LMIHAGHRSAINDFSMN 371
            +WDI ++G E      +  A +V         ++  GH   +N F+ +
Sbjct: 365 RVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNAD 413

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 76/162 (46%), Gaps = 8/162 (4%)

Query: 163 GLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVN 222
           GL+ TF  + E+ +    +  +A   ++G     I LW+ N S       W +   D + 
Sbjct: 164 GLLKTF--YGEHAFQGIDHHREASTFVTGG--AQIHLWDSNRSKPISNLSWGA---DNIT 216

Query: 223 DCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT 282
             K++  ++++  S   D+ + L+D R  ++ T +       N + ++    + F  A  
Sbjct: 217 SVKFNQNEVDILASTGSDNAIVLYDLRT-NSPTQKIIQTMRTNAICWNPMEAFNFVIANE 275

Query: 283 DSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTS 324
           D + Y +D R++SR LH    H  AV +++FSP  D I+  S
Sbjct: 276 DHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 317

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 24/183 (13%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVN------DC 224
           H++  Y ++ N N+  KL SGS DG I  WN++       +V    H  +V       + 
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNMSTREE---FVSFKAHYGLVTGLCVTPEH 122

Query: 225 KWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDS 284
              N + N   S  +D T++L      D   S  K DA  NT    K      A  G D 
Sbjct: 123 TSKNKNENFMLSCGDDKTVKLWSVNNDD--FSNVKSDAELNTEGLLKTFYGEHAFQGIDH 180

Query: 285 H------------VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAII 332
           H            ++L+D  + S+P+ +++     +T+++F+ ++  IL ++G D   ++
Sbjct: 181 HREASTFVTGGAQIHLWD-SNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVL 239

Query: 333 WDI 335
           +D+
Sbjct: 240 YDL 242

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 23/171 (13%)

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSVSEDS 241
           D   L+S S D T  +W++ +SN    YV + +  H   V D K+      +F S   D 
Sbjct: 234 DTNLLISSSIDTTCIVWDLQSSN----YVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDG 289

Query: 242 TLQLHDQRE----------------KDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSH 285
           ++++ D R                  DT T   K  +    L  S     + A    DS 
Sbjct: 290 SVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSK 349

Query: 286 -VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
            + + D R+   P+ ++ GH  AV  +++ P +  +L++ G+D + + WD+
Sbjct: 350 SILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDL 400

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 78/201 (38%), Gaps = 28/201 (13%)

Query: 140 NLVATINGSGKVFLYD--RSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N VA    S  V L+D  R+    S LVS+   H  +     FN      L+SG  DG +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 198 ALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLN-VFGSVSEDSTLQLHDQREKDTFTS 256
            +W++  +N           + IVN C   +  +N  FGS+ +   +  ++    D    
Sbjct: 265 KIWDIRTNNP----------TKIVNTC---DVRINTTFGSIRDIKWMPGYNFSGNDR--- 308

Query: 257 QFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPD 316
                   N      H  Y FA+      +  FD R  ++P   +  H G    + + P 
Sbjct: 309 --------NYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPH 360

Query: 317 QDGILMTSGEDRRAIIWDICD 337
           QD I  + G D +  +W   D
Sbjct: 361 QDYI-ASGGRDGKCCLWYFGD 380

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 103/242 (42%), Gaps = 48/242 (19%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D +  K+   V+ F+ H+   +  ++N  D    LS S DGT+ +
Sbjct: 75  NQVLAAQGDGSLRLFDINLQKYP--VAIFQEHEREVFSCNWNLIDKQTFLSSSWDGTVKI 132

Query: 200 WN--------------VNNS---------NSSPI-----YVWSSVHSDIVNDCKWSNFDL 231
           W+               NN+            P+     + +SS + D +    +S  D 
Sbjct: 133 WSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDS 192

Query: 232 NVFGSVSEDSTLQLHDQR-----EKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHV 286
           N+  S S +S + + D R     E+ +F +   ++A   T  F+K+  ++ A  G D  +
Sbjct: 193 NLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEAL--TCDFNKYRPHIVATGGVDKLI 250

Query: 287 YLFDRRDISRPL----------HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW-DI 335
            ++D R + + L          + M GH  AV  + +SP    +L+++  D     W D+
Sbjct: 251 KVWDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRTWQDL 310

Query: 336 CD 337
            D
Sbjct: 311 TD 312

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 71/185 (38%), Gaps = 29/185 (15%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLS 190
           +A Y P +SNLV + +G+  V ++D  +  ++   S   +         FN      + +
Sbjct: 184 QALYSPHDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHIVAT 243

Query: 191 GSDDGTIALWNVNNSNSSPIYVWSSV--------HSDIVNDCKWSNFDLNVFGSVSEDST 242
           G  D  I +W++     S ++  SS         HS  V    WS    ++  S S D T
Sbjct: 244 GGVDKLIKVWDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMT 303

Query: 243 LQLHDQREKDTFTSQFKVDAPFNT-------LAFSKHSQYLFAA-------------AGT 282
            +   Q   D  TS +      N+        +F  HS+++F A              G 
Sbjct: 304 CRTW-QDLTDNNTSGYTPGRTNNSHPQRGCQFSFENHSEFVFGADWSLWGEPGYVATTGW 362

Query: 283 DSHVY 287
           D HVY
Sbjct: 363 DGHVY 367

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 97/205 (47%), Gaps = 17/205 (8%)

Query: 146 NGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN- 204
           NGS +++  +   D  S + + F  H  +   + FN      L SG ++G I +W++N  
Sbjct: 83  NGSLELYSTNEVNDAISSM-AKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKC 141

Query: 205 ----SNSSPIYVWSSVHS-DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD-----TF 254
               +N +P+    S+ S D VN   W+    +VF S    +   + D + K       +
Sbjct: 142 TESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLCY 201

Query: 255 TS-QFKVDAPFNTLAF-SKHSQYLFAAAGTDS--HVYLFDRRDISRPLHSM-AGHDGAVT 309
           TS    +    + + +  K+S  +  A G+D+   + ++D R+ + PL ++  GH   + 
Sbjct: 202 TSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLNQGHQKGIL 261

Query: 310 NMEFSPDQDGILMTSGEDRRAIIWD 334
           ++++    + +L++SG D   ++W+
Sbjct: 262 SLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 11/168 (6%)

Query: 233 VFGSVSEDSTLQLHDQREKDT--FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
           V  + S DS+L+L      D+    +  +VD+ FN L +S H+  + A A  +  + L+ 
Sbjct: 32  VDANFSSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYS 90

Query: 291 RRDISRPLHSMA---GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDA 347
             +++  + SMA    H  +V  ++F+  QD +L + G +    IWD+      + P + 
Sbjct: 91  TNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNK--CTESPANY 148

Query: 348 EDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHK 395
               P   M        +N  + N ++  + AS+   N   +W    K
Sbjct: 149 TPLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 77/169 (45%), Gaps = 25/169 (14%)

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSVSEDS 241
           D   L+S S D T  +W++ +SN    YV + +  H   V D ++      +F S   D 
Sbjct: 244 DTNLLISSSIDTTCIVWDLQSSN----YVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDG 299

Query: 242 TLQLHDQR--------------EKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSH-V 286
           ++++ D R              + +  TSQF +      L  S H   + A    DS+ +
Sbjct: 300 SVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLR----LEPSPHDPNVMATFAADSNKI 355

Query: 287 YLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
            + D R+   PL  + GH  +V  +++ P +  +L++ G+D + + WD+
Sbjct: 356 LILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDL 404

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 87/205 (42%), Gaps = 34/205 (16%)

Query: 140 NLVATINGSGKVFLYDRSKDKH--SGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N +A  N S  + +YD +K+ +  + LV++F  H        FN      L+SG  DG I
Sbjct: 197 NYIAVCNNSTIISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQI 256

Query: 198 ALWNVNN---SNSSPIYVWSSVHSDIVNDCKW-SNFDLNVFGSVSEDSTLQLHDQREKDT 253
            +W++ +   S S+   +  +  SD + D KW   ++ + F         Q +D ++   
Sbjct: 257 KIWDLRSNSLSGSNKPDLNINAASDSIRDVKWMPGYNFSSFN--------QSYDGKQ--- 305

Query: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
                           + +S+Y FA+      +  FD R  ++    +  H G    + +
Sbjct: 306 ----------------TGNSEYKFASIHDSGLLLKFDIRQPNQVEKKINAHTGPGLCLNW 349

Query: 314 SPDQDGILMTSGEDRRAIIWDICDI 338
            P+QD I  T G D +  IW I D+
Sbjct: 350 HPNQDYI-ATGGRDGKCCIWYIGDV 373

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 74/151 (49%), Gaps = 7/151 (4%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
           ++S S+   I +WN+N  +S+ I      HS  + D  +++   ++  + S D+ +   D
Sbjct: 86  IVSTSNQKAI-IWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAWD 144

Query: 248 QREKDT---FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGH 304
            R        TS ++  A      F K S  L ++ G D  V+++D R  S PLH + GH
Sbjct: 145 MRSPHRPFYTTSSWRSSASQVKWNF-KDSNILASSHGND--VFIWDLRHGSTPLHKLTGH 201

Query: 305 DGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           +  V +++FS  ++  +M+S  D     WD+
Sbjct: 202 NSGVNSIDFSRFEENKIMSSSNDGTVKFWDL 232

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 102/216 (47%), Gaps = 19/216 (8%)

Query: 138 NSNLVATI-NGSGKVFLYDRSKD--KHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSD- 193
           N N+   + NG+ ++F +D      K  G +S    HK +   L FN   +  L+SGSD 
Sbjct: 74  NINIAGALDNGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDK 133

Query: 194 DGTIALWNVNNSNSSPIYVWSSVH-SDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD 252
           +G I +W++NN + +P+     +  ++ +    W+    +VF   S  S + + D + K 
Sbjct: 134 NGEILIWDLNNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKK 193

Query: 253 -----TFTSQFK-VDAPFNTLAFSKHSQYLFAAAGTDS------HVYLFDRRDISRPLHS 300
                 +T+    V + F+ + +   +    A A  ++       ++++D R+   PL  
Sbjct: 194 EVIHLNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQI 253

Query: 301 MA--GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           ++  GH   + ++++    + +L++SG D   ++W+
Sbjct: 254 LSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWN 289

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 75/164 (45%), Gaps = 12/164 (7%)

Query: 163 GLVSTFEYHKENGYGLSFNCNDAGKLLS--GSDDGTIALWNVNNSNSSPIYVWSSVHSDI 220
           GLV TF+         +F   D+ ++ S   +    I LW+VN         W +   D 
Sbjct: 171 GLVRTFDGES------AFQGIDSHRVNSTFATGGAKIQLWDVNRVKPVSNLSWGA---DN 221

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280
           +   K++  + ++  S   D+++ L+D R  ++ T +       N + ++    + F  A
Sbjct: 222 ITSVKFNQNETDILASTGSDNSIVLYDLRT-NSPTQKIVQTMRTNAICWNPMEAFNFVIA 280

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTS 324
             D + Y +D R++SR L+    H  AV +++FSP  D I+  S
Sbjct: 281 NEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGS 324

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 80/195 (41%), Gaps = 41/195 (21%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVN-------- 222
           H++  Y ++ N     KL +GS DG I  WN++       +V    H  ++         
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREE---FVSFKAHYGLITGLCVTQPH 122

Query: 223 ------DCKWSNFDLNVFGSVSEDSTLQL--------HDQREKDT--------FTSQFKV 260
                 D K  NF L    S S+D T++L         ++R  D             F  
Sbjct: 123 FHDKKPDLKNQNFML----SCSDDKTVKLWSINVDDYSNKRSSDNDSVINEEGLVRTFDG 178

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGI 320
           ++ F  +  S      FA  G    ++  +R    +P+ +++     +T+++F+ ++  I
Sbjct: 179 ESAFQGID-SHRVNSTFATGGAKIQLWDVNR---VKPVSNLSWGADNITSVKFNQNETDI 234

Query: 321 LMTSGEDRRAIIWDI 335
           L ++G D   +++D+
Sbjct: 235 LASTGSDNSIVLYDL 249

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 105/245 (42%), Gaps = 38/245 (15%)

Query: 164 LVSTFEYHKENGYGLSFNC----NDAGKLLSGSDDGTIALWNVNNS-------NSSPIYV 212
           L  + +Y K   +    NC    ND    L+G+++GT++LWN++N+       N+     
Sbjct: 36  LYHSTKYIKYYNHPYKINCLALNNDKTSFLAGNNNGTVSLWNLDNTLSTSHILNNKLART 95

Query: 213 WSSVHSDI--VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQF--KVDAPFNTLA 268
            +  HS +  +ND KW + D  +F +   D  ++L D       T++F    D  FN+  
Sbjct: 96  STKPHSHLFGINDMKWYSIDDGMFFTCGNDKFVKLWD-------TNKFINVQDLEFNSNL 148

Query: 269 FSKHSQYLFAAAGTDSHV-YLFDRRDISRPLHSMAGHDGAVT-NMEFSPDQDGILMTSGE 326
           F   +   F     D +   L D R+++  +     H  + T   + +P +D ++ +S  
Sbjct: 149 FQMDTANQFILVTLDDYYPRLIDLRNMNLGITIFGKHLNSKTLCCKINPVRDNLIASSDN 208

Query: 327 DRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENI 386
           D    IWD+  +    I +               H  +IND   N N   L+++  +   
Sbjct: 209 DGMIRIWDV-RMNYRSIEE------------WKAHSRSINDMVWNDNGTKLISTGVDGK- 254

Query: 387 IQVWK 391
           IQ+W+
Sbjct: 255 IQIWR 259

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 128/298 (42%), Gaps = 41/298 (13%)

Query: 130 TRARYMPQNSNLVATINGSGKVF-LYDRSKDKHSGLVSTFEYHK-----ENGYGL----- 178
           +R ++MP +S  +AT + S +++ L D+ K++ +  +S  +Y K      NG+ L     
Sbjct: 111 SRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVN--LSLVKYGKGVGDVANGHTLGKLPP 168

Query: 179 --SFNCN--DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLN 232
             SF+ N  D   +LS S D T  +W++  SN    YV + +  H   V D K+     N
Sbjct: 169 VTSFDWNSIDTNIILSSSIDTTCTVWDLQASN----YVKTQLIAHDSEVFDAKFLTQSSN 224

Query: 233 VFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAG-TDSHVYLFDR 291
           +F S   D ++++ D R          +  P + +     SQ   +A G  D H    ++
Sbjct: 225 LFASCGGDGSVRVFDLR---CLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQ 281

Query: 292 RDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGA 351
                 L   +    A+  +E SP    IL T  +D   +I          I D    G+
Sbjct: 282 NAAETSLAVSSLESQALLRLEPSPFDPNILATIQQDSNVVI----------ILDMRYPGS 331

Query: 352 PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQ 409
           P  ++   GH  A+N    +P+ P ++A+  ++  I  W     L   GGT +  + Q
Sbjct: 332 P--ILTLNGHYCALNQLRWHPSKPNVLATCGDDCQILYWDLLDSLN--GGTISSGIPQ 385

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 102/248 (41%), Gaps = 47/248 (18%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKE-NGYGLS--------- 179
           TR +++P+    +AT + S +++    S  +   L S  +Y K+ NG   S         
Sbjct: 112 TRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNL-SLCKYSKQSNGSTASAALGSLPPV 170

Query: 180 ----FNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNV 233
               +N  D   ++S S D T  +W++ +SN    YV + +  H   V D K+      +
Sbjct: 171 TSFDWNSVDTNLIISSSIDTTCTVWDLQSSN----YVKTQLIAHDSEVYDVKFLTNSTQL 226

Query: 234 FGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAF--------------SKHSQYL--- 276
           F S   D ++++ D R     T  ++  A   +                 + H+  L   
Sbjct: 227 FASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLE 286

Query: 277 --------FAAAGTDSH-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGED 327
                    A    DS+ V + D R    P+ ++ GH  AV  M + P Q  +L+T G+D
Sbjct: 287 PSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDD 346

Query: 328 RRAIIWDI 335
            + + WDI
Sbjct: 347 CQVLYWDI 354

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 37/172 (21%)

Query: 226 WSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV-DAPFNTLAFSKHSQYLFAAAGTDS 284
           W++ D N+  S S D+T  + D +  +   +Q    D+    + F  +S  LFA+ G D 
Sbjct: 175 WNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQLIAHDSEVYDVKFLTNSTQLFASCGGDG 234

Query: 285 HVYLFDRRDISR------PLHSM--------------AGHDG----AVTNMEFSPDQDGI 320
            V +FD R ++       PL  +                 DG    A+  +E SP    +
Sbjct: 235 SVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPSPFDPNV 294

Query: 321 LMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNP 372
           + T  +D  A++          I D    G+P  ++   GH SA+N    +P
Sbjct: 295 VATFTQDSNAVL----------ILDMRYPGSP--ILTLEGHSSAVNQMRWHP 334

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 97/205 (47%), Gaps = 17/205 (8%)

Query: 146 NGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN- 204
           NG+ +++  + + D  S   + F  H  +   + FN      L SG ++G I +W++N  
Sbjct: 83  NGTLELYSTNEANDTISS-TAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKC 141

Query: 205 ----SNSSPIYVWSSVHS-DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD-----TF 254
               S  +P+    S+ S D VN   W+    +VF S    +   + D + K      ++
Sbjct: 142 TESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSY 201

Query: 255 TSQFK-VDAPFNTLAF-SKHSQYLFAAAGTDS--HVYLFDRRDISRPLHSM-AGHDGAVT 309
           TS    +    + + +  K+S  +  A G+D+   + ++D R+ + P+ ++  GH   + 
Sbjct: 202 TSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLNQGHQKGIL 261

Query: 310 NMEFSPDQDGILMTSGEDRRAIIWD 334
           ++++    + +L++SG D   ++W+
Sbjct: 262 SLDWCDQDENLLLSSGRDNTVLLWN 286

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 11/168 (6%)

Query: 233 VFGSVSEDSTLQLHDQREKDTFT--SQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
           V  + S DS+L+L      D+    +  +VD+ FN L +S H+  + A A  +  + L+ 
Sbjct: 32  VDANFSTDSSLELWSLLATDSEKPLASLQVDSKFNDLDWS-HNNEIIAGALDNGTLELYS 90

Query: 291 RRDISRPLHSMA---GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDA 347
             + +  + S A    H  +V  ++F+  QD +L + G +    IWD+      + P   
Sbjct: 91  TNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNK--CTESPSTY 148

Query: 348 EDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHK 395
               P   M        +N  + N ++  + AS+   N   +W    K
Sbjct: 149 TPLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.663
           YKL021C
          Length = 393

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 69/151 (45%), Gaps = 19/151 (12%)

Query: 243 LQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMA 302
           L L+  +E   FT  F   A   ++     +Q    +   D H+ ++D +   + L ++ 
Sbjct: 21  LSLNLDKETPLFTPIFHFQAHSLSVKCMDINQRYLVSGSNDEHIRIYDLQK-RKELGTLL 79

Query: 303 GHDGAVTNMEFSPDQDGI---LMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA 359
            H G++T ++FS  +D     L +S +D+  IIW + D               E   I  
Sbjct: 80  AHQGSITGLKFSKTEDNKSKWLFSSSDDKNIIIWRVKD--------------WENFGILK 125

Query: 360 GHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           GH + INDF ++P+   +  S  E++ I++W
Sbjct: 126 GHMNRINDFDIHPS-NRIAVSVSEDHTIRLW 155

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 18/121 (14%)

Query: 132 ARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGK---L 188
            + M  N   + + +    + +YD  K K  G   T   H+ +  GL F+  +  K   L
Sbjct: 45  VKCMDINQRYLVSGSNDEHIRIYDLQKRKELG---TLLAHQGSITGLKFSKTEDNKSKWL 101

Query: 189 LSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLN----VFGSVSEDSTLQ 244
            S SDD  I +W V +  +  I      H + +ND     FD++    +  SVSED T++
Sbjct: 102 FSSSDDKNIIIWRVKDWENFGIL---KGHMNRIND-----FDIHPSNRIAVSVSEDHTIR 153

Query: 245 L 245
           L
Sbjct: 154 L 154

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 68/139 (48%), Gaps = 5/139 (3%)

Query: 197 IALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTS 256
           I LW+VN         W     D V+  +++  + ++  S   D+++ L+D R  ++ T 
Sbjct: 198 IQLWDVNRKKPLSNLSWGV---DNVSFVRFNQNEEDILASTGSDNSIVLYDLRT-NSPTQ 253

Query: 257 QFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPD 316
           +       N L ++    + FA A  D + Y +D R++SR LH    H  AV +++FSP 
Sbjct: 254 KVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPT 313

Query: 317 QDGILMTSGEDRRAIIWDI 335
            + I+ T   D+   I+++
Sbjct: 314 GEEIV-TGSYDKTIRIFNL 331

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNV 202
           H++  Y L+ N N   KL SGS DG +  WN+
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNM 97

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 87/196 (44%), Gaps = 38/196 (19%)

Query: 175 GYGLSFNC----NDAGKLLSGSDDGTIALWNV----------NN----SNSSPIYVWSSV 216
           G+  + NC    N+   L++GS D T+ +WN+          NN     + SP  +    
Sbjct: 392 GHKATINCLQMSNNNSLLMTGSKDATVKVWNIDLGIELAKKENNQLEEKDESPCVLTFDS 451

Query: 217 HSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD---QREKDTFTSQFKVDAPFNT-LAFSKH 272
           HSD +      +FD     S S D T++ +D    +   T  + F   +  N  +  S++
Sbjct: 452 HSDEITAL---SFDGEYLISASRDKTVRQYDIISGKCFQTLATNFGSISKTNGDMLMSRN 508

Query: 273 S------QYLFAA---AGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMT 323
           S      QY   A     +D    L+D R I + + SM GH+GA+T+++F P +   L T
Sbjct: 509 SPVVGALQYYNTALITGSSDGIARLWDLR-IGKVVRSMEGHNGAITSLQFDPIK---LTT 564

Query: 324 SGEDRRAIIWDICDIG 339
           S  D    +WD+   G
Sbjct: 565 SSTDGDIRVWDLRTAG 580

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 95/217 (43%), Gaps = 21/217 (9%)

Query: 138 NSNLVATINGSGKVFLYDRSK-DKHSGLVS--TFEYHKENGYGLSFNCNDAGKLLSGSDD 194
           N  +   ++ +GK+ L+ + + D    L S   F+ H      L FN      L S  ++
Sbjct: 76  NKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNN 135

Query: 195 GTIALWNVNNSNSSPIYVWSS-----VHSDIVNDCKWSNFDLNVFGSVSEDSTL-QLHDQ 248
           G I +W++N + SS  Y  S+        D +    W+    +VF S  + +T   + D 
Sbjct: 136 GEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIWDL 195

Query: 249 REKDTFTSQFKVDAPFNTLA--------FSKHSQYLFAAAGTDSH--VYLFDRRDISRPL 298
           + K          +P   L           K + Y+  A+G+DS   + ++D R+ + P+
Sbjct: 196 KAKKEVI-HLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMPM 254

Query: 299 HSMAG-HDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
            ++ G H   + ++++    + +L++SG D    +WD
Sbjct: 255 TTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 233 VFGSVSEDSTLQL----HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYL 288
           +    S DSTL+L     D ++  T  +    DA F  L +S  ++++  A   +  + L
Sbjct: 32  IAADFSNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIEL 91

Query: 289 FDRRD----IS-RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           F + +    IS + L     H  AV  + F+P Q  +L ++G +   +IWDI
Sbjct: 92  FSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDI 143

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 72/150 (48%), Gaps = 20/150 (13%)

Query: 192 SDDGTIALWNV-NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE 250
           S+D T+ LW++ ++    P  V S        D  WS  +  + G++ ++  ++L  + E
Sbjct: 37  SNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIELFSKEE 96

Query: 251 KDTFTS-----QFKV-DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGH 304
            DT  S     +FK      NTL F+   Q + A+AG +  + ++   DI++ L S    
Sbjct: 97  NDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIW---DINKTLSS---- 149

Query: 305 DGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
                  ++SP   GI M++ ++ +++ W+
Sbjct: 150 ------TDYSPSAPGIAMSTQDEIKSVSWN 173

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 4/130 (3%)

Query: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254
             I LW+VN         W +   D +   K++  + ++  S   D+++ L+D R  ++ 
Sbjct: 199 AKIHLWDVNRLKPVSNLSWGA---DNITSVKFNQSETDILASTGSDNSIVLYDLRT-NSP 254

Query: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314
           T +       N + ++    + F  A  D + Y +D R++SR L+    H  AV +++FS
Sbjct: 255 TQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFS 314

Query: 315 PDQDGILMTS 324
           P  D I+  S
Sbjct: 315 PTGDEIVTGS 324

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 78/195 (40%), Gaps = 41/195 (21%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVN-------- 222
           H++  Y ++ N     KL +GS DG I  WN++       +V    H  ++         
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREE---FVSFKAHYGLITGLCVTQPR 122

Query: 223 ------DCKWSNFDLNVFGSVSEDSTLQL----------------HDQREKDTFTSQFKV 260
                 D K  NF L    S S+D T++L                     ++     F  
Sbjct: 123 FHDKKPDLKNQNFML----SCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDG 178

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGI 320
           ++ F  +  S      FA  G   H++  +R    +P+ +++     +T+++F+  +  I
Sbjct: 179 ESAFQGID-SHRENSTFATGGAKIHLWDVNR---LKPVSNLSWGADNITSVKFNQSETDI 234

Query: 321 LMTSGEDRRAIIWDI 335
           L ++G D   +++D+
Sbjct: 235 LASTGSDNSIVLYDL 249

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 94/204 (46%), Gaps = 27/204 (13%)

Query: 169 EYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS-SPIYVWSSVHSDIVNDCKWS 227
            Y +EN + L         L++   DG++ L +  N  + S I      H+  +ND K  
Sbjct: 9   RYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSI----QCHTTSINDMKVI 64

Query: 228 NFDLN---VFGSVSEDSTLQLHDQREKDTFTS-QFKVDAPFNTLAFSKHSQYLFAAAGT- 282
           N D +   VF + +ED  +++ D R ++   S Q    +PF    FS  S++   A GT 
Sbjct: 65  NSDFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPF----FSLDSRHNMLACGTE 119

Query: 283 ----DSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICD 337
               D+ ++++D R+ ++P+ S    H   +T+++F P    +LM+   D    I+D+  
Sbjct: 120 LKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDL-- 177

Query: 338 IGVEQIPDDAEDGAPEVLMIHAGH 361
                  DD ED   +V+   + H
Sbjct: 178 -----TQDDEEDALHQVINFASIH 196

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 102/214 (47%), Gaps = 17/214 (7%)

Query: 138 NSNLVATINGSGKVFLYDRSKDKHS-GLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGT 196
           N+ ++A    +G + LY  ++  ++   ++ F  H  +   + FN      L SG ++G 
Sbjct: 73  NNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGE 132

Query: 197 IALWNVNN-----SNSSPIYVWSSVHS-DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE 250
           I +W++N      SN +P+    S+ S D V    W+    +VF S    +   + D + 
Sbjct: 133 IFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 251 KD-----TFTS-QFKVDAPFNTLAF-SKHSQYLFAAAGTDS--HVYLFDRRDISRPLHSM 301
           K      ++TS    +    + + +  K+S  +  A G+D+   + ++D R+ + PL ++
Sbjct: 193 KKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTL 252

Query: 302 -AGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
             GH   + ++++    + +L++SG D   ++W+
Sbjct: 253 NQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 55/108 (50%), Gaps = 6/108 (5%)

Query: 233 VFGSVSEDSTLQLHDQREKDT--FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
           V  + S DS+L+L      D+    +  +VD+ FN L +S H+  + A A  +  + L+ 
Sbjct: 32  VDANFSTDSSLELWSLLAADSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYS 90

Query: 291 RRDISRPLHSMA---GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
             + +  ++SMA    H  +V  ++F+  QD +L + G +    IWD+
Sbjct: 91  TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDM 138

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 94/238 (39%), Gaps = 44/238 (18%)

Query: 138 NSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N N      G G + L+D + DK+   V+ ++ H++     +++       +S   DG +
Sbjct: 72  NENQCLVAQGDGSLRLFDTTLDKYP--VAVYQEHRDEVASCNWSLIGRNTFVSSGWDGLV 129

Query: 198 ALWNVNNSNS----------------SPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDS 241
            +W+V   NS                 P    ++   D V   K+S  D ++    S DS
Sbjct: 130 KVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDS 189

Query: 242 TLQLHDQREKDTF---TSQFKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFDRRDI-S 295
           T+ L D R        T QF   +   TL+  F+K+   + A  G D+ + ++D R + +
Sbjct: 190 TVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLRMLRT 249

Query: 296 RPL--------------------HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
            PL                      + GH+ AV  + +SP     L+++  D    IW
Sbjct: 250 GPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVNWSPHSSNYLLSTSYDMTCCIW 307

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 114/277 (41%), Gaps = 36/277 (12%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENG-YGLSFNCNDAGKLLSGSDDGTIALWNVNNS 205
           G+GK+++ D S +    +V+  +Y  ++  + L+++  +  + L    DG++ L++    
Sbjct: 36  GNGKLWILDISPEGQ--MVTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLFDTT-L 92

Query: 206 NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD--------TFTSQ 257
           +  P+ V+   H D V  C WS    N F S   D  +++      +        T ++ 
Sbjct: 93  DKYPVAVYQE-HRDEVASCNWSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNT 151

Query: 258 FKVDAPFNT-----------LAFSKHSQYLFAAAGTDSHVYLFDRRDIS---RPLHSMAG 303
             +D P  T             FS H   L      DS V LFD R       P H    
Sbjct: 152 AVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMA 211

Query: 304 HDGAVT-NMEFSPDQDGILMTSGEDRRAIIWDI-----CDIGVEQIPDDAEDGAPEVLM- 356
           H G+ T +++F+  +  ++ T G D +  IWD+       + +     +   GA +V   
Sbjct: 212 HSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCT 271

Query: 357 --IHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
             I  GH  A+   + +P+    + S+  +    +W+
Sbjct: 272 NEIVGGHELAVRKVNWSPHSSNYLLSTSYDMTCCIWQ 308

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 4/130 (3%)

Query: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254
             I LW+VN         W +   D +   K++  + ++  S   D+++ L+D R  ++ 
Sbjct: 199 AKIHLWDVNRLKPVSDLSWGA---DNITSLKFNQNETDILASTGSDNSIVLYDLRT-NSP 254

Query: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314
           T +       N + ++    + F  A  D + Y +D R++SR L+    H  AV +++FS
Sbjct: 255 TQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFS 314

Query: 315 PDQDGILMTS 324
           P  D I+  S
Sbjct: 315 PTGDEIVTGS 324

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 83/195 (42%), Gaps = 41/195 (21%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVN-------- 222
           H++  Y ++ N     KL +GS DG I  WN++       +V    H  +V         
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREE---FVSFKAHYGLVTGLCVTQPR 122

Query: 223 ------DCKWSNFDLNVFGSVSEDSTLQL----------HDQREKDTFTSQ------FKV 260
                 D K  NF L    S S+D T++L           +  + D+ T++      F  
Sbjct: 123 FHDKKPDLKSQNFML----SCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDG 178

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGI 320
           ++ F  +  S      FA  G   H++  +R    +P+  ++     +T+++F+ ++  I
Sbjct: 179 ESAFQGID-SHRENSTFATGGAKIHLWDVNR---LKPVSDLSWGADNITSLKFNQNETDI 234

Query: 321 LMTSGEDRRAIIWDI 335
           L ++G D   +++D+
Sbjct: 235 LASTGSDNSIVLYDL 249

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 8/124 (6%)

Query: 215 SVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAP-FNTLAFSKHS 273
           S HSD V+   W+N   ++  S S D  +   D R  D++ +Q +        L ++   
Sbjct: 406 SGHSDRVSCLSWNN---HILSSGSRDRKILHRDVRSPDSYFTQIETHTQEVCGLKWNIED 462

Query: 274 QYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG--EDRRAI 331
             L A+ G D+ VY++D  + S+P      H  AV  M +SP + GIL T G   DRR  
Sbjct: 463 NRL-ASGGNDNIVYVYDGVN-SKPTLMFTEHTAAVKAMTWSPHRRGILATGGGTADRRLK 520

Query: 332 IWDI 335
           IW++
Sbjct: 521 IWNV 524

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 101/236 (42%), Gaps = 24/236 (10%)

Query: 148 SGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS 207
           S K +L  R K K SG       H      + F  N     LSG +D  + +W+  +   
Sbjct: 129 SFKCYLPKRIKYKFSG-------HSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDFYHDRK 181

Query: 208 SPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTL 267
           S +  +   H+  +    + N D + F + S D T++L D  E      + K  +  N +
Sbjct: 182 S-LRDYRG-HTKAIKSMSF-NDDAHNFITSSFDQTVKLWDT-ETGQVKKRLKFKSTPNCV 237

Query: 268 AFSKHSQYLFAAAGTDSHVYLFDRRDISRP--LHSMAGHDGAVTNMEFSPDQDGILMTSG 325
            F   + + F     DS +  +D R+ S+   + +   H G++ ++ F PD     ++S 
Sbjct: 238 EFRPANNHEFIVGLADSKIAHYDTRESSKHGLVQTYDHHLGSILSLRFFPDGSK-FISSS 296

Query: 326 EDRRAIIWD-ICDIGVEQIPDDAEDGAPEVLMIHAGHR--------SAINDFSMNP 372
           ED+   IW+   +I ++QI D  +   P  + IH  H+        + I  +S+ P
Sbjct: 297 EDKTVRIWENQINIPIKQISDTTQYSMP-FIGIHPEHKYFCTQSLDNTIYSYSLRP 351

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 38/95 (40%), Gaps = 14/95 (14%)

Query: 296 RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVL 355
           R  +  +GH    T M+F P+   + ++ G D    IWD                  + L
Sbjct: 137 RIKYKFSGHSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDFYH-------------DRKSL 183

Query: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
             + GH  AI   S N +    + SS ++  +++W
Sbjct: 184 RDYRGHTKAIKSMSFNDDAHNFITSSFDQT-VKLW 217

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 134 YMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSD 193
           + P N++         K+  YD  +    GLV T+++H  +   L F   D  K +S S+
Sbjct: 239 FRPANNHEFIVGLADSKIAHYDTRESSKHGLVQTYDHHLGSILSLRF-FPDGSKFISSSE 297

Query: 194 DGTIALW 200
           D T+ +W
Sbjct: 298 DKTVRIW 304

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 80/188 (42%), Gaps = 16/188 (8%)

Query: 163 GLVSTFEYHKENG--YGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHS-- 218
            L S  + HK  G    L FN      L+SG   G I +W+ N   SS    +S+  S  
Sbjct: 93  ALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIGSSDYSPFSAGISNT 152

Query: 219 --DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF------TSQFKVDAPFNTLAFS 270
             D V+   W+    +VF S S      + D + K         +S   +  P   + + 
Sbjct: 153 PIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAKKQVLHLNHSSSTTGIKVPLTVVDWH 212

Query: 271 KHSQYLFAAAG---TDSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGE 326
             S  + A A    T+  V  +D R+   PL  ++ GH   V ++++    + +L++SG 
Sbjct: 213 PTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGHSKGVLSLDWCKQDENLLLSSGR 272

Query: 327 DRRAIIWD 334
           D  +++W+
Sbjct: 273 DNTSVLWN 280

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGI 320
           D  FN L +S   + + A A  +  V  FD + + + +  +  H G V  ++F+  Q+ +
Sbjct: 62  DGKFNDLDWSGDDK-IIAGALENGVVEFFDPKAL-KSVAKIHKHQGPVKTLKFNAKQNNV 119

Query: 321 LMTSGEDRRAIIWDICDIG 339
           L++ G      +WD   IG
Sbjct: 120 LVSGGTQGEIFVWDSNKIG 138

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 12/119 (10%)

Query: 190 SGSDDGTIAL-WNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQ 248
           S SD   + L W++ N++  P+ V S  HS  V    W   D N+  S   D+T  L + 
Sbjct: 223 SSSDTEPLVLTWDLRNAHV-PLKVLSQGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNP 281

Query: 249 REKDTFTSQFKVDAP-----FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMA 302
           +E    T QF   AP     F +  F+  +  LFA+A  DS + +   +++S  L + A
Sbjct: 282 QEGSILT-QF---APRGNWVFKS-KFAPEAPDLFASASFDSKIVVQTLQNLSNTLDAQA 335

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 82/207 (39%), Gaps = 37/207 (17%)

Query: 140 NLVATINGSGKVFLYDRSKDKH--SGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N VA    S  + +YD +K +     L++++  H        FN  D+  L+SG  DG I
Sbjct: 194 NYVAICAKSTVISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCI 253

Query: 198 ALWN-----VNNSNSSPIYVWSSVHSDIVNDCKW-SNFDLNVFGSVSEDSTLQLHDQREK 251
            +W+     +N S  S I +  +  SD + D KW   ++    GS + +           
Sbjct: 254 KIWDLRTGSLNGSTRSDINI--NTASDSIRDVKWMPGYNFASHGSATAN----------- 300

Query: 252 DTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNM 311
                          L    +S Y FA+      +  FD R  S     +  H G    +
Sbjct: 301 ---------------LRRKNNSGYKFASIHDSGLLLKFDIRQPSHAERKINAHTGPGLCL 345

Query: 312 EFSPDQDGILMTSGEDRRAIIWDICDI 338
            + P+QD I+ T G D +  +W + D+
Sbjct: 346 NWHPNQDYIV-TGGRDGKCCLWYVGDM 371

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 95/240 (39%), Gaps = 34/240 (14%)

Query: 165 VSTFEYH--KENGYGLSFNCNDAGKLLSGSDDGTIALWNV------------NNSNSSPI 210
           VS + +H  ++N   L F  N+     SG  D  I +W++            NN  SS  
Sbjct: 509 VSIYTFHNTQKNMTSLEF-SNNYKLAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTC 567

Query: 211 YVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFS 270
             +   HS  V    +S  D  +  S SED T++L   ++     S    + P   + FS
Sbjct: 568 KTFIG-HSGTVYSTSFSAGDEYLL-SASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFS 625

Query: 271 KHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRA 330
                LFA A  D    L+   D   PL  MAGH   V  + F  +   I  T   D+  
Sbjct: 626 PSCNNLFATASNDQTARLWS-CDRVYPLRVMAGHLNDVDCVSFHSNGRYIF-TGSSDKTV 683

Query: 331 IIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
            +WDI                 + + +  GH S +   S++P+  W+   S ++ II +W
Sbjct: 684 RMWDI--------------NTGDSVRLFMGHNSTVTSLSVSPDGKWISTGS-DDGIITIW 728

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 15/104 (14%)

Query: 294 ISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPE 353
           IS    +  GH G V +  FS   D  L+++ ED+   +W +            +D  P 
Sbjct: 563 ISSTCKTFIGHSGTVYSTSFSAG-DEYLLSASEDKTVRLWSV------------QDDKP- 608

Query: 354 VLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLP 397
            L+ + GH   + D   +P+   L A++  +   ++W C    P
Sbjct: 609 -LVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYP 651

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 75/167 (44%), Gaps = 19/167 (11%)

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSVSEDS 241
           D   L+S S D T  +W++ +SN    YV + +  H   V D ++      +F S   D 
Sbjct: 260 DTNLLISSSIDTTCIIWDLESSN----YVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 315

Query: 242 TLQLHDQREKDTFTSQFKVDAPFNT------------LAFSKHSQYLFAAAGTDSH-VYL 288
           ++++ D R     T  ++  A  +             L  S H   + A    DS+ + +
Sbjct: 316 SVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIII 375

Query: 289 FDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
            D R+   P+ ++ GH  ++  +++ P +  IL++  +D + + WD+
Sbjct: 376 LDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 84/173 (48%), Gaps = 14/173 (8%)

Query: 170 YHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHS-DIVNDCKWSN 228
           +H +    L+ N +    L S S D T+ LW++N+  ++      +VHS   V+  +W  
Sbjct: 269 HHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAA--RSLDAVHSATAVSSSQWHP 326

Query: 229 FDLNVFGSVSEDSTLQLHDQR-EKDTFTSQF-KV--DAPFNTLAFSKHSQYLFAAAGTDS 284
            D ++  +   DS + L D R   D   S++ KV       +  F   + +L   AGTDS
Sbjct: 327 SDGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFL---AGTDS 383

Query: 285 -HVYLFDRR--DISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IW 333
            +VY FD R  + S PL ++  HD  ++++  SP    +L+TS    + I +W
Sbjct: 384 GNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLW 436

>Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON}
           YDR142C (REAL)
          Length = 377

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 101/262 (38%), Gaps = 59/262 (22%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D +  ++   ++ F+ H+   +  ++N  +    LS S DG+I +
Sbjct: 74  NQVLVAQGDGTLRLFDTTLKEYP--IAIFKEHEREVFSCNWNLVNRQTFLSSSWDGSIKI 131

Query: 200 W-------------------------NVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVF 234
           W                         N   SN    +   S + + V   ++S  D N+ 
Sbjct: 132 WSPLRSQSLMSLTPRPLEITKMVDPLNAILSNKKKNFTGISQNKNCVYQAQFSPHDQNLV 191

Query: 235 GSVSEDSTLQLHDQREKDTFT-SQFKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFDR 291
            S S +S   L D R   + + + F V +    L   F+K+  Y+ A  G D+ + ++D 
Sbjct: 192 ISCSGNSYASLFDIRLPPSRSQTNFLVHSGLEALTCDFNKYRPYVIATGGVDNAIRIWDI 251

Query: 292 RDI--------SRPLHSMA-----------GHDGAVTNMEFSPDQDGILMTSGEDRRAII 332
           R +         RP H+ +            H  A+  + +SP    ILM++  D    +
Sbjct: 252 RMLKTSGSATTGRPTHTSSHNSACINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRV 311

Query: 333 WDICDIGVEQIPDDAEDGAPEV 354
           W           D + DGA E 
Sbjct: 312 WK----------DLSNDGAKET 323

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 74/179 (41%), Gaps = 41/179 (22%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYD------RSKDK---HSGLVS-TFEYHKENGYGLSF 180
           +A++ P + NLV + +G+    L+D      RS+     HSGL + T +++K   Y ++ 
Sbjct: 180 QAQFSPHDQNLVISCSGNSYASLFDIRLPPSRSQTNFLVHSGLEALTCDFNKYRPYVIA- 238

Query: 181 NCNDAGKLLSGSDDGTIALWNV-----------------NNSNSSPIYVWSSVHSDIVND 223
                    +G  D  I +W++                 ++ NS+ I    + H   +  
Sbjct: 239 ---------TGGVDNAIRIWDIRMLKTSGSATTGRPTHTSSHNSACINEIPNAHGLAIRK 289

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFK---VDAPFNTLA-FSKHSQYLFA 278
             WS    N+  S S D T ++      D     +K    D     L+ F++HS+++F 
Sbjct: 290 VTWSPHHSNILMSASYDMTCRVWKDLSNDGAKETYKTNSTDTGKGCLSNFTQHSEFVFG 348

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 85/182 (46%), Gaps = 25/182 (13%)

Query: 233 VFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD-R 291
           +  S   D T++  +        +    D+  N L  +   +YL AAAG   HV L+D R
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYL-AAAG-HLHVRLYDIR 61

Query: 292 RDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGA 351
            +   P+ S  GH G VT++ F   ++  +++S ED    +WD+    V++         
Sbjct: 62  SNNPNPVSSFEGHKGNVTSIAFQ-QENRWMVSSSEDGTIKVWDVRSPSVQR--------- 111

Query: 352 PEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW-----KCSHKLPRVGGTPTVS 406
                 +  H + +N+ +++PN   L++  ++ N I++W     +C+++L     TP  S
Sbjct: 112 ------NYKHNAPVNEVAIHPNQGELISCDQDGN-IRIWDLGENQCTNQLTPEDNTPLQS 164

Query: 407 VS 408
           +S
Sbjct: 165 LS 166

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 87/199 (43%), Gaps = 19/199 (9%)

Query: 147 GSGKVFLYD-RSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNS 205
           G   V LYD RS + +   VS+FE HK N   ++F   +   ++S S+DGTI +W+V   
Sbjct: 51  GHLHVRLYDIRSNNPNP--VSSFEGHKGNVTSIAFQ-QENRWMVSSSEDGTIKVWDVR-- 105

Query: 206 NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVD--AP 263
             SP    +  H+  VN+    + +     S  +D  +++ D  E +  T+Q   +   P
Sbjct: 106 --SPSVQRNYKHNAPVNEVA-IHPNQGELISCDQDGNIRIWDLGE-NQCTNQLTPEDNTP 161

Query: 264 FNTLAFSKHSQYLFAAAGTDSHVYLFD---RRDIS--RPLHSMAGHDGAVTNMEFSPDQD 318
             +L+ +     +  A     + Y++      D S   P+     H   +T +  S D  
Sbjct: 162 LQSLSVASDGS-MLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVK 220

Query: 319 GILMTSGEDRRAIIWDICD 337
             L T   D  A +W+I D
Sbjct: 221 H-LATCSADHTARVWNIED 238

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 98/231 (42%), Gaps = 39/231 (16%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D    ++   ++ F+ H++  +  ++N  +    +S S DGT+ +
Sbjct: 74  NQVLVAQGDGSLRLFDTKLAQYP--IAIFKEHQKEVFSCNWNLLNKNTFVSSSWDGTVKI 131

Query: 200 WNVNNSNS------SPIYVWSSV-------------HSDI------VNDCKWSNFDLNVF 234
           W+    +S       P+   + V             H+DI      +   ++S  D N+ 
Sbjct: 132 WSPTRKDSLLTLTPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQAQFSPHDPNLV 191

Query: 235 GSVSEDSTLQLHDQREKDTFTSQ--FKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFD 290
              S +S + + D R+  + T+Q  F   +    L   F+K+  +  A  G D+ + ++D
Sbjct: 192 MCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHTIATGGVDNVIRIWD 251

Query: 291 RRDISRPLHS--------MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
            R  S+   S        + GH+ AV  + +SP    I +++  D    +W
Sbjct: 252 LRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMTCCVW 302

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 67/169 (39%), Gaps = 29/169 (17%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYD----------RSKDKHSGLVSTFEYHKENGYGLSF 180
           +A++ P + NLV   +G+  + ++D          R+   HSGL               F
Sbjct: 180 QAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGL---------EALTCDF 230

Query: 181 NCNDAGKLLSGSDDGTIALWNV---NNSNSSPIYVWSSV---HSDIVNDCKWSNFDLNVF 234
           N      + +G  D  I +W++   + +NSSP    + V   H   V    WS    N+F
Sbjct: 231 NKYRPHTIATGGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIF 290

Query: 235 GSVSEDSTLQLHDQREKDTFTSQFKVDA----PFNTLAFSKHSQYLFAA 279
            S S D T  +          S  K ++          F++HS++++ A
Sbjct: 291 LSTSYDMTCCVWQDVSYTDRRSTGKTNSIDPNRGCRFKFTQHSEFVYGA 339

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 75/154 (48%), Gaps = 25/154 (16%)

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDG 319
           D+  N L  S   ++L AA   +  V L+D R  +  P+ S  GH G VT++ F   ++ 
Sbjct: 32  DSQVNRLEISSDKRFLAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQ-QENK 88

Query: 320 ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMA 379
            +++S ED    +WD+               AP V   +  H++A+N+  ++PN   L++
Sbjct: 89  WMVSSSEDGTIKVWDV--------------RAPSVQRNYK-HQAAVNEVVIHPNQGELIS 133

Query: 380 SSEEENIIQVW-----KCSHKLPRVGGTPTVSVS 408
             ++ N +++W     +C H+L     TP  S+S
Sbjct: 134 CDQDGN-VRIWDLGENQCVHQLAPEDDTPLQSLS 166

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNV 202
           G   V LYD  +  +   V++FE H+ N   ++F   +   ++S S+DGTI +W+V
Sbjct: 51  GHLNVRLYD-IRTTNPNPVTSFEGHRGNVTSIAFQ-QENKWMVSSSEDGTIKVWDV 104

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 81/174 (46%), Gaps = 9/174 (5%)

Query: 162 SGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIV 221
           +GL+ TF Y +    G+  +  +   +  G+    I LW++N         W     D +
Sbjct: 166 NGLIKTF-YGEHAFQGIDHHKENTSFVTGGAQ---IELWDINRRKPLSNLSWGI---DNI 218

Query: 222 NDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAG 281
              K++  + ++  S   D+++ L+D R  ++ T +       N++ ++    + F  A 
Sbjct: 219 TAVKFNQNEADLLLSSGSDNSVVLYDLRT-NSPTQKIVQTMKTNSMCWNPMEPFNFVTAN 277

Query: 282 TDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
            D + Y +D R++SR LH    H  A+ +++ SP  + I+ T   D+   I++I
Sbjct: 278 EDQNAYYYDMRNMSRALHVFKDHVSAIMDVDISPTGEEIV-TGSYDKTIRIFNI 330

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 79/189 (41%), Gaps = 33/189 (17%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN------------------------SN 206
           H++  Y ++ N N   +L S S DG +  WN++                          N
Sbjct: 66  HRDGCYVIAKNYNVLNRLASASADGVVKYWNISTREELCSFKAHYGLVTGLCVSPQHIGN 125

Query: 207 SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNT 266
            S  Y+ S     +V    WS  D   F +V +D+ + LH   + +     F  +  F  
Sbjct: 126 QSDSYMLSCGDDKMVK--MWS-VDSGDFNNVKDDTKV-LHPS-DGNGLIKTFYGEHAFQG 180

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGE 326
           +   K +   F   G    ++  +RR   +PL +++     +T ++F+ ++  +L++SG 
Sbjct: 181 IDHHKENTS-FVTGGAQIELWDINRR---KPLSNLSWGIDNITAVKFNQNEADLLLSSGS 236

Query: 327 DRRAIIWDI 335
           D   +++D+
Sbjct: 237 DNSVVLYDL 245

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 4/130 (3%)

Query: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254
             I LW+VN         W +   D +   +++  + ++  S   D+++ L+D R  ++ 
Sbjct: 199 AKIHLWDVNRLKPISNLSWGA---DNITSVRFNQNETDILASTGSDNSIVLYDLRT-NSP 254

Query: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314
           T +       N + ++    + F  A  D + Y +D R++SR L     H  AV +++FS
Sbjct: 255 TQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDFS 314

Query: 315 PDQDGILMTS 324
           P  D I+  S
Sbjct: 315 PTGDEIVTGS 324

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 81/193 (41%), Gaps = 37/193 (19%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIV--------- 221
           H++  Y ++ N     KL +GS DG I  WN++       +V    H  ++         
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNMSTREE---FVSFKAHYGLITGLCVTQPH 122

Query: 222 -NDCK--WSNFDLNVFGSVSEDSTLQL--------HDQREKDT--------FTSQFKVDA 262
            +D K  W N   N   S S+D T++L         ++R  D             F  ++
Sbjct: 123 FHDKKSDWKN--QNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGES 180

Query: 263 PFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILM 322
            F  +  S      FA  G   H++  +R    +P+ +++     +T++ F+ ++  IL 
Sbjct: 181 AFQGID-SHRENSTFATGGAKIHLWDVNR---LKPISNLSWGADNITSVRFNQNETDILA 236

Query: 323 TSGEDRRAIIWDI 335
           ++G D   +++D+
Sbjct: 237 STGSDNSIVLYDL 249

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 96/238 (40%), Gaps = 42/238 (17%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D +  ++   ++ F+ H+   +  ++N       +S S DGT+ +
Sbjct: 74  NQVLAAQGDGSLRLFDITLQQYP--IALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKV 131

Query: 200 WNVNNSNSS----PIYVWSSV----------------HSDIVN--DC----KWSNFDLNV 233
           W      S     P     SV                H D  +  DC    ++S  D N+
Sbjct: 132 WTPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPNL 191

Query: 234 FGSVSEDSTLQLHDQREKDTFTSQ-FKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFD 290
             S S +S + L D R+      Q F   +    L+  F+K+  ++ A  G D  V ++D
Sbjct: 192 VMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIATGGVDKMVKVWD 251

Query: 291 RRDISRPLHS----------MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW-DICD 337
            R + + L +          M GH  AV  + +SP    IL+++  D     W D+ D
Sbjct: 252 LRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAWHDLAD 309

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 66/165 (40%), Gaps = 19/165 (11%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLS 190
           +A++ P + NLV + +G+  V L+D  +   S       +         FN      + +
Sbjct: 181 QAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIAT 240

Query: 191 GSDDGTIALWN-------VNNSNSSPIYV-WSSVHSDIVNDCKWSNFDLNVFGSVSEDST 242
           G  D  + +W+       +  S ++P+ +     HS  V    WS    N+  S S D T
Sbjct: 241 GGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMT 300

Query: 243 LQL-HD-------QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAA 279
            +  HD       Q    T  S  +    +    FSKHS+++F A
Sbjct: 301 CRAWHDLADGPGGQHSGRTNNSDPQRGCSY---VFSKHSEFVFGA 342

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 88/198 (44%), Gaps = 17/198 (8%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSN 206
           G   V LYD +   +   V++FE H+ N   LSF  ND   +++ S+DGTI +W+V    
Sbjct: 51  GHQNVKLYDINT-TNPNPVASFEGHRGNVTSLSFQ-NDNRWMVTSSEDGTIKVWDVR--- 105

Query: 207 SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV--DAPF 264
            SP    +  H+  VN+    + +     S   D  +++ D  E    T Q     D P 
Sbjct: 106 -SPSVPRTYKHNAPVNEVA-IHPNQGELISCDRDGNIRIWDLGENQC-THQLTPEDDTPV 162

Query: 265 NTLAFSKHSQYLFAAAGTDSHVYLFD---RRDIS--RPLHSMAGHDGAVTNMEFSPDQDG 319
            +L+ +     L  AA +  + Y+++   R D S  +P+     HD  +T +  S D   
Sbjct: 163 QSLSLATDGSML-VAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVK- 220

Query: 320 ILMTSGEDRRAIIWDICD 337
            L T   D  A IW I D
Sbjct: 221 FLATCSADHTARIWSIDD 238

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 73/173 (42%), Gaps = 5/173 (2%)

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV-DAPFNTLAFSKHSQYLFAA 279
           V    W+  D N+  S S D+T  + D +  +   +Q    D+    + F   S  LFA+
Sbjct: 283 VTSFDWNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQLFAS 342

Query: 280 AGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMT--SGEDRRAIIWDICD 337
            G D  V +FD R ++            V+N + S  Q+ +L    S  D   I   + +
Sbjct: 343 CGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSE 402

Query: 338 IGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
                I D     +P  +++  GH+SAIN    +P   +++ S  ++  +  W
Sbjct: 403 SNKILILDMRNSESP--VLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYW 453

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 86/194 (44%), Gaps = 28/194 (14%)

Query: 180 FNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSV 237
           +N  D   L+S S D T  +W++ +SN    YV + +  H   V D ++      +F S 
Sbjct: 288 WNQTDTNLLISSSIDTTCIVWDLQSSN----YVKTQLIAHDSEVYDVRFLTKSTQLFASC 343

Query: 238 SEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFA-----AAGTDSHV------ 286
             D ++++ D R      S    + P N ++ +  SQ   A      + TD++V      
Sbjct: 344 GGDGSVRVFDLRS--LAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVS 401

Query: 287 -----YLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDI--- 338
                 + D R+   P+  + GH  A+  +++ P +  IL++  +D + + WD+      
Sbjct: 402 ESNKILILDMRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNSTFSG 461

Query: 339 -GVEQIPDDAEDGA 351
             V    ++AE+G+
Sbjct: 462 NTVASPSNNAENGS 475

>ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 455

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 90/220 (40%), Gaps = 19/220 (8%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPI-YVWSSVHSDIVND 223
           + +F  H      L F        LSG +D  + +W+  +       Y+  S     VN 
Sbjct: 155 IHSFTGHTRGTSALQFLPKTGHLFLSGGNDNILKIWDFYHERICLRDYIGHSKPIKTVN- 213

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTD 283
               N D N F S S D  ++L D  E     S+++ +A  N L +       F    ++
Sbjct: 214 ---FNEDGNSFLSASFDQNVKLWDT-ETGQVKSRYRYNATPNDLKYRPGHLNEFVVGLSN 269

Query: 284 SHVYLFDRRDISRP--LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-ICDIGV 340
           S +  +D R  +    +     H  ++ ++EF PD    L++S ED+   IW+   +I +
Sbjct: 270 SKINHYDDRVAANQGLVQVYDHHLSSILSLEFFPDGSK-LISSSEDKTVRIWENQVNIPI 328

Query: 341 EQIPDDAEDGAPEVLMIHAGHR--------SAINDFSMNP 372
           +QI D A+   P  L +H  H         + I  F M P
Sbjct: 329 KQISDTAQHSMP-FLRVHPEHHYFCAQSMDNVIYSFGMKP 367

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 19/108 (17%)

Query: 283 DSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQ 342
           D   YL  RR     +HS  GH    + ++F P    + ++ G D    IWD      E+
Sbjct: 145 DFKCYLPKRR-----IHSFTGHTRGTSALQFLPKTGHLFLSGGNDNILKIWDFYH---ER 196

Query: 343 IPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           I           L  + GH   I   + N +    +++S ++N +++W
Sbjct: 197 I----------CLRDYIGHSKPIKTVNFNEDGNSFLSASFDQN-VKLW 233

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 133 RYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGS 192
           +Y P + N       + K+  YD     + GLV  +++H  +   L F   D  KL+S S
Sbjct: 254 KYRPGHLNEFVVGLSNSKINHYDDRVAANQGLVQVYDHHLSSILSLEF-FPDGSKLISSS 312

Query: 193 DDGTIALW 200
           +D T+ +W
Sbjct: 313 EDKTVRIW 320

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 74/154 (48%), Gaps = 25/154 (16%)

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS-RPLHSMAGHDGAVTNMEFSPDQDG 319
           D+  N L  +   ++L AA   +  V L+D R  +  P+ S  GH G VT++ F   ++ 
Sbjct: 32  DSQVNRLEITSDKRFLAAAGHLN--VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQ-QENK 88

Query: 320 ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMA 379
            +++S ED    +WD+               AP V   +  H +A+N+  ++PN   L++
Sbjct: 89  WMVSSSEDGTIKVWDV--------------RAPSVQRNYK-HHAAVNEVVIHPNQGELIS 133

Query: 380 SSEEENIIQVW-----KCSHKLPRVGGTPTVSVS 408
             ++ N I++W     +C H+L     TP  S+S
Sbjct: 134 CDQDGN-IKIWDLGENQCVHQLAPEDDTPLQSLS 166

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 15/197 (7%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSN 206
           G   V LYD  +  +   V++FE H+ N   ++F   +   ++S S+DGTI +W+V   +
Sbjct: 51  GHLNVRLYD-IRTTNPNPVTSFEGHRGNVTSIAFQ-QENKWMVSSSEDGTIKVWDVRAPS 108

Query: 207 SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQF-KVDAPFN 265
               Y   +  +++V      + +     S  +D  +++ D  E         + D P  
Sbjct: 109 VQRNYKHHAAVNEVV-----IHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDTPLQ 163

Query: 266 TLAFSKHSQYLFAAAGTDSHVYLFD---RRDIS--RPLHSMAGHDGAVTNMEFSPDQDGI 320
           +L+ +     +  A     + Y++    + D +  RP+     H   +T +  S D    
Sbjct: 164 SLSVASDGS-MLVAGNNKGNCYVWQMPHQTDAANPRPVTKFRSHAKYITRVLLSSDVKH- 221

Query: 321 LMTSGEDRRAIIWDICD 337
           L T   D  A +W I D
Sbjct: 222 LATCSADHTARVWSIDD 238

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 107/266 (40%), Gaps = 33/266 (12%)

Query: 141 LVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALW 200
           ++A    SG V L+  + D      + F+ H+     + FN      L SG   G I +W
Sbjct: 76  IIAGALDSGVVELFSSTGDSLKS-EARFQQHQGAAKTVKFNSKQNNVLASGGSKGEIYIW 134

Query: 201 NVNN--SNS---SPIYVW-SSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254
           ++N    NS   +P+    +S   + V    W+    +VF S    S   + D + K   
Sbjct: 135 DLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKAKKEV 194

Query: 255 TSQFKVDAPFNTLA--------FSKHSQYLFAAAGTDSH--VYLFDRRDISRPLHSMA-G 303
                  +P   L           K+S  +  A G+D+   + ++D R+ + PL  ++ G
Sbjct: 195 I-HLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVLSKG 253

Query: 304 HDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRS 363
           H   + ++++    + +L++SG D   ++W            + E G         G+  
Sbjct: 254 HSKGILSLDWCSQDEELLLSSGRDNTIVLW------------NPESGQELTQFPTRGNWC 301

Query: 364 AINDFSMNPNIPWLMASSEEENIIQV 389
               F+  P  P L AS+  +N IQV
Sbjct: 302 FKTKFA--PEAPDLFASASFDNKIQV 325

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 2/81 (2%)

Query: 256 SQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRR-DISRPLHSMAGHDGAVTNMEFS 314
           +   VDA FN L +S   + + A A     V LF    D  +       H GA   ++F+
Sbjct: 57  ASLAVDAKFNDLDWSNDDK-IIAGALDSGVVELFSSTGDSLKSEARFQQHQGAAKTVKFN 115

Query: 315 PDQDGILMTSGEDRRAIIWDI 335
             Q+ +L + G      IWD+
Sbjct: 116 SKQNNVLASGGSKGEIYIWDL 136

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
           YOL138C
          Length = 1365

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 81/207 (39%), Gaps = 34/207 (16%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSG----LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDG 195
           N  A    S  + ++D  K   S     +V++F  H  +  G  FN      ++SG  D 
Sbjct: 236 NYAAICTNSTTISIFDIVKPPSSSEFNPVVTSFNGHTRSVNGFDFNMIQTNLIISGGQDA 295

Query: 196 TIALWNV-----NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE 250
            + +W++      +S+ S I + +S   D + D KW     N+  + S+ S+        
Sbjct: 296 CVKIWDIRTNTRKDSSRSDINITTSY--DSIRDIKWMPGS-NILANNSDPSS-------- 344

Query: 251 KDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTN 310
                        + +     HS Y FA+      V  FD R  ++    +  H G    
Sbjct: 345 -------------YGSYGVRSHSGYKFASIHDSGTVLKFDLRQPNQFEKKINAHTGPGLC 391

Query: 311 MEFSPDQDGILMTSGEDRRAIIWDICD 337
           + + P+QD I  T G D +  +W + D
Sbjct: 392 LNWHPNQDYI-ATGGRDGKCCLWYVGD 417

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 215 SVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQ 274
           S H D V    W+N   +V  S S D  +   D R  + F  Q    +          ++
Sbjct: 357 SGHVDRVACLSWNN---HVLSSGSRDRKILHRDVRAPEPFFEQIDTHSQEVCGLKWNVNE 413

Query: 275 YLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG--EDRRAII 332
              A+ G D+ VY++D   + +P+ SM  H  AV  M +SP   G+L T G   D++  I
Sbjct: 414 NKLASGGNDNMVYVYDG-TLRQPMLSMEEHTAAVKAMAWSPHTRGVLATGGGTADKKLKI 472

Query: 333 WDI 335
           W+I
Sbjct: 473 WNI 475

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 100/238 (42%), Gaps = 40/238 (16%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D   + +   V+ F+ H++  +  ++N  +    +S S DGT+ +
Sbjct: 74  NHVLVAQGDGSLRLFDIQLNDYP--VAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVKV 131

Query: 200 WNVNNSNS------SPIYVWSSVHS-------------------DIVNDCKWSNFDLNVF 234
           W     +S       P+   +S  S                   + +   ++S  D N+ 
Sbjct: 132 WTPMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIV 191

Query: 235 GSVSEDSTLQLHDQRE-KDTFTSQFKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFDR 291
            S + +S + + D R+  +     F       TL   F+K+  ++ A  G D+ V ++D 
Sbjct: 192 MSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDL 251

Query: 292 RDISR---------PLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW-DICDIG 339
           R + +          ++ + GHD A+  + +SP    +L+++  D    +W D+ D G
Sbjct: 252 RMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDG 309

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 4/139 (2%)

Query: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR--EKDTFTS 256
           +WN+  ++S  I      HS  + D  ++  + ++  + S D+ +   D R   +  +T+
Sbjct: 98  IWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTT 157

Query: 257 QFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPD 316
                         K S  L +A   D  +Y++D R  S PLH + GHD +V +++F+  
Sbjct: 158 SAWRSGASQVKWNYKDSNILASAHSND--IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRF 215

Query: 317 QDGILMTSGEDRRAIIWDI 335
           +   +M+S  D     WDI
Sbjct: 216 KSSEIMSSSNDGTVKFWDI 234

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 96/238 (40%), Gaps = 22/238 (9%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189
           T   + P+N +++AT +    V  +D  +  H    +T  + +     + +N  D+  +L
Sbjct: 121 TDINFNPENPDILATCSVDTYVHAWDM-RSPHRPFYTTSAW-RSGASQVKWNYKDSN-IL 177

Query: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD-Q 248
           + +    I +W++    S+P++     H   VN   ++ F  +   S S D T++  D  
Sbjct: 178 ASAHSNDIYIWDLR-MGSTPLHKLVG-HDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDIS 235

Query: 249 REKDTFTSQFKVDAPF---NTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS---------- 295
           +  D  TS    D P      L F  +   +    G  + VYL   ++            
Sbjct: 236 KGSDNCTSTVSTDFPIWRGRYLPFG-NGFCIMPQEGGGNAVYLSTLKEQENLNESNKLTK 294

Query: 296 -RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQIPDDAEDGA 351
            +P++S  GH   V +  +   Q   LM +  + + + W   CD+ +  I D+  D  
Sbjct: 295 LQPIYSFKGHSERVIDFLWRSRQPSDLMVNDCEFQLVTWSKDCDLRLWPITDNIYDSV 352

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 15/135 (11%)

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRD-ISRPLHSMAGHDGAVTNMEFSPD 316
            KVD  FN ++ +   + +  A+   + +Y+ D  D  S P          V ++++SP 
Sbjct: 24  LKVDGGFNAVSINPSGRDVVLAS--RNGLYIIDLDDPFSPPRWLQHITPWQVADVQWSPH 81

Query: 317 -QDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIP 375
                 + S  +++A+IW++      +   DA D      ++H GH  AI D + NP  P
Sbjct: 82  PAKPYWVVSTSNQKALIWNLA-----RTSSDAIDH-----VLH-GHSRAITDINFNPENP 130

Query: 376 WLMASSEEENIIQVW 390
            ++A+   +  +  W
Sbjct: 131 DILATCSVDTYVHAW 145

>Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 102/250 (40%), Gaps = 49/250 (19%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D S  ++   ++ F+ H+   +  ++N  +    LS S DG+I +
Sbjct: 74  NQVLVAQGDGTLRLFDTSLKEYP--IAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKI 131

Query: 200 WNVNNSNS------SPIYVWSSV------------------HSDIVNDCKWSNFDLNVFG 235
           W+     S       P+ +   V                  + + V   ++S  D N+  
Sbjct: 132 WSPLRKQSLMSLTPRPLEITKMVDPLNAILLNKKKFAGISKNRNCVYQAQFSPHDQNLII 191

Query: 236 SVSEDSTLQLHDQREKDTFT-SQFKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFDRR 292
           S S +S   L D R   + + S F V +    L   F+K+  Y+ A  G D+ + ++D R
Sbjct: 192 SCSGNSYASLFDIRLPPSKSQSNFLVHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIR 251

Query: 293 --------DISRPLHSMA-----------GHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
                    I R  H+ +            H+ AV  + +SP    ILM++  D    IW
Sbjct: 252 MLNAIGSTAIDRTTHNKSHNSACINEIPNAHELAVRKVAWSPHHSNILMSASYDMTCRIW 311

Query: 334 -DICDIGVEQ 342
            D+ + G ++
Sbjct: 312 KDLSNDGTKE 321

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 80/205 (39%), Gaps = 38/205 (18%)

Query: 140 NLVATINGSGKVFLYD--RSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N +A    S  V +YD  R+  K S L++T   H  +   + FN      L+SG  DG I
Sbjct: 197 NYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 198 ALWNVNNS----NSSPIYVWSSVHSDIVNDCKW-SNFDLNVFGSVSEDSTLQLHDQREKD 252
            +W++ +     N S +   S   SD V D KW   +D   F S+  D++L    +  K 
Sbjct: 257 KVWDLRSHSYKVNRSDLNFNSG--SDSVRDVKWMPTYD---FASLGADTSLCSSGRSNK- 310

Query: 253 TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNME 312
                                   FA+      +  FD R  ++    +  H G    M 
Sbjct: 311 ------------------------FASVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMH 346

Query: 313 FSPDQDGILMTSGEDRRAIIWDICD 337
           + P  D I+ + G D +  +W + D
Sbjct: 347 WHPHMDYII-SGGRDGKCALWYVGD 370

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 73/168 (43%), Gaps = 5/168 (2%)

Query: 170 YHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNF 229
           +H +    L+ N      L S S D T+ LW++N S ++   +    H   V+  +W   
Sbjct: 291 HHTDAVLSLAHNQLFRAILASTSADSTVKLWDLN-SGTAARSLNQVHHGSRVSSSQWHQT 349

Query: 230 DLNVFGSVSEDSTLQLHDQREKD--TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY 287
           D ++  +   DS + L D R  D    +  + V +       S  + Y   A   + +VY
Sbjct: 350 DGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETASFINDYTVLAGTDNGNVY 409

Query: 288 LFDRRDI-SRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IW 333
            FD R + S+PL ++  HD  +  +    +  G+L+T     + I +W
Sbjct: 410 SFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 99/261 (37%), Gaps = 37/261 (14%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D S  K    ++ F+ H +     ++N  +    +S S DGT+ +
Sbjct: 75  NQVLVAQGDGSLRLFDTSLQKFP--IAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVKI 132

Query: 200 WNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFK 259
           W  N   S                             V      QL D     T  S+  
Sbjct: 133 WTPNRKESLRTL------------------------QVQPVMQSQLVDNTIAKTNGSRGT 168

Query: 260 VDAPFNTL---AFSKHSQYLFAAAGTDSHVYLFDRR--DISRPLHSMAGHDGAVT-NMEF 313
           + A  N +    FS H + L      +S+V LFD R  + +        H+G+ T   +F
Sbjct: 169 ISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDF 228

Query: 314 SPDQDGILMTSGEDRRAIIWDI---CDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSM 370
           +  +  ++ TSG D    IWDI    ++G +         A  +  I   H  A+   + 
Sbjct: 229 NKYRPTVVATSGVDSSIRIWDIRMLVNLGPQS--QHINSSAACINEITRAHELAVRKVAW 286

Query: 371 NPNIPWLMASSEEENIIQVWK 391
           +P+ P ++ S+  +    VW+
Sbjct: 287 SPHHPNVLLSASYDMTCSVWQ 307

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 64/166 (38%), Gaps = 17/166 (10%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHK-ENGYGLSFNCNDAGKLL 189
           +A++ P + NLV   +G+  V L+D  +   +     F  H         FN      + 
Sbjct: 178 QAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVA 237

Query: 190 SGSDDGTIALWNVN------------NSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSV 237
           +   D +I +W++             NS+++ I   +  H   V    WS    NV  S 
Sbjct: 238 TSGVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLLSA 297

Query: 238 SEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSK----HSQYLFAA 279
           S D T  +      D      K ++  ++  F K    HS+++F A
Sbjct: 298 SYDMTCSVWQDLSYDGSRFTMKTNSIDSSKGFIKRFTGHSEFVFGA 343

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 80/184 (43%), Gaps = 21/184 (11%)

Query: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249
           +GS+D TI +WN+    S  + V    H   V D   SN    +F SVSED T++  D  
Sbjct: 133 TGSNDKTIKIWNL---ASGKLKVTLKAHDMTVRDLAISNRHPYMF-SVSEDKTVKCWDL- 187

Query: 250 EKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVT 309
           EK+T    +              +  +   AG DS V ++D R    P+ ++ GH G +T
Sbjct: 188 EKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIR-TRLPVMTLPGHKGPIT 246

Query: 310 NMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFS 369
            +   P  D  +++S  D    +WD+               A + + +   H+  + D S
Sbjct: 247 KVRCLP-VDPQVISSSVDASIRLWDLV--------------AGKSMKVLTHHQRTVRDIS 291

Query: 370 MNPN 373
           ++P+
Sbjct: 292 VHPS 295

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 83/207 (40%), Gaps = 49/207 (23%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKW---- 226
           H E    ++F+ ND+ K +S SDD  + +WN  N       V +  H D V  C W    
Sbjct: 165 HTECIRDVAFSANDS-KFVSCSDDNILKIWNFTNGQQE--RVLTGHHWD-VKSCDWHPTM 220

Query: 227 ------SNFDL--------------------------------NVFGSVSEDSTLQLHDQ 248
                 S  +L                                N+   +S+D + ++ D 
Sbjct: 221 GLIASASKDNLVKLWDPRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDI 280

Query: 249 REKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD-RRDISRPLHSMA-GHDG 306
           R+  T    F+ D  + TL +   +   F     D  +  FD  +DI++P+H +   HD 
Sbjct: 281 RQNMTELMVFRDDVDYMTLLWHPINHSTFTVGNYDGSIKHFDVLQDITKPVHVIPFAHDK 340

Query: 307 AVTNMEFSPDQDGILMTSGEDRRAIIW 333
            VT++ ++P  + IL ++ +DR    W
Sbjct: 341 CVTSLSYNPAGN-ILASASKDRTIRFW 366

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 88/213 (41%), Gaps = 31/213 (14%)

Query: 133 RYMPQNSNL-VATING-----SGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAG 186
           R+ P+   L VAT NG     +G  F ++     H   ++T +Y     +          
Sbjct: 89  RWTPEGRRLIVATYNGEFSLWNGTSFNFESLMQAHDSSITTMQYSHMGDW---------- 138

Query: 187 KLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL- 245
            L+SG  DG I +W  N +    +      H++ + D  +S  D + F S S+D+ L++ 
Sbjct: 139 -LISGDADGGIKIWQPNFNMVKEL---DGAHTECIRDVAFSAND-SKFVSCSDDNILKIW 193

Query: 246 ---HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMA 302
              + Q+E+      + V +          +  L A+A  D+ V L+D R     + ++ 
Sbjct: 194 NFTNGQQERVLTGHHWDVKS-----CDWHPTMGLIASASKDNLVKLWDPR-TGNCVSTIL 247

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
                V    F P    +L+   +D+   ++DI
Sbjct: 248 KFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDI 280

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 79/193 (40%), Gaps = 38/193 (19%)

Query: 174 NGYGLSFNCNDAG----KLLSGSDDGTIALWN--------------VNNSNSSPIYVWSS 215
           NG+  +  C  +      L++GS D TI LWN              + NSN S I+ +SS
Sbjct: 443 NGHMATITCMQSSPHYSMLITGSKDATIKLWNLKLASQLYLEENADIGNSNQSCIHTFSS 502

Query: 216 -------VHSDIVN------DCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDA 262
                  +  D +N      D     +DL + G   +   L     R  D +++Q   + 
Sbjct: 503 HLDELTAISYDTINLVSGSQDKTIRQWDL-LSGKCVQTIDLSFIKSRNNDFYSNQLLGEK 561

Query: 263 PFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILM 322
           P   +   +      A    D  V L+D R    P+ ++ GH  AVT ++F       ++
Sbjct: 562 PL--VGAIQCFDAALATGTKDGIVRLWDLRS-GVPVRTLEGHTDAVTALKFDSSS---IV 615

Query: 323 TSGEDRRAIIWDI 335
           T+  D++  IWD+
Sbjct: 616 TASSDKQVRIWDL 628

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 92/211 (43%), Gaps = 33/211 (15%)

Query: 186 GKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL 245
           G L SGS D T+ +W++N++            S + N   W N       S+S D  L++
Sbjct: 292 GLLYSGSHDKTVRVWDMNSATVGKCI------SILKNHAHWVNHL-----SLSTDYALRI 340

Query: 246 ----HDQREKDT-FTSQFKVDAPFNTLAFSKHS-QYLFAAAGTDSHVYLFDRRDISRPLH 299
               H   +  T   ++ +  A ++ +A    S + L   A  D  ++L++ + +++PL 
Sbjct: 341 GPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLA 400

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA 359
            M GH   V ++ FSPD   I+  S  D    +W            D  DG  + L    
Sbjct: 401 RMTGHQKLVNHVAFSPDGRYIVSAS-FDNSIKLW------------DGRDG--KFLSTFR 445

Query: 360 GHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           GH +++   + + +   L+ S  ++  ++VW
Sbjct: 446 GHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 475

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 288 LFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDA 347
           +F  + ++R   ++AGH   +    F+PD    ++T   D  A IWD CD    Q P   
Sbjct: 122 IFKVKPVTRSASAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWD-CDT---QTP--- 174

Query: 348 EDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGG 401
                  L    GH + +   S +P+   ++A+   ++ I++W+ +   P  GG
Sbjct: 175 -------LATLEGHSNWVLCVSWSPDGE-VIATGSMDSTIRLWESTKGKPVGGG 220

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 88/201 (43%), Gaps = 9/201 (4%)

Query: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVND 223
           +++ ++ H+     L F        LSG +D  + +W++ +     +      H   + D
Sbjct: 170 IINVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHDRR--LLRDFCGHQKPIRD 227

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTD 283
             ++  D   F SVS D  L++ D  EK     + K+ +  N + F   + Y       +
Sbjct: 228 FNFTT-DSKQFTSVSYDKFLKIWDT-EKGAIIHRTKLTSVPNCVTFHPINNYELVVGLLN 285

Query: 284 SHVYLFDRRDISRP--LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-ICDIGV 340
           S +  +D RD  +   + +   H  ++  ++F P+     ++S ED+   IWD   +I +
Sbjct: 286 SEIKHYDTRDNYKNGLIQTYDHHTSSIIALKFFPNGSK-FISSSEDKTIRIWDNQINIPI 344

Query: 341 EQIPDDAEDGAPEVLMIHAGH 361
           +QI D A+   P +  IH  H
Sbjct: 345 KQISDTAQHSMPWI-EIHPEH 364

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 36/88 (40%), Gaps = 14/88 (15%)

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHR 362
           GH+   T ++F P    + ++ G D +  IWD+                  +L    GH+
Sbjct: 176 GHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYH-------------DRRLLRDFCGHQ 222

Query: 363 SAINDFSMNPNIPWLMASSEEENIIQVW 390
             I DF+   +     + S ++  +++W
Sbjct: 223 KPIRDFNFTTDSKQFTSVSYDK-FLKIW 249

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 154 YDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWN 201
           YD   +  +GL+ T+++H  +   L F  N   K +S S+D TI +W+
Sbjct: 291 YDTRDNYKNGLIQTYDHHTSSIIALKFFPN-GSKFISSSEDKTIRIWD 337

>Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON}
           (100800..102569) [1770 nt, 590 aa]
          Length = 589

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 215 SVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQ 274
           S H+D V+   W+N   N+  S S D  +   D R  D F +Q +              +
Sbjct: 364 SGHTDRVSCLSWNN---NILSSGSRDRRILHRDVRIADPFFAQIETHTQEVCGLKWNVEE 420

Query: 275 YLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG--EDRRAII 332
              A+ G D+ V ++D   ++ P  +   H  AV  + +SP + GIL T G   DRR  I
Sbjct: 421 NKLASGGNDNIVCVYDGTSVT-PTLTFREHTAAVKAIGWSPHKRGILATGGGTADRRLKI 479

Query: 333 WDI 335
           W++
Sbjct: 480 WNV 482

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 103/215 (47%), Gaps = 26/215 (12%)

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYH------KENGY-----GLSFNCN 183
           M QN+    +IN +G+   +  S     G +  +E+       K+ G+     GL+++  
Sbjct: 293 MGQNAVNTVSINNTGEWLAFGSSA---LGQLLVYEWQSESYILKQQGHFDSLNGLTYSP- 348

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243
           D  ++++ ++DG I +W+V +      +   S H+  V   +++     +F S S D T+
Sbjct: 349 DGARVVTAANDGKIKVWDVVSGFCLATF---SEHTSSVTAVQFAKRGQVLFSS-SLDGTV 404

Query: 244 QLHDQ---REKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300
           +  D    R   TFTS  ++  PFN LA     + + A +     ++++  +   + L S
Sbjct: 405 RAWDLIRFRNFRTFTSTQRI--PFNCLAVDPSGEVVCAGSSDSFEIHVWSVQ-TGQLLDS 461

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           + GH+G V+ + FS  ++ +L ++  D+   IW I
Sbjct: 462 LDGHEGPVSCLAFS-QENSVLASASWDKTIRIWSI 495

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 87/218 (39%), Gaps = 37/218 (16%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDC 224
           +  FE H +    LSF   D+  L+SGS D  I  W++  +    +   + + +   ND 
Sbjct: 420 IHNFELHNDEITALSF---DSEALISGSKDKKIFHWDL--ATGKCVQELNLIFTPTHNDT 474

Query: 225 KWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDS 284
           K S                     R     T     +AP   +   +      A    D 
Sbjct: 475 KTST--------------------RSGKNGTYLLGTEAPM--IGALQCYNSALATGTKDG 512

Query: 285 HVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-----ICDIG 339
            V L+D R I +P+ S+ GH   +T+++F  ++   L+T   D    IWD     I D+ 
Sbjct: 513 VVRLWDLR-IGKPVRSLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRTSSIVDVI 568

Query: 340 VEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377
              +P  + D   +++ + A  R  +N F+M  +  W+
Sbjct: 569 AYDLPVTSLDFDDKLITVGANER-GVNIFNMERDEHWM 605

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 73/154 (47%), Gaps = 25/154 (16%)

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFD-RRDISRPLHSMAGHDGAVTNMEFSPDQDG 319
           D+  N L  +   + L AAAG   ++ L+D +   S P+ S  GH G VT++ F  D + 
Sbjct: 32  DSQVNRLEITN-DKKLLAAAG-HQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQD-NK 88

Query: 320 ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMA 379
            ++TS ED    +W   DI    +P + +  AP            +N+  ++PN   L++
Sbjct: 89  WMVTSSEDGTIKVW---DIRSPSVPRNYKHNAP------------VNEVVIHPNQGELIS 133

Query: 380 SSEEENIIQVW-----KCSHKLPRVGGTPTVSVS 408
              + N I++W     +C+H+L      P  S+S
Sbjct: 134 CDRDGN-IRIWDLGENQCTHQLTPEDDVPLQSLS 166

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 85/198 (42%), Gaps = 17/198 (8%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSN 206
           G   + LYD  K  +S  V++FE H+ N   +SF   D   +++ S+DGTI +W++    
Sbjct: 51  GHQNIRLYD-IKTSNSNPVASFEGHRGNVTSVSFQ-QDNKWMVTSSEDGTIKVWDIR--- 105

Query: 207 SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV--DAPF 264
            SP    +  H+  VN+    + +     S   D  +++ D  E +  T Q     D P 
Sbjct: 106 -SPSVPRNYKHNAPVNEVV-IHPNQGELISCDRDGNIRIWDLGE-NQCTHQLTPEDDVPL 162

Query: 265 NTLAFSKHSQYLFAAAGTDSHVYLFD---RRDIS--RPLHSMAGHDGAVTNMEFSPDQDG 319
            +L+ +     +  AA    + Y+++     D S  +P      H   +T +  S D   
Sbjct: 163 QSLSVASDGS-MLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKH 221

Query: 320 ILMTSGEDRRAIIWDICD 337
            + T   D  A IW + D
Sbjct: 222 -MATCSADHTARIWSVED 238

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 96/240 (40%), Gaps = 30/240 (12%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS---SPIYVWSSVHS-DI 220
           V+    H      + FN   A   +SG   G I +W+ N  ++   SP    +++   D 
Sbjct: 96  VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPIDE 155

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPF----NTLAF----SKH 272
           V    W+    +VF S        + D + K          +P     N LA       +
Sbjct: 156 VQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVI-HLSYTSPHSGLKNQLAVVEWHPSN 214

Query: 273 SQYLFAAAGTDSH--VYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRR 329
           S  +  A G D+   + ++D R+ + PL  M+ GH   + ++++    + ++++SG D  
Sbjct: 215 STRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNT 274

Query: 330 AIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQV 389
            I+W+         P++A+      L  +    +        P  P L AS+  +N IQV
Sbjct: 275 CILWN---------PEEAQK-----LTQYPTRGNWCFKTKFAPEAPDLFASASFDNKIQV 320

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
           YOL138C (REAL)
          Length = 1326

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 83/205 (40%), Gaps = 35/205 (17%)

Query: 140 NLVATINGSGKVFLYDRSKDKH--SGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N +A  N S  + +YD +K     + L+++   H  +     FN  ++  L+SG  D  +
Sbjct: 224 NCIAVCNNSTAISIYDLNKSSSIDNPLITSLYEHTRSINSFDFNMVESNLLISGGQDSCV 283

Query: 198 ALWNV-----NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD 252
            +W++      +SN S I +  +  SD + D KW       F + SE  T          
Sbjct: 284 KIWDLRSNKPKSSNRSDISI--NTASDSIRDVKW--MPGYNFATKSEQGT---------- 329

Query: 253 TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNME 312
                       +T   SK S Y FA+     ++  FD R  ++    +  H G    + 
Sbjct: 330 ------------STYGNSK-SGYKFASIHDSGYLLKFDLRQPAQYEKKLNAHTGPGLCLN 376

Query: 313 FSPDQDGILMTSGEDRRAIIWDICD 337
           + P Q+ I  T G D +  +W + D
Sbjct: 377 WHPHQEYI-ATGGRDGKCCLWYVGD 400

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 98/216 (45%), Gaps = 28/216 (12%)

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYH------KENGYGLSFNC----ND 184
           M QN     ++N +G+   +  SK    G +  +E+       K+ G+  S NC     D
Sbjct: 295 MGQNPVNTVSVNSTGEWLAFGSSK---LGQLLVYEWQSESYILKQQGHFDSTNCLAYSPD 351

Query: 185 AGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
             ++++ SDDG I +W++ +      +     H+  V   +++     +F S S D T++
Sbjct: 352 GSRVVTASDDGKIKVWDITSGFCLATF---EEHTSSVTAVQFAKRGQVMFSS-SLDGTVR 407

Query: 245 LHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA--GTDSHVYLFDRRDISRPLH 299
             D    R   TFT   ++   FN LA     + + A +    D HV+        + L 
Sbjct: 408 AWDLIRYRNFRTFTGTERIQ--FNCLAVDPSGEVVCAGSLDNFDIHVW---SVQTGQLLD 462

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           +++GH+G V+ + FS  ++ +L ++  D+   IW I
Sbjct: 463 ALSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSI 497

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 76/178 (42%), Gaps = 26/178 (14%)

Query: 180 FNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSV 237
           +N  D   ++S S D T  +W++ +S+    YV + +  H   V D ++      +F S 
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSH----YVKTQLIAHDSEVFDVRFLTKSTQLFASC 306

Query: 238 SEDSTLQLHDQRE-------------------KDTFTSQFKVDAPFNTLAFSKHSQYLFA 278
             D ++++ D R                      T T   K       L  S +   + A
Sbjct: 307 GGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLA 366

Query: 279 AAGTDSH-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
               DS+ + + D R+   P+ ++ GH  +V  +++ P +  +L++ G+D + + WD+
Sbjct: 367 TFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 93/240 (38%), Gaps = 36/240 (15%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLS-GSDDGTIALWNVNN---SNSSPIYVWSSV---- 216
           V  + +H  N    S   +D  +L + G  D  I +W+++     N  P           
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNET 477

Query: 217 ---HSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDA---PFNTLAFS 270
              HS  V    +S  D     S SED T++L      DT+TS         P   +AFS
Sbjct: 478 LVGHSGTVYSTSFSP-DNRYLLSASEDKTVRLW---STDTYTSLVNYKGHNHPIWDVAFS 533

Query: 271 KHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRA 330
               Y FA A  D    L+    I  PL   AGH   V  + F P+   +  T   D+  
Sbjct: 534 PLGHY-FATASHDQTARLWSCDHI-YPLRIFAGHLNDVDTVSFHPNGTYVF-TGSSDKTC 590

Query: 331 IIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
            +WDI               + + + +  GH + +   +++P+  WL   S E+ +I VW
Sbjct: 591 RMWDIT--------------SGDSVRLFLGHTAPVTSTAVSPDGRWLSTGS-EDGVINVW 635

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 16/98 (16%)

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA 359
           ++ GH G V +  FSPD +  L+++ ED+   +W                     L+ + 
Sbjct: 477 TLVGHSGTVYSTSFSPD-NRYLLSASEDKTVRLWSTDTY--------------TSLVNYK 521

Query: 360 GHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLP 397
           GH   I D + +P +    A++  +   ++W C H  P
Sbjct: 522 GHNHPIWDVAFSP-LGHYFATASHDQTARLWSCDHIYP 558

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/238 (20%), Positives = 98/238 (41%), Gaps = 40/238 (16%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D     +   ++ F  H++  +  ++N  +    +S S DGT+ +
Sbjct: 74  NQVLVAQGDGSLRLFDTQLTDYP--IAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKV 131

Query: 200 WNVNNSNS------------SPI-------------YVWSSVHSDIVNDCKWSNFDLNVF 234
           W+     S            +P+             +   S + + +   ++S  D NV 
Sbjct: 132 WSPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVI 191

Query: 235 GSVSEDSTLQLHDQREKDTFTS-QFKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFDR 291
            S + +S + + D R+        F       TL   F+K+  ++ A  G D+ + ++D 
Sbjct: 192 MSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDL 251

Query: 292 RDISRP---------LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW-DICDIG 339
           R + +          ++ + GHD A+  + +SP    +L+++  D    +W D+ D G
Sbjct: 252 RMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDG 309

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 120/299 (40%), Gaps = 48/299 (16%)

Query: 132 ARYMPQNSNLVATINGS-------GKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCND 184
            +Y P   N +A   GS       GK+F+ D +         +F   ++  + +++N   
Sbjct: 14  VQYSPFFDNRLAVATGSNFGLVGNGKLFIVDINNQGIMTEAKSF-LTQDGLFDVAWNELH 72

Query: 185 AGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
             ++L    DG++ L++   ++  PI ++   H   V  C W+  +  +F S S D T++
Sbjct: 73  ENQVLVAQGDGSLRLFDTQLTDY-PIAIFHE-HEKEVFSCNWNLINKQLFVSSSWDGTVK 130

Query: 245 L-HDQREKDTFTSQFKVDAPFNTLA---------------------------FSKHSQYL 276
           +    R K   T   K  A  N L                            FS H   +
Sbjct: 131 VWSPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNV 190

Query: 277 FAAAGTDSHVYLFD-RRDISRPLHSMAGHDGAVT-NMEFSPDQDGILMTSGEDRRAIIWD 334
             +   +S+V +FD R+      +S   H+G  T   +F+  +  I+ T G D    +WD
Sbjct: 191 IMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWD 250

Query: 335 ICDIGVEQIPDDAEDGAPEVLMIH--AGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
           +      ++   A   + + + ++   GH  AI   S +P+   ++ S+  +   +VW+
Sbjct: 251 L------RMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

>KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} similar
           to uniprot|P20484 Saccharomyces cerevisiae YKL021C MAK11
           Protein essential for cell growth and replication of M
           dsRNA virus contains four beta-transducin repeats
          Length = 390

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 25/146 (17%)

Query: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
           FT  F   A   ++     S+    +   D ++ ++D +   + L ++ GH G++TN+ F
Sbjct: 31  FTPIFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQK-RKELGTLLGHQGSITNLRF 89

Query: 314 S--PDQDGI-------LMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSA 364
           S   D DG        L+++ ED + I+W + D               E      GH + 
Sbjct: 90  SRGKDADGQDIQLNKWLLSASEDHKIIVWRVKDW--------------ENFGTLKGHTAR 135

Query: 365 INDFSMNPNIPWLMASSEEENIIQVW 390
           INDF ++P+   +  S  E++ I++W
Sbjct: 136 INDFDIHPS-NRVAVSVSEDHSIRLW 160

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 90/240 (37%), Gaps = 44/240 (18%)

Query: 137 QNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGT 196
           Q+   V    G G + L+D    K+   ++ F  HK+     ++N  +     S S DGT
Sbjct: 71  QHEKQVVVAQGDGSLRLFDIDLAKYP--IAIFNEHKKEVMSCNWNLINKTMFTSSSWDGT 128

Query: 197 IALWNVNNSNS----SPIYVWSS------------------------------VHSDIVN 222
           + +W+     S     P   W                                 + D + 
Sbjct: 129 VKIWSPTRKESLLTLRPTPKWKKHLDSMEPIIPKRRNNIQIQPSHKINMPNNNNNKDCIY 188

Query: 223 DCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLA--FSKHSQYLFAAA 280
             ++S  D N+    S DS   + D R+       F   A    L+  F+K+   + A A
Sbjct: 189 QSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKYRPNVLATA 248

Query: 281 GTDSHVYLFD-----RRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           G D+ + ++D      RD +  ++ +   HD AV  + +SP    IL+++  D    IW+
Sbjct: 249 GVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMSCKIWN 308

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 89/221 (40%), Gaps = 20/221 (9%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFD 230
           H E    ++F+ ND+ K ++ SDD  + +WN +N       V S  H D V  C W + +
Sbjct: 165 HTEGIRDVAFSNNDS-KFVTCSDDNILKIWNFSNGQQE--RVLSGHHWD-VRSCDW-HPE 219

Query: 231 LNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
           L +  S S+D+ ++L D R     ++  K         F      L AA   D    +FD
Sbjct: 220 LGLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFD 279

Query: 291 RRDISRPLHSMAGHDGA-VTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAED 349
            R     L  M   D      +E+S   + +               C  G  +  D  +D
Sbjct: 280 LRASMNEL--MCVRDEVDFMELEWSTINESMFTVG-----------CYDGSLKHFDLGQD 326

Query: 350 GAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
               + +I   H   I+  + NP +  ++A++ ++  I+ W
Sbjct: 327 TEKPIHIIPFAHEKCISAIAYNP-VGHILATAAKDRTIRFW 366

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 56/132 (42%), Gaps = 28/132 (21%)

Query: 217 HSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYL 276
           H D  +   W+N   ++  S S D T+   D R  + F  + K            HSQ +
Sbjct: 348 HVDRTSCLSWNN---HILSSGSRDHTILHRDVRMAEPFFERIKT-----------HSQEV 393

Query: 277 -----------FAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
                       A+ G D+ VY++D    S P+  +  H  AV  M +SP + G L T G
Sbjct: 394 CGLKWNVDENKLASGGNDNMVYVYDGTS-SSPVFKITEHKAAVKAMAWSPHKRGTLATGG 452

Query: 326 E--DRRAIIWDI 335
              DR+  IW+I
Sbjct: 453 GTVDRKLKIWNI 464

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 79/200 (39%), Gaps = 34/200 (17%)

Query: 180 FNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSV 237
           +N  D   L+S S D T  +W++ +SN    YV + +  H   V D ++      +F S 
Sbjct: 251 WNPVDPNLLISSSIDTTCIVWDLQSSN----YVRTQLIAHDSEVYDVRFLTQTTQLFSSC 306

Query: 238 SEDSTLQLHDQREKDTFTSQFK-----------------------VDAPFNTLAFSKHSQ 274
             D ++++ D R     T  ++                          P   L  S    
Sbjct: 307 GGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDP 366

Query: 275 YLFAAAGTDS-HVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
            + A    DS  V + D R+   P+  + GH  AV  M + P +  +L++  +D + + W
Sbjct: 367 NVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYW 426

Query: 334 DICDI----GVEQIPDDAED 349
           D+ +       +Q PD A D
Sbjct: 427 DLNNYIMGHPTDQDPDHAVD 446

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 77/178 (43%), Gaps = 26/178 (14%)

Query: 180 FNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSV 237
           +N  D   ++S S D T  +W++ +S+    YV + +  H   V D ++      +F S 
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSH----YVKTQLIAHDSEVFDVRFLTKSTQLFASC 306

Query: 238 SEDSTLQLHDQRE-------------------KDTFTSQFKVDAPFNTLAFSKHSQYLFA 278
             D ++++ D R                     DT T   K       L  S +   + A
Sbjct: 307 GGDGSVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLA 366

Query: 279 AAGTDSH-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
               +S+ + + D R+   P+ ++ GH  +V  +++ P +  +L++ G+D + + WD+
Sbjct: 367 TFAAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 35/198 (17%)

Query: 226 WSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV-DAPFNTLAFSKHSQYLFAAAGTDS 284
           W+  D N+  S S D+T  + D +      +Q    D+    + F   S  LFA+ G D 
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 285 HVYLFDRRDISR-------PLHSMAGHDG-----------AVTNMEFSPDQDGILMT-SG 325
            V +FD R ++        P  S  G +            A+  +E SP    +L T + 
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAA 370

Query: 326 EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA-GHRSAINDFSMNPNIPWLMASSEEE 384
           E  + II D+ +              PE  +++  GH S++N+   +P    ++ S  ++
Sbjct: 371 ESNKIIILDMRN--------------PESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDD 416

Query: 385 NIIQVWKCSHKLPRVGGT 402
             +  W  ++    + G 
Sbjct: 417 CQVLYWDLNNSFMEINGA 434

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 99/214 (46%), Gaps = 24/214 (11%)

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYH------KENGYGLSFNC----ND 184
           M QN+    +IN SG+   +  SK    G +  +E+       K+ G+  S N      D
Sbjct: 297 MGQNAVNTVSINNSGEWLAFGSSK---LGQLLVYEWQSESYILKQQGHFDSMNSLTYSPD 353

Query: 185 AGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
             ++++ SDDG I +W+V +      +     H+  V   +++     V  S S D T++
Sbjct: 354 GSRVVTSSDDGKIKIWDVVSGFCLATF---DDHTSSVTAVQFAK-KGQVLFSASLDGTVK 409

Query: 245 LHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSM 301
             D    R   TFT+  ++   FN LA     + + A +     ++++  +     L ++
Sbjct: 410 AWDLIRYRNFRTFTAAERIQ--FNCLAVDPSGEVVCAGSVDSFEIHVWSVQ-TGNLLDTL 466

Query: 302 AGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           AGH+G V+ + FS +++ +L ++  D+   IW I
Sbjct: 467 AGHEGPVSCLSFS-NENSVLASASWDKTIRIWSI 499

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 100/252 (39%), Gaps = 50/252 (19%)

Query: 130 TRARYMPQ-NSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYG----------- 177
           +R ++ P  NS  +AT + S +++ Y     +    +S   Y+K  G G           
Sbjct: 109 SRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVAALGQLPPV 168

Query: 178 --LSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNV 233
               +N  D   ++S S D T  +W++  +N    YV + +  H   V D K+      +
Sbjct: 169 SSFHWNAVDPNLIISSSIDTTCTVWDLQATN----YVKTQLIAHDSEVFDVKFLTQSTQL 224

Query: 234 FGSVSEDSTLQLHDQREKDTFTSQFKVDA-----------------------------PF 264
           F S   D ++++ D R     T  ++  +                               
Sbjct: 225 FASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGSNAL 284

Query: 265 NTLAFSKHSQYLFAAAGTDSH-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMT 323
             L  S     + A    DS+ V + D R     + ++ GH GAV  +++ P +  +L+T
Sbjct: 285 LRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHNVLLT 344

Query: 324 SGEDRRAIIWDI 335
            G+D +A++WD+
Sbjct: 345 CGDDCQALLWDL 356

>ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 371

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 96/244 (39%), Gaps = 46/244 (18%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D    ++   ++ F  H++  +  ++N       +S S DG + +
Sbjct: 74  NQVLVAQGDGTLRLFDTKLKQYP--IAIFNEHQKEVFSCNWNLVGKQNFVSSSWDGAVKI 131

Query: 200 WNVNNSNS------SPIYVWSSV-------------HSDIVND--CKW----SNFDLNVF 234
           W+     S       P+ V +               H+DI  +  C +    S  D N+ 
Sbjct: 132 WSPQRKESLLTVVPRPMDVSTMACAGPQVPMSNQKGHADIAKNKNCIYQALFSPHDPNLV 191

Query: 235 GSVSEDSTLQLHDQREKDTFTSQ--FKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFD 290
              S +S + L D R+  T  +Q  F   +    L   F+K+  +     G D+ + ++D
Sbjct: 192 MCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNKYRPHSLVTGGVDNCIRIWD 251

Query: 291 RRDISRPLHSMA-------------GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICD 337
            R +     S A             GH+ AV  + +SP    IL+++  D    IW   D
Sbjct: 252 LRMVGPSAASRANASPAVCTNEIVGGHELAVRKVSWSPHHSNILLSTSYDMTCCIWQ--D 309

Query: 338 IGVE 341
           +G +
Sbjct: 310 LGFD 313

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 67/165 (40%), Gaps = 16/165 (9%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKE-NGYGLSFNCNDAGKLL 189
           +A + P + NLV   +G+  V L+D  +        +F  H         FN      L+
Sbjct: 180 QALFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNKYRPHSLV 239

Query: 190 SGSDDGTIALWNV--------NNSNSSPIYVWSSV---HSDIVNDCKWSNFDLNVFGSVS 238
           +G  D  I +W++        + +N+SP    + +   H   V    WS    N+  S S
Sbjct: 240 TGGVDNCIRIWDLRMVGPSAASRANASPAVCTNEIVGGHELAVRKVSWSPHHSNILLSTS 299

Query: 239 EDSTLQLHDQREKDTFTSQFKVDA--PFNTL--AFSKHSQYLFAA 279
            D T  +      D   S  + ++  P       F++H++++++A
Sbjct: 300 YDMTCCIWQDLGFDGRRSTGRTNSVDPRRGCRSRFAQHTEFVYSA 344

>CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly
           similar to uniprot|P20484 Saccharomyces cerevisiae
           YKL021c MAK11 involved in cell growth and replication of
           M1 dsRNA virus
          Length = 388

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 66/149 (44%), Gaps = 24/149 (16%)

Query: 250 EKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVT 309
           E   FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G++T
Sbjct: 27  ETPVFTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSIT 85

Query: 310 NMEFSPDQD--------GILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGH 361
           N++FS   D          L+++ ED + I+W + D               E      GH
Sbjct: 86  NLKFSKVSDQEPKSTSGKWLLSASEDNKIIVWRVKD--------------WENFGTLKGH 131

Query: 362 RSAINDFSMNPNIPWLMASSEEENIIQVW 390
            + IND  ++P+   ++AS  E++ I++W
Sbjct: 132 TARINDMDIHPS-NRVVASVSEDHSIRLW 159

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 79/155 (50%), Gaps = 12/155 (7%)

Query: 188 LLSGSDDGTIALWN-VNNSNSSPIYVWSSVHSDIV--NDCKWSNFDLNVFGSVSEDSTLQ 244
           LL+   +G++ L + V N   S I    +  SD+V  N+ + + F   +  + +EDS ++
Sbjct: 28  LLASLSNGSVQLIDWVKNKQISQIQAHGTTISDMVVLNNDRNNGF---LIATAAEDS-VK 83

Query: 245 LHDQREKDTF-TSQFKVDAPFNTLAFSKHSQYLFAA--AGTDSHVYLFDRRDISRPLHSM 301
           + D R  DT  T + +  APF +L  S+H         +G D+ ++++D +   +PL S+
Sbjct: 84  IFDLRSSDTVATLKNEKSAPFLSLD-SRHGMLACGTELSGVDAELHIYDMKAWHQPLRSL 142

Query: 302 A-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
              H   +TN++F P    +L++   D    I+D+
Sbjct: 143 VDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDL 177

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 80/208 (38%), Gaps = 51/208 (24%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFD 230
           H E    ++F+ ND+ K +S SDD  + +WN   SN     V S  H D V  C W + +
Sbjct: 162 HTECIRDVAFSGNDS-KFVSCSDDNILKIWNF--SNGKLERVLSGHHWD-VKSCDW-HPE 216

Query: 231 LNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
           + +  S S+D+ ++L D R  +  ++  K       + F      + AA   D    +FD
Sbjct: 217 MGLIISASKDNLIKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFD 276

Query: 291 RR--------------------------------------------DISRPLHSMA-GHD 305
            R                                            D+++P H +   HD
Sbjct: 277 IRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPYAHD 336

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIW 333
             VT++ ++P    IL ++ +DR    W
Sbjct: 337 KCVTSLSYNP-MGNILASASKDRTVRFW 363

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 19/101 (18%)

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDIGVEQIPDDAEDGAPEVLMIHA 359
           M  HD +VT ME+S   DG  M SG+    I IW      V+++ DDA            
Sbjct: 117 MQAHDSSVTTMEYS--HDGDWMISGDSDGIIKIWQANFNMVKEL-DDA------------ 161

Query: 360 GHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSH-KLPRV 399
            H   I D + + N    ++ S ++NI+++W  S+ KL RV
Sbjct: 162 -HTECIRDVAFSGNDSKFVSCS-DDNILKIWNFSNGKLERV 200

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 97/243 (39%), Gaps = 37/243 (15%)

Query: 148 SGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS 207
           +G+V LY  S   H+  VS   +  +N             L +GS D TI +W++N SN 
Sbjct: 265 TGRVCLYTLSG--HTSSVSCVRWGGQN------------MLYTGSHDKTIRVWDMN-SNG 309

Query: 208 SPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTL 267
             I +  S H+  VN    S       G            +  +D     ++       +
Sbjct: 310 RCINILKS-HAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYE-----KIV 363

Query: 268 AFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGED 327
             + H++ L   A  D  ++L++    ++PL  M GH   V ++ FSPD   I+  S  D
Sbjct: 364 KKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSPDGRHIVSAS-FD 422

Query: 328 RRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENII 387
               +W            D  DG  + +    GH +++   + + +   L+ S  ++  +
Sbjct: 423 NSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTL 467

Query: 388 QVW 390
           +VW
Sbjct: 468 KVW 470

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 48/103 (46%), Gaps = 15/103 (14%)

Query: 288 LFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDA 347
           +F  + ++R   ++AGH   +    F+P+    ++T   D  A +WD CD    Q P   
Sbjct: 125 VFKVKPVTRSSSAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWD-CD---TQTP--- 177

Query: 348 EDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
                  +   +GH + +   + +P+   ++A+   +N I++W
Sbjct: 178 -------MATLSGHSNWVLCVAWSPDAE-VIATGSMDNTIRLW 212

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 79/173 (45%), Gaps = 19/173 (10%)

Query: 175 GYGLSFNC-----NDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNF 229
           G+G +  C     N + ++++G+ D T  LW+ +    +P+   S  HS+ V    WS  
Sbjct: 140 GHGSTILCSAFAPNSSSRMVTGAGDNTARLWDCD--TQTPMATLSG-HSNWVLCVAWSP- 195

Query: 230 DLNVFGSVSEDSTLQL----HDQREKDTFT--SQFKVDAPFNTLAFSKHSQY-LFAAAGT 282
           D  V  + S D+T++L    + +   D+    S++     +  L   K  Q    A+A  
Sbjct: 196 DAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASK 255

Query: 283 DSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           D  + ++D       L++++GH  +V+ + +      +L T   D+   +WD+
Sbjct: 256 DGTIKVWDTTG-RVCLYTLSGHTSSVSCVRWG--GQNMLYTGSHDKTIRVWDM 305

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 25/167 (14%)

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKW---------SNFDLN-V 233
           D   L++G+ +G I +WN+NN + SP    +  H + V   ++         ++FD+   
Sbjct: 236 DGTALVTGAANGEIRIWNLNNDSESPAGTLTG-HENRVARVRFHPSGKYVASASFDMTWR 294

Query: 234 FGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRD 293
              V +   LQL +   K+ +   F+ D              L  + G DS   ++D R 
Sbjct: 295 LWDVEKQIELQLQEGHAKEVYCVAFQKDGS------------LLCSTGLDSVGLVWDLRS 342

Query: 294 ISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGV 340
             + + ++ GH   +  +++SP+   I  T   D    +WD+  +G+
Sbjct: 343 -GKSIMALEGHIKPIYGLDWSPNGYDI-ATGSADGTIRLWDVRKVGI 387

>KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly
           similar to uniprot|Q06078 Saccharomyces cerevisiae
           YLR409C UTP21 Possible U3 snoRNP protein involved in
           maturation of pre-18S rRNA based on computational
           analysis of large-scale protein-protein interaction data
          Length = 942

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 85/209 (40%), Gaps = 25/209 (11%)

Query: 182 CNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDS 241
           C + G  L GS +G I++ N+ +     +Y    +H   V        +  +  S   D 
Sbjct: 473 CGNFG--LVGSSNGGISVHNLQSGQKRKVY---RLHKKAVTGIAMDGMNRKMV-SCGLDG 526

Query: 242 TLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSM 301
            +  +D   K TF  + K+D+P  ++ + + S  LFA A  D  + + D     + +  +
Sbjct: 527 IVGFYD-FSKSTFLGKLKLDSPITSMVYHRSSD-LFALALDDLSIVVVDSV-TQKVVRQL 583

Query: 302 AGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGH 361
            GH   +++ +FSPD   I ++S  D     WD+   G         DG           
Sbjct: 584 WGHSNRISSFDFSPDGRWI-VSSSLDSTIRTWDLPTGG-------CIDGMKV-------- 627

Query: 362 RSAINDFSMNPNIPWLMASSEEENIIQVW 390
            + I +   +PN   L  +S   N I +W
Sbjct: 628 ENVITNIKFSPNGDLLATTSVSGNGISLW 656

>Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar to
           Ashbya gossypii ACR199C
          Length = 295

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 88/212 (41%), Gaps = 23/212 (10%)

Query: 142 VATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL-SGSDDGTIALW 200
           +AT +    + +++   D H  LV T   H+   + + +     G +L S S DG + +W
Sbjct: 24  LATCSSDKTIQIFEVEGDSHK-LVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIW 82

Query: 201 NVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLN-VFGSVSEDSTLQLHDQREKDTFTSQFK 259
              N   S I   S VHS  VN  KW+  +   +    S D    + + +E  T TS   
Sbjct: 83  KEENGRWSQIAT-SEVHSASVNSIKWAPHEYGPLLLCASSDGKFSVVEFKENGT-TSPII 140

Query: 260 VD-----------APFNTLAFSKHSQYL--FAAAGTDS--HVYLFDRRDISRPLH-SMAG 303
           +D           AP       +H Q L   A  G D+   ++ F+    +  L  +++G
Sbjct: 141 IDAHAIGVNAACWAPATIEEDGQHPQQLRRIATGGADNLVKIWKFNSESNTYLLEDTLSG 200

Query: 304 HDGAVTNMEFSPD--QDGILMTSGEDRRAIIW 333
           H   V ++ +SP       L T  +DR  IIW
Sbjct: 201 HSDWVRDVAWSPSVLPRAYLATVSQDRTCIIW 232

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 88/175 (50%), Gaps = 18/175 (10%)

Query: 170 YHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI-VNDCKWSN 228
           +H +    LS N +    L S S D T+ LW++NN  ++     +S+H++  V+  +W +
Sbjct: 277 HHTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGIAARSI--ASIHNNKNVSSSQWHS 334

Query: 229 FDLNVFGSVSEDSTLQLHDQR-EKDTFTSQFKVDAPFNTLAFSKHSQYLFAA-----AGT 282
            D ++  +   DS + + D R   D+  S++     ++ +A  +     FA+      GT
Sbjct: 335 TDGSILLTGGYDSRVAVSDVRIADDSAMSKY-----WSVMAGEEIESVRFASENVIMCGT 389

Query: 283 DS-HVYLFDRR--DISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IW 333
           DS +VY FD R  + S+PL ++  HD  +++++ +     +L TS    + + +W
Sbjct: 390 DSGNVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQHVPNMLATSAMGEKVVKLW 444

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 91/202 (45%), Gaps = 25/202 (12%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSN 206
           G G + L+D +  K+   ++ F+ HK+     ++N  +    LS S DG + +W+   + 
Sbjct: 81  GDGSLRLFDINLQKYP--IAIFKEHKKEVLSCNWNLINKNLFLSSSWDGDVKVWST--AR 136

Query: 207 SSPIYVWSSVHSD---IVNDCKWSNFDLNVFGSVSEDSTLQLHDQ----REKDTFTSQFK 259
            + +   S +H+D   IVN         N+  S++  S   LH +    R+  T  S   
Sbjct: 137 QASLITLSPIHTDPTAIVNT------KSNINPSLNNVSQPILHPRSTAIRQPVTSASMQG 190

Query: 260 VDAP--FNTLAFSKHSQYLFAAAGTDSHVYLFDRR----DISRPLHSMAGHDGAVTNMEF 313
            D         FS H   + A     S++ LFD R    ++ R + + +G++     ++F
Sbjct: 191 NDNKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYE--TLTLDF 248

Query: 314 SPDQDGILMTSGEDRRAIIWDI 335
           +  +  I+ TSG D+   +WD+
Sbjct: 249 NKYRSHIIATSGVDKAIKMWDM 270

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 69/137 (50%), Gaps = 2/137 (1%)

Query: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE-KDTFTSQ 257
           +WN++ ++++ I      H   + D  +      +  + S D+ +   D R  +  + S 
Sbjct: 95  VWNLSRNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYST 154

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317
            +  A  + + ++  +  + A++ +D HV ++D R    PL+++ GH+G+V N++F+  +
Sbjct: 155 SEWRAGASQVKWNFRNSNIMASSHSD-HVCIWDLRKGCTPLYTLQGHEGSVNNIDFNKAK 213

Query: 318 DGILMTSGEDRRAIIWD 334
           +  +M+S  D     WD
Sbjct: 214 ETEIMSSSNDGTVKFWD 230

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/127 (19%), Positives = 49/127 (38%), Gaps = 14/127 (11%)

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGE 326
           + F  H   + A    D++V  +D R   RP +S +      + ++++     I+ +S  
Sbjct: 120 INFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIMASSHS 179

Query: 327 DRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENI 386
           D    IWD+              G   +  +  GH  ++N+   N      + SS  +  
Sbjct: 180 DH-VCIWDL------------RKGCTPLYTLQ-GHEGSVNNIDFNKAKETEIMSSSNDGT 225

Query: 387 IQVWKCS 393
           ++ W  S
Sbjct: 226 VKFWDYS 232

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 28/61 (45%)

Query: 275 YLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           ++ + +   + V+   R   +   H + GH  A+T++ F P    IL T   D   + WD
Sbjct: 84  WVVSTSNQKAMVWNLSRNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWD 143

Query: 335 I 335
           +
Sbjct: 144 M 144

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189
           ++ ++  +NSN++A+ + S  V ++D  K      + T + H+ +   + FN     +++
Sbjct: 162 SQVKWNFRNSNIMAS-SHSDHVCIWDLRKG--CTPLYTLQGHEGSVNNIDFNKAKETEIM 218

Query: 190 SGSDDGTIALWNVNNSNSSP 209
           S S+DGT+  W+ + S++ P
Sbjct: 219 SSSNDGTVKFWDYSVSDTKP 238

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 88/215 (40%), Gaps = 37/215 (17%)

Query: 168 FEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWS 227
           FE H +    LSF   D+  L+SGS D  I  W                  D+V      
Sbjct: 422 FELHSDEITALSF---DSEALISGSKDRKILHW------------------DLVTGKCVQ 460

Query: 228 NFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY 287
             DL V  + ++         R  +  TS    +AP   +   +      A+   D  V 
Sbjct: 461 QLDLIVTPTYNDTKV----SARSANNSTSVLGSEAPM--IGALQCYNSALASGTKDGVVR 514

Query: 288 LFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-----ICDIGVEQ 342
           L+D R I +P+ ++ GH   +T+++F  ++   L+T   D    IWD     I D+    
Sbjct: 515 LWDLR-IGKPVRALEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRTSSIIDVIAYD 570

Query: 343 IPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377
           +P  + D   +++ + A + + +N F+M  +  W+
Sbjct: 571 LPITSLDFDDKLITVGA-NETGVNVFNMERDEHWM 604

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 17/118 (14%)

Query: 273 SQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAII 332
           S+ L   A   S + L+D R +   LH   GHDG V  ++F P Q  I  ++G+D    I
Sbjct: 22  SRPLVLVALFSSTIQLWDYR-MGTLLHRFEGHDGPVRGIDFHPTQP-IFASTGDDATIRI 79

Query: 333 WDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           W +                 + L    GH   +     +  +PWL+++S+++  I++W
Sbjct: 80  WSL--------------DTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQT-IRIW 122

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 71/177 (40%), Gaps = 35/177 (19%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
           ++SG DD  + LW ++++ +  I      H++ V DC   +   N+  S  ED TL++ D
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEIDSCRG-HTNNV-DCVIFHPQQNLIISAGEDKTLRVWD 281

Query: 248 ----------QREKDTF-------------------TSQFKVDAPFNTLAFSKHSQYLFA 278
                     +RE D F                      FK+D      +    +Q LF 
Sbjct: 282 LDKRVPVKQFKRENDRFWLVAAHPTINLFGAAHDSGIMIFKLDRE-RPCSVIHQNQLLFV 340

Query: 279 AAGTDSHVYLFDRRDISRP---LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAII 332
               +   + + ++  S P   L  +     A  ++ ++P Q  IL+  G D+ A++
Sbjct: 341 NKAKEIQSFDYQKKVTSLPFANLKKIGQTWSAFRSISYNPSQHSILVNEGNDKFALV 397

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 276 LFAAAGTDSHVYLFDRRDISR-PLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           L  + G D  V L+         + S  GH   V  + F P Q+ +++++GED+   +WD
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEIDSCRGHTNNVDCVIFHPQQN-LIISAGEDKTLRVWD 281

Query: 335 I-CDIGVEQIPDDAED-----GAPEVLMIHAGHRSAINDFSMNPNIP 375
           +   + V+Q   + +        P + +  A H S I  F ++   P
Sbjct: 282 LDKRVPVKQFKRENDRFWLVAAHPTINLFGAAHDSGIMIFKLDRERP 328

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/241 (20%), Positives = 92/241 (38%), Gaps = 38/241 (15%)

Query: 138 NSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N   V    G G + L+D +       +  ++ H    +  ++N       +SGS DG +
Sbjct: 72  NPTQVLVAQGDGTLTLFDLTNKLQQ--IQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKV 129

Query: 198 ALWNVNNSNS------------------SPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSE 239
            +W+   S S                  +     +S + D +    +S  D N+    S 
Sbjct: 130 KIWDCARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPHDPNMAMCCSG 189

Query: 240 DSTLQLHDQREKDTFTSQFKVDAPFNTLA--FSKHSQYLFAAAGTDSHVYLFDRRDISRP 297
           +S L   D R+ +   S     +   TL+  ++K+  Y+ A+AG D  + ++D R I   
Sbjct: 190 NSYLTFFDLRQPNQQNSIL-AHSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNK 248

Query: 298 LHSMA--------------GHDGAVTNMEFSPDQDGILMTSGEDRRAIIW-DICDIGVEQ 342
            H+M                H+ A+  + +SP      +T+  D    +W D+   G  Q
Sbjct: 249 PHNMFADISSYNCTNEVVNAHELAIRKILWSPHHSNYFLTTSYDLTCRVWQDLSHDGTRQ 308

Query: 343 I 343
           +
Sbjct: 309 V 309

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 95/232 (40%), Gaps = 41/232 (17%)

Query: 153 LYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIY- 211
           L +++++  +  +  FE HK+    LSF   D+  L+SGS D  I  W++          
Sbjct: 405 LKEKTEEIVTPCIHNFELHKDEITALSF---DSEALVSGSRDKKIFHWDLTTGKCIQQLD 461

Query: 212 -VWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFS 270
            +++  HSDI    +  N    + G+                        +AP   +   
Sbjct: 462 LIFTPTHSDIKMPARSLNNGACLLGT------------------------EAPM--IGAL 495

Query: 271 KHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRA 330
           +      A    D  V L+D R + +P+  + GH   +T+++F  ++   L+T   D   
Sbjct: 496 QCYNSALATGTKDGIVRLWDLR-VGKPVRLLEGHTDGITSLKFDSEK---LVTGSMDNSV 551

Query: 331 IIWD-----ICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377
            IWD     I D+    +P  + D   +++ + A +   +N F+M  +  W+
Sbjct: 552 RIWDLRTSSILDVIAYDLPVSSLDFDGKLITVGA-NEGGVNVFNMERDEHWM 602

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
           YOL138C (REAL)
          Length = 1336

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 82/205 (40%), Gaps = 35/205 (17%)

Query: 140 NLVATINGSGKVFLYDRSKDKH--SGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N +A  N S  + +YD +K     + LV++   H  +     FN  ++  ++SG  D  +
Sbjct: 227 NCIAVCNNSTAISIYDLNKSSSLDNPLVTSLCEHTRSINSFDFNMVESNLIISGGQDSCV 286

Query: 198 ALW-----NVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD 252
            +W     N  +SN S I +  +  SD + D KW       F S +E  +          
Sbjct: 287 KIWDLRSSNFKSSNRSDISI--NTASDSIRDVKW--MPGYNFASRNEQGS---------- 332

Query: 253 TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNME 312
                       +T   SK S Y FA+     ++  FD R  ++    +  H G    + 
Sbjct: 333 ------------STYGNSK-SGYKFASIHDSGYLLKFDLRQPAQYEKKLNAHTGPGLCLN 379

Query: 313 FSPDQDGILMTSGEDRRAIIWDICD 337
           + P Q+ I  T G D +  +W + D
Sbjct: 380 WHPHQEYI-ATGGRDGKCCLWYVGD 403

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 68/141 (48%), Gaps = 15/141 (10%)

Query: 225 KWSNFDLNVFGSVSEDSTLQLHDQREKDTF-TSQFKVDAPFNTLAFSKHSQYLFAA--AG 281
           +++N DL  F S S+DS +++ D R      T      APF +L  S+H         +G
Sbjct: 67  EFTNSDL--FASASKDS-VKIFDVRTSSCVATLHNDKSAPFLSLD-SRHDMLACGTELSG 122

Query: 282 TDSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGV 340
            D+ ++++D + +S+PL S    H   +T+ +F P   G+LM+   D    I+D+ +   
Sbjct: 123 VDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN--- 179

Query: 341 EQIPDDAEDGAPEVLMIHAGH 361
                D ED   +V+   + H
Sbjct: 180 ----SDEEDALHQVINFASVH 196

>KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {ON}
           Anc_2.663 YKL021C
          Length = 381

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 66/128 (51%), Gaps = 22/128 (17%)

Query: 266 TLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGI---LM 322
           TL  SK  +YL + +  D H+ ++D +   + L ++  H G++T ++FS ++      L+
Sbjct: 46  TLDISK--RYLVSGS-NDEHIRIYDLQK-RKELGTLLAHQGSITALKFSKNEASTNKWLL 101

Query: 323 TSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSE 382
           ++ ED++ IIW        ++ D    G  +      GH   IND  ++P+    ++ SE
Sbjct: 102 SASEDKKIIIW--------RVKDWENYGTLK------GHTGRINDLDIHPSSRIAISVSE 147

Query: 383 EENIIQVW 390
           + + I++W
Sbjct: 148 DHS-IRLW 154

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 100/239 (41%), Gaps = 27/239 (11%)

Query: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSS---PIYVWSSVHSDI 220
           L  T E H      L+ +      LLSGS D T+  W +   +     P+  +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280
           V DC  +  D     S S D TL+L D    +T+       +   ++A  + +  + + +
Sbjct: 68  VQDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSP----DQDGILMTSGEDRRAIIWDIC 336
             D  + ++  +   + L ++ GH+  V+ +  +P    D    ++++G D+    W++ 
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

Query: 337 DIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHK 395
                QI  D             GH   +N  + +P+   L+AS+ ++  I +W  + K
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNTVTASPDGT-LIASAGKDGEIMLWNLAEK 227

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 73/156 (46%), Gaps = 14/156 (8%)

Query: 185 AGKLLS-GSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243
           AG  L+ G  +G + +++V       I   S  H D V    W+N   ++  S S D T+
Sbjct: 387 AGSHLAIGQGNGIVEIYDVTKEKC--IRTLSG-HLDRVACLSWNN---HILSSGSRDRTI 440

Query: 244 QLHDQREKDTFTSQFKV-DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISR-PLHSM 301
              D R  D F  + +  +     L ++ +   L A+ G D+ V+++D    SR P  S+
Sbjct: 441 LHRDVRMADPFFEKIETHEQEICGLKWNTNDNKL-ASGGNDNMVFVYD--GTSRTPFLSI 497

Query: 302 AGHDGAVTNMEFSPDQDGILMTSG--EDRRAIIWDI 335
             H  AV  M +SP + GIL T G   DR   +W++
Sbjct: 498 NEHKAAVKAMAWSPHKQGILATGGGTADRTLKMWNV 533

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 95/244 (38%), Gaps = 44/244 (18%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLS-GSDDGTIALWNVN--------------NSNSSP 209
           V  + +H  N    S   +D  +L S G  D  + +W+++               SN++ 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNAT 477

Query: 210 IYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDA---PFNT 266
           +      HS  V    +S  D     S SED T++L      DT+TS         P   
Sbjct: 478 LVG----HSGTVYSTAFSP-DNRYLLSASEDKTVRLW---STDTYTSLVSYKGHNHPIWD 529

Query: 267 LAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGE 326
           +AFS    Y FA A  D    L+    I  PL   AGH   V  + F P+   +  T   
Sbjct: 530 VAFSPLGHY-FATASHDQTARLWSCDHI-YPLRIFAGHLNDVDTVSFHPNGTYVF-TGSS 586

Query: 327 DRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENI 386
           D+   +WD+                 + + +  GH + +   +++P+  WL   S E+ I
Sbjct: 587 DKTCRMWDMS--------------TGDSVRLFLGHTAPVTATAVSPDGRWLSTGS-EDGI 631

Query: 387 IQVW 390
           I VW
Sbjct: 632 INVW 635

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 16/98 (16%)

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA 359
           ++ GH G V +  FSPD +  L+++ ED+   +W                     L+ + 
Sbjct: 477 TLVGHSGTVYSTAFSPD-NRYLLSASEDKTVRLWSTDTY--------------TSLVSYK 521

Query: 360 GHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLP 397
           GH   I D + +P +    A++  +   ++W C H  P
Sbjct: 522 GHNHPIWDVAFSP-LGHYFATASHDQTARLWSCDHIYP 558

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 57/126 (45%), Gaps = 18/126 (14%)

Query: 268 AFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGED 327
           AFS  ++YL +A+  D  V L+   D    L S  GH+  + ++ FSP       T+  D
Sbjct: 489 AFSPDNRYLLSAS-EDKTVRLWST-DTYTSLVSYKGHNHPIWDVAFSP-LGHYFATASHD 545

Query: 328 RRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENII 387
           + A +W  CD      P          L I AGH + ++  S +PN  ++   S ++   
Sbjct: 546 QTARLWS-CD---HIYP----------LRIFAGHLNDVDTVSFHPNGTYVFTGSSDKT-C 590

Query: 388 QVWKCS 393
           ++W  S
Sbjct: 591 RMWDMS 596

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 90/209 (43%), Gaps = 20/209 (9%)

Query: 144 TINGS---GKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALW 200
           TI G+   G + L+  S D+ +  V+    H  +   L FN      L+SGS+ G I +W
Sbjct: 76  TIAGALDNGIIELFYLSNDQLTS-VAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVW 134

Query: 201 NVNNSNSS---PIYVWSSVHS-DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTS 256
           + N +  +   P+   +++   + +    W+    +VF S        + D + K     
Sbjct: 135 DTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKEVI- 193

Query: 257 QFKVDAPFNTLA--------FSKHSQYLFAAAGTDS--HVYLFDRRDISRPLHSM-AGHD 305
                +P   L            +S  +  A G D+   + ++D R+ + PL  +  GH 
Sbjct: 194 HLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGHS 253

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
             + ++++  + + ++++SG D   ++W+
Sbjct: 254 KGIISLDWCHEDESLMLSSGRDNTVLLWN 282

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 99/216 (45%), Gaps = 28/216 (12%)

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYH------KENGYGLSFNC----ND 184
           M QN     T+N +G+   +  SK    G +  +E+       K+ G+  S N      D
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSK---LGQLLVYEWQSESYILKQQGHFDSTNSLTYSPD 352

Query: 185 AGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
             ++++ +DDG I +W+V +      +   + H+  V   +++     +F S S D T++
Sbjct: 353 GSRVVTAADDGKIKVWDVVSGFCLATF---TEHTSSVTQVQFAKKGQVLFSS-SLDGTVR 408

Query: 245 LHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA--GTDSHVYLFDRRDISRPLH 299
             D    R   TFT+  ++   FN LA     + + A +    D HV+        + L 
Sbjct: 409 AWDLIRYRNFRTFTAAERIQ--FNCLAVDPSGEVVCAGSIDSFDIHVW---SVQTGQLLD 463

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           +++GH+G V+ + FS  ++ +L ++  D+   IW I
Sbjct: 464 TLSGHEGPVSCLSFS-QENSVLASASWDKTVRIWSI 498

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 81/188 (43%), Gaps = 16/188 (8%)

Query: 151 VFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLS-GSDDGTIALWNVNNSNSSP 209
           VFL D + ++   L  T     EN Y  S N   AG  L+ G  +G + ++++       
Sbjct: 274 VFLTDNATNEVVQLCDT-----ENEY-TSINWVGAGSHLAVGQGNGLVEIYDIVKRKC-- 325

Query: 210 IYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAF 269
           I   S  H D V    W+N   ++  S S D  +   D R  + +  Q +          
Sbjct: 326 IRTLSG-HMDRVACLSWNN---HILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLK 381

Query: 270 SKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG--ED 327
               +   A+ G D+ VY++D     +P   +A H  AV  + +SP + GIL T G   D
Sbjct: 382 WNTDENRLASGGNDNVVYVYDGTS-RKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTAD 440

Query: 328 RRAIIWDI 335
           ++  IW++
Sbjct: 441 KKMKIWNV 448

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 77/180 (42%), Gaps = 33/180 (18%)

Query: 173 ENGYGLSFNCNDAGKLLS-GSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDL 231
           EN Y  S N   +G  L+ G  +G + +++VN        +    HSD V    W+++  
Sbjct: 303 ENEYT-SLNWVGSGSHLAVGQSNGIVEIFDVNKKKCIRTMLG---HSDRVACLSWNSY-- 356

Query: 232 NVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYL-----------FAAA 280
            +  S S D  +   D R  D F  + +            HSQ +             + 
Sbjct: 357 -ILTSGSRDHNILHRDVRSPDPFFEKIE-----------SHSQEVCGLKWNVDENKLVSG 404

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG--EDRRAIIWDICDI 338
           G D+ V ++DR   ++P  +M  H  AV  +++S  + GIL T G   DR   IW++ ++
Sbjct: 405 GNDNIVNVYDRTS-TKPFMTMTEHKAAVKALDWSSHKRGILATGGGTADRHLKIWNVNNM 463

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 6/139 (4%)

Query: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDT---FT 255
           +WN+  S+S  I      HS  + D  ++  + ++  + S D+ +   D R        T
Sbjct: 94  IWNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYST 153

Query: 256 SQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSP 315
           S ++  A      F K S  L ++ G D  V+++D R+ S PL  + GH+ +V +++FS 
Sbjct: 154 SAWRSSASQVKWNF-KDSNILASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDFSR 210

Query: 316 DQDGILMTSGEDRRAIIWD 334
            +   +M+S  D     WD
Sbjct: 211 FKSTEIMSSSNDGTVKFWD 229

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 58/135 (42%), Gaps = 15/135 (11%)

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRD-ISRPLHSMAGHDGAVTNMEFSPD 316
            KVD  FN ++ +   + +  A+     +Y+ D  D  S P          V ++++SP 
Sbjct: 20  LKVDGGFNAISINPSGRDVVLASRRG--LYIIDLDDPFSPPRWLQHITPWQVADVQWSPH 77

Query: 317 -QDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIP 375
                 + S  +++A+IW++           A+  +  +  +  GH  AI D + NP  P
Sbjct: 78  PAKPYWVVSTSNQKALIWNL-----------AKSSSDAIEHVLHGHSRAITDINFNPENP 126

Query: 376 WLMASSEEENIIQVW 390
            ++A+   +  +  W
Sbjct: 127 DILATCSIDTYVHAW 141

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 299 HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           H + GH  A+T++ F+P+   IL T   D     WD+
Sbjct: 107 HVLHGHSRAITDINFNPENPDILATCSIDTYVHAWDM 143

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 82/170 (48%), Gaps = 8/170 (4%)

Query: 170 YHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI-VNDCKWSN 228
           +H +    L+ N +    L S S D T+ LW++NN  ++     +S+HS   V+  +W  
Sbjct: 286 HHTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAA--RSLASIHSGKNVSSSEWHK 343

Query: 229 FDLNVFGSVSEDSTLQLHDQREKD-TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDS-HV 286
            + +V  +   DS + L D R  D +  S++    P   +  S  +      +GTDS +V
Sbjct: 344 TNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADENIILSGTDSGNV 403

Query: 287 YLFDRRD--ISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIW 333
           Y FD R+   S+P+ ++  HD  ++ +  +    G++ TS   D+   +W
Sbjct: 404 YAFDIRNNSGSKPVWTLNAHDAGISCLCANDYIPGMMTTSAMGDKTVKLW 453

>Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar to
           Ashbya gossypii ACR166W
          Length = 385

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 65/147 (44%), Gaps = 26/147 (17%)

Query: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
           FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H+G++T+++F
Sbjct: 31  FTPIFHFQAHSLSIKCLDISRRYLVSGSNDEHIKIYDLQK-RKELGTLFNHNGSITSLKF 89

Query: 314 S----------PDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRS 363
           S          P  +  ++++ ED + +IW + D               E   I  GH  
Sbjct: 90  SRAKDVGGNGTPQNNKWMLSASEDNKIVIWRVKDW--------------ENFGILKGHTG 135

Query: 364 AINDFSMNPNIPWLMASSEEENIIQVW 390
            IND  ++P+   +  S  E++ I++W
Sbjct: 136 RINDLDIHPS-NRVAVSVSEDHTIRLW 161

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 77/175 (44%), Gaps = 14/175 (8%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDC 224
           + TF   K+  Y  S+   D   L +G   G +++++  N  +  + V +S H   V   
Sbjct: 74  IKTFSRFKDVVYSASYR-KDGKLLCAGDATGLVSVYDSYNPRTLLVSVAASQHPTHVT-- 130

Query: 225 KWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAP---FNTLAFSKHSQYLFAAAG 281
           K+ + DL    S S+D   ++ D      +  Q ++        TL F   + +L     
Sbjct: 131 KFHDHDLKTLVSASDDRVTRVWDISH--AYEPQLELTGAADYVRTLCFVPAAPHLVVTGS 188

Query: 282 TDSHVYLFDRRDISRPLHSMAGHDGAVTN-MEFSPDQDGILMTSGEDRRAIIWDI 335
            D  + L+D R  S+P H++  HD  V N +  SP Q  ++   G + +  +WD+
Sbjct: 189 YDGALRLYDTRAGSKPQHTLV-HDQPVENVVAISPTQ--LVSCGGPNFK--VWDL 238

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 84/196 (42%), Gaps = 17/196 (8%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
            LSG +D  + LW+V +     +      HS  V D  +S    + F SVS D  +++ +
Sbjct: 185 FLSGGNDNKVKLWDVYHKRE--LLRDYCGHSKAVRDVSFSGSGTS-FLSVSYDQHMKIWN 241

Query: 248 QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRP--LHSMAGHD 305
               D    ++K  A  N   FS  +        ++S V  +D R   +   +     H 
Sbjct: 242 TETGD-IEHRYKFPAVPNCAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHHL 300

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWD-ICDIGVEQIPDDAEDGAPEVLMIHAGHR-- 362
            ++  +++ PD     ++S ED+   IWD   +I ++QI D A+   P  + IH  H   
Sbjct: 301 SSIIALKYFPDGSK-FISSSEDKSMRIWDNQVNIPIKQISDTAQYSMP-FIDIHPEHHYF 358

Query: 363 ------SAINDFSMNP 372
                 +AI  FSM P
Sbjct: 359 ATQSMDNAIYAFSMKP 374

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 89/214 (41%), Gaps = 22/214 (10%)

Query: 132 ARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSG 191
           A + P NSN +     + +V  YD       GLV  +++H  +   L +   D  K +S 
Sbjct: 260 AEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKY-FPDGSKFISS 318

Query: 192 SDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNV------FGSVSEDSTLQL 245
           S+D ++ +W  +N  + PI         I +  ++S   +++      F + S D+ +  
Sbjct: 319 SEDKSMRIW--DNQVNIPI-------KQISDTAQYSMPFIDIHPEHHYFATQSMDNAIYA 369

Query: 246 HDQREKDTFTSQFKVD----APFNT-LAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300
              + K     + + +    A +     FS   QYL A+  T   VY++D +      H 
Sbjct: 370 FSMKPKYRRNPKKRFEGHKCAGYGIGFGFSPDGQYL-ASGDTKGRVYIWDWKTTRLLKHF 428

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
                 AV  + ++P +   ++ +G   R  ++D
Sbjct: 429 EVPGKKAVITVAWAPQETSKMLCAGNGGRIFLYD 462

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 14/93 (15%)

Query: 298 LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMI 357
           +HS  GH    T ++  P    + ++ G D +  +WD+                 E+L  
Sbjct: 162 IHSYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVYH-------------KRELLRD 208

Query: 358 HAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           + GH  A+ D S + +    ++ S +++ +++W
Sbjct: 209 YCGHSKAVRDVSFSGSGTSFLSVSYDQH-MKIW 240

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 266 TLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325
           T+     S +LF + G D+ V L+D       L    GH  AV ++ FS      L  S 
Sbjct: 174 TIKMLPKSGHLFLSGGNDNKVKLWDVYHKRELLRDYCGHSKAVRDVSFSGSGTSFLSVS- 232

Query: 326 EDRRAIIWD 334
            D+   IW+
Sbjct: 233 YDQHMKIWN 241

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 82/197 (41%), Gaps = 32/197 (16%)

Query: 160 KHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN-----------SNSS 208
           KH+G V+   +H       S   N    L +G   G I +W+ N            S  +
Sbjct: 108 KHAGAVTQARFH-------SLQSN---ILATGDSKGGILIWDTNKCLTKAQGGGVVSTYT 157

Query: 209 PIYVWSSVHSDIVNDC-KWSNFDLNVFGSVSEDSTLQLHDQREKD-----TFTSQFKVDA 262
           P+   ++  S+    C  W+    ++F S +  S   + D + K      ++TS      
Sbjct: 158 PMLPAANKSSEEPVQCLAWNKKQAHIFASTNSTSFASIWDLKAKKDVLHLSYTSPLTGLK 217

Query: 263 PFNTLA--FSKHSQYLFAAAGTDSH--VYLFDRRDISRPLHSM-AGHDGAVTNMEFSPDQ 317
           P  ++       S Y+    G D+   V ++D R+ + PL  +  GH   + ++++    
Sbjct: 218 PQLSVVEWHPDQSTYVATGTGNDTGPVVVVWDLRNANTPLQELTGGHSKGILSLDWCQQD 277

Query: 318 DGILMTSGEDRRAIIWD 334
           + +L++SG D   ++W+
Sbjct: 278 ETLLLSSGRDNSVVLWN 294

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 104/247 (42%), Gaps = 48/247 (19%)

Query: 137 QNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGT 196
           +N  LVA   G G + L+D     +   ++ ++ H+   +  ++N       +S S DG 
Sbjct: 73  ENQCLVA--QGDGSLRLFDIKLKDYP--IAIYKEHQREVFSCNWNMIQKQMFVSSSWDGK 128

Query: 197 IALWNV-----------NNSNSS----------PIYVWSS-----VHSDIVNDC----KW 226
           + LW++           N++N++          P+ V  S      H+D   +C     +
Sbjct: 129 VKLWSLMRPQSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATF 188

Query: 227 SNFDLNVFGSVSEDSTLQLHDQREKDTFT--SQFKVDAPFNTLA--FSKHSQYLFAAAGT 282
           S  D N+    S +S + L+D R  +      QF     F  L   F+K+  ++ A  G 
Sbjct: 189 SPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFNKYRPHIIATGGV 248

Query: 283 DSHVYLFDRRDISRPL---------HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
           D  + ++D R   + L         + + GH+ AV  + +SP    +L+++  D    +W
Sbjct: 249 DKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSYDMTCRVW 308

Query: 334 -DICDIG 339
            D+ D G
Sbjct: 309 TDLSDDG 315

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 6/92 (6%)

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDIC-DIGVEQIPDDAEDGAPEVL---MIH 358
           GH   V + +F P  D  L +S +D +  IW+I  D  ++   D  EDG P+V+    I 
Sbjct: 79  GHTAQVLDTDFDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVD--EDGEPKVIKPVKIL 136

Query: 359 AGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           +GH+  +     +P    ++ASS  +  +++W
Sbjct: 137 SGHKRKVGHILYHPVAQNVLASSSLDYTVKIW 168

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 75/195 (38%), Gaps = 28/195 (14%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS--------------SPI 210
           +  F  H        F+  D  KL S +DD  IA+W +    +               P+
Sbjct: 74  IPLFRGHTAQVLDTDFDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPV 133

Query: 211 YVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD-QREKDTFTSQFKVDAP--FNTL 267
            + S  H   V    +     NV  S S D T+++ D + EKD  T    +  P    ++
Sbjct: 134 KILSG-HKRKVGHILYHPVAQNVLASSSLDYTVKIWDIENEKDMLT----LTHPDMVTSM 188

Query: 268 AFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG-- 325
           +FS +  +L A    D  + ++D R+  + +     H GA             L T+G  
Sbjct: 189 SFSYNGNFL-ATVARDKKLRVWDVRE-GKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFS 246

Query: 326 --EDRRAIIWDICDI 338
              DR+  +WD  ++
Sbjct: 247 RLSDRQLGVWDAFNL 261

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 100/239 (41%), Gaps = 27/239 (11%)

Query: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSS---PIYVWSSVHSDI 220
           L  T E H      L+ +      LLSGS D T+  W +   +     P+  +   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280
           V DC  +  D     S S D TL+L D    +T+       +   ++A  + +  + + +
Sbjct: 68  VQDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSP----DQDGILMTSGEDRRAIIWDIC 336
             D  + ++  +   + L ++ GH+  V+ +  +P    D    ++++G D+    W++ 
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

Query: 337 DIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHK 395
                QI  D             GH   +N  + +P+   L+AS+ ++  I +W  + K
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNAVTASPDGT-LIASAGKDGEIMLWNLAEK 227

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 78/155 (50%), Gaps = 11/155 (7%)

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243
           D  ++++ S+DG I +W+V +      +     H+  V   +++     +F S S D T+
Sbjct: 347 DGSRVVTSSEDGKIKIWDVVSGFCLATF---EEHTSSVTAVQFAKRGQVLF-SASLDGTV 402

Query: 244 QLHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300
           +  D    R   TFTS  ++   FN LA     + + A +  +  ++++  +   + L +
Sbjct: 403 RAWDLIRYRNFRTFTSTDRIQ--FNCLAVDPSGEVVCAGSLDNFEIHVWSVQ-TGQLLDT 459

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           +AGH+G V+ + FS  ++G+L ++  D+   IW I
Sbjct: 460 LAGHEGPVSCLAFS-QENGVLASASWDKTIRIWSI 493

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 97/216 (44%), Gaps = 28/216 (12%)

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYH------KENGYGLSFNC----ND 184
           M QN     T+N +G+   +  SK    G +  +E+       K+ G+  S N      D
Sbjct: 300 MGQNPVNTVTVNNTGEWLAFGSSK---LGQLLVYEWQSESYILKQQGHFDSTNSLAYSPD 356

Query: 185 AGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
             ++++ SDDG I +W+V +      +     H+  V   +++     +F S S D T++
Sbjct: 357 GSRVVTASDDGKIKVWDVTSGFCLATF---EEHTSSVTAVQFAKRGQVMFSS-SMDGTVR 412

Query: 245 LHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA--GTDSHVYLFDRRDISRPLH 299
             D    R   TFT   ++   FN LA     + + A +    D HV+        + L 
Sbjct: 413 AWDLIRYRNFRTFTGTERIQ--FNCLAVDPSGEVVCAGSLDNFDIHVW---SVQTGQLLD 467

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           +++GH+G V+ + FS  ++ +L ++  D+   IW I
Sbjct: 468 ALSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSI 502

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 31/165 (18%)

Query: 188 LLSGSDDGTIAL--WN---------VNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGS 236
           LL  S +G++ L  WN         V  +N + + V   +++D  N C        +F +
Sbjct: 28  LLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRV---INNDFENGC--------IFAA 76

Query: 237 VSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT-----DSHVYLFDR 291
            S  ++++++D R  D+  +  K D   N++  S  S++     GT     D+ ++++D 
Sbjct: 77  TSL-ASVKIYDVRNGDSPVATIKNDK--NSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133

Query: 292 RDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           R  S+P+ +    H   +T+++F P    IL++   D    I+D+
Sbjct: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178

>TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.429
           YDR364C
          Length = 441

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 88/197 (44%), Gaps = 8/197 (4%)

Query: 168 FEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWS 227
           ++ H      L F  N A   LSG +D  I LW+  +     I  +   H   V    ++
Sbjct: 144 YKGHTNGTTDLKFFPNTAHMFLSGGNDNMIRLWDFYHDRRC-IRDYKG-HKKAVRSVDFN 201

Query: 228 NFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVY 287
           N +  VF S S D T+++ D  E     ++ K ++  N +     S   +    ++S + 
Sbjct: 202 N-NGTVFFSSSYDQTVKIWDT-ETGKVKAKVKCNSIPNDVKPRPLSDSEYIVGLSNSKIN 259

Query: 288 LFDRRDISRP--LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-ICDIGVEQIP 344
            +D+R  S+   + +   H G++  +++ PD     ++S ED+   IW+   +I ++QI 
Sbjct: 260 HYDQRVSSKNGLVQTYDHHQGSILCLKYFPDGSK-FISSSEDKTVRIWENKINIPIKQIA 318

Query: 345 DDAEDGAPEVLMIHAGH 361
           D  +   P + +   GH
Sbjct: 319 DTTQHSMPYMDIHPEGH 335

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 86/193 (44%), Gaps = 16/193 (8%)

Query: 150 KVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSP 209
           K+  YD+     +GLV T+++H+ +   L +   D  K +S S+D T+ +W   N  + P
Sbjct: 257 KINHYDQRVSSKNGLVQTYDHHQGSILCLKY-FPDGSKFISSSEDKTVRIW--ENKINIP 313

Query: 210 I--YVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ------LHDQREKDTFTSQFKVD 261
           I     ++ HS    D    + + + F + S D+T+        + ++ K  F     V 
Sbjct: 314 IKQIADTTQHSMPYMDI---HPEGHYFSTQSMDNTIYSYGMKPKYKRQNKKVFKGHQSVG 370

Query: 262 APFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGIL 321
               +L+FS   +Y+  +  T+S V+++D +            +  +T + + P +   L
Sbjct: 371 YKI-SLSFSPDGRYI-CSGDTNSRVFIWDWKTTKLLRCLTINGNKPITQVTWHPQETSKL 428

Query: 322 MTSGEDRRAIIWD 334
           + SG      I+D
Sbjct: 429 LCSGGSGYIYIYD 441

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/95 (18%), Positives = 38/95 (40%), Gaps = 14/95 (14%)

Query: 296 RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVL 355
           + L+   GH    T+++F P+   + ++ G D    +WD                    +
Sbjct: 139 KQLYRYKGHTNGTTDLKFFPNTAHMFLSGGNDNMIRLWDFYH-------------DRRCI 185

Query: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
             + GH+ A+     N N     +SS ++  +++W
Sbjct: 186 RDYKGHKKAVRSVDFNNNGTVFFSSSYDQT-VKIW 219

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 80/170 (47%), Gaps = 8/170 (4%)

Query: 170 YHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI-VNDCKWSN 228
           +H +    L+ N      L S S D T+ LW++N + ++   +  ++HS+  V+  +W  
Sbjct: 286 HHTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAARSLI--NIHSNTNVSASQWHP 343

Query: 229 FDLNVFGSVSEDSTLQLHDQR-EKDTFTSQF-KVDAPFNTLAFSKHSQYLFAAAGTDSHV 286
            + +V  +   DS   L D R E D   S++  V +           + +F     + +V
Sbjct: 344 SNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFADENIFICGTDNGNV 403

Query: 287 YLFDRRD--ISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IW 333
           Y FD R+   S+P+ ++  HD  V+++E +     +L+TS    + + +W
Sbjct: 404 YSFDIRNGAESKPVWTLKAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLW 453

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE-KDTFTSQ 257
           LWN++ ++S  I      HS  + D  +      +  + S D+ +   D R  +  + S 
Sbjct: 95  LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSA 154

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317
               A  + + ++  +  + A+A ++  VY++D R    PLH + GH  +V +++FS   
Sbjct: 155 SVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVLQGHVNSVNSIDFSKFD 213

Query: 318 DGILMTSGEDRRAIIWD 334
           +  +M+S  D     WD
Sbjct: 214 ETEIMSSSNDGTVKFWD 230

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 15/135 (11%)

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVY-LFDRRDISRPLHSMAGHDGAVTNMEFSPD 316
            +VD  FN ++ S   + +  A+    +V  L D     R LH +   +  V ++++SP 
Sbjct: 21  LRVDGGFNAVSISPSGRDVVLASRQGLYVIDLDDPFSAPRWLHHITSWE--VADVQWSPH 78

Query: 317 -QDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIP 375
                 + S  +++A++W++          ++ D    VL    GH  AI D + +P  P
Sbjct: 79  PSKPSWVISTSNQKALLWNLSR--------NSSDAIEHVLH---GHSRAITDINFHPTHP 127

Query: 376 WLMASSEEENIIQVW 390
            ++A+   +  +  W
Sbjct: 128 EILATCSIDAYVHAW 142

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189
           ++ ++  +NSN++A+ + S  V+++D  K      +   + H  +   + F+  D  +++
Sbjct: 162 SQVKWNYKNSNVMASAH-SNDVYIWDLRKG--CTPLHVLQGHVNSVNSIDFSKFDETEIM 218

Query: 190 SGSDDGTIALWNVNNSNSSP 209
           S S+DGT+  W+ + S+  P
Sbjct: 219 SSSNDGTVKFWDYSLSDKEP 238

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 75/186 (40%), Gaps = 18/186 (9%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSS----VHSDI 220
           V+    H      L FN      L SG   G I +W++N   SS    +S        D 
Sbjct: 97  VAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTPIDE 156

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKD-----TFTSQFKVDAPFNTLAF----SK 271
           V    W+    +VF S        + D + K      ++TS        N L+       
Sbjct: 157 VYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTS--PSTGAKNHLSVVEWHPS 214

Query: 272 HSQYLFAAAGTDSH--VYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDR 328
           +S  +  A G D+   + ++D R+   PL +M+ GH   + ++++    + +L++SG D 
Sbjct: 215 NSTKIATATGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDN 274

Query: 329 RAIIWD 334
              +W+
Sbjct: 275 TCALWN 280

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 238 SEDSTLQLHDQREKDTFTSQ--FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDIS 295
           S +STL+L      D    Q      A FN L +S  +  L A A  +  V  F  +++ 
Sbjct: 37  SSESTLELWSLLSADVEKPQGSITASAKFNDLDWSPDNSIL-AGALDNGIVEFFSPKEL- 94

Query: 296 RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDI 338
           + +  ++ H   V  ++F+  QD +L  SG+ R  I IWDI  I
Sbjct: 95  KSVAKISKHTTPVNTLKFNAKQDNVLC-SGDSRGEIFIWDINKI 137

>KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.429
           YDR364C
          Length = 440

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 7/198 (3%)

Query: 166 STFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCK 225
           +TF  H+     L F  N     +SG +D  + LW+  +     +  + S HS  +   +
Sbjct: 140 ATFSGHRNGTNTLQFIPNTGHLFMSGGNDAVVRLWDFYHDRRC-VRDYRS-HSKGIRATR 197

Query: 226 WSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSH 285
           +   D + F S S D T+   D        S      P       +H    +    +DS 
Sbjct: 198 FVP-DGSQFLSASFDQTVNRWDTETGTVLQSLSLRSTPTAVDFRPQHGTDEYLVGLSDSR 256

Query: 286 VYLFDRRDISRP--LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI-CDIGVEQ 342
           +  +D R  +R   + +   H G +  + + PD     ++S ED+   IWD   +I V+Q
Sbjct: 257 ILHYDTRVDTRDGLVQTYDHHLGGILALRYFPDGTK-FISSSEDKTVRIWDSGVNIPVKQ 315

Query: 343 IPDDAEDGAPEVLMIHAG 360
           I D  +   P V +  AG
Sbjct: 316 ISDTTQHSMPSVSLHPAG 333

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 150 KVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWN 201
           ++  YD   D   GLV T+++H      L +   D  K +S S+D T+ +W+
Sbjct: 256 RILHYDTRVDTRDGLVQTYDHHLGGILALRY-FPDGTKFISSSEDKTVRIWD 306

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 92/230 (40%), Gaps = 23/230 (10%)

Query: 164 LVSTFE-YHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVN 222
           +V  FE  H E    +SF+ ND+ K ++ SDD  + +WN +N         S  H DI  
Sbjct: 165 MVKEFENAHTECIRDISFSNNDS-KFVTCSDDNVLKIWNFSNGQVE--RTLSGHHWDI-K 220

Query: 223 DCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT 282
            C W + ++ +  S S+D+ ++L D R     ++  K         F      L AA   
Sbjct: 221 SCDW-HPEMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISK 279

Query: 283 DSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQ 342
           D    +FD R   + L  +      +T + ++P  + +      D           G  +
Sbjct: 280 DKSCRVFDIRHSMKELMCVRDEVDYMT-LTWNPINESMFTVGNYD-----------GAMK 327

Query: 343 IPDDAEDGAPEVLMIHAGHRSAINDFSMNP--NIPWLMASSEEENIIQVW 390
             D  +D      +I   H   +   + NP  NI   +AS+ ++  I+ W
Sbjct: 328 YFDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNI---LASASKDRTIRFW 374

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 70/174 (40%), Gaps = 19/174 (10%)

Query: 217 HSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYL 276
           HS  V    +S  D     S SED T++L       +  S    + P   ++FS    Y 
Sbjct: 475 HSGTVYSTSFSP-DNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHY- 532

Query: 277 FAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDIC 336
           FA A  D    L+    I  PL   AGH   V  + F P+   +  T   D+   +WDI 
Sbjct: 533 FATASHDQTARLWSCDHI-YPLRIFAGHLNDVDCVSFHPNGTYVF-TGSTDKTCRMWDI- 589

Query: 337 DIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
                        G  + + +  GH + +   +++P+  WL   S E+ II VW
Sbjct: 590 -------------GTGDSVRLFLGHTAPVISTAVSPDGRWLSTGS-EDGIINVW 629

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 61/149 (40%), Gaps = 20/149 (13%)

Query: 251 KDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT--DSHVYLFDRRDISRPLHSMAGHDGAV 308
           +D    +F  DA      F      L++  GT  DS +    R  I+    ++ GH G V
Sbjct: 422 RDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINN--TTLIGHSGTV 479

Query: 309 TNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDF 368
            +  FSPD +  L+++ ED+   +W +                   L+ + GH   + D 
Sbjct: 480 YSTSFSPD-NKYLLSASEDKTVRLWSMDTY--------------SSLVSYKGHNHPVWDV 524

Query: 369 SMNPNIPWLMASSEEENIIQVWKCSHKLP 397
           S +P +    A++  +   ++W C H  P
Sbjct: 525 SFSP-LGHYFATASHDQTARLWSCDHIYP 552

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 79/184 (42%), Gaps = 14/184 (7%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS---SPIYVWSSVHS-DI 220
           ++    H      + FN      L SG   G I +W+ N   +   +P    +++   D 
Sbjct: 97  IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDE 156

Query: 221 VNDCKWSNFDLNVFGSVSED---STLQLHDQREKDTFTSQFKVDAPFNTLAF----SKHS 273
           +    W+    +VF S       S   L  ++E    +    +    N L+       +S
Sbjct: 157 IYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPNNS 216

Query: 274 QYLFAAAGTDS--HVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRA 330
             +  A+G+DS   + ++D R+ + PL +++ GH   V ++++    + +L++SG D   
Sbjct: 217 TRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSC 276

Query: 331 IIWD 334
           ++W+
Sbjct: 277 VLWN 280

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 85/218 (38%), Gaps = 37/218 (16%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDC 224
           +  FE H +    LSF   D+  L+SGS D  I  W                  D+    
Sbjct: 436 IHNFEIHDDEITALSF---DSEALISGSKDKKILHW------------------DMATGK 474

Query: 225 KWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDS 284
                DL +F     DS +        +  T     DAP   +   +  +   A    D 
Sbjct: 475 CIQQLDL-IFAPTHNDSRIS---APSSNYSTRLLDTDAPM--IGALQCYKSALATGTKDG 528

Query: 285 HVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-----ICDIG 339
            V L+D R + +P+  + GH   +T+++F  ++   L+T   D    IWD     + D+ 
Sbjct: 529 IVRLWDLR-VGKPVRLLRGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRTSSVVDVI 584

Query: 340 VEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377
              +P  + D   +++ + A  R  +N F+M  +  W+
Sbjct: 585 AYDLPVTSLDFDDKLIAVGANER-GVNVFNMELDEHWM 621

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 88/173 (50%), Gaps = 14/173 (8%)

Query: 170 YHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI-VNDCKWSN 228
           +H +    LS N +    L S S D T+ LW++N+ N++     +S+H++  V+  +W +
Sbjct: 287 HHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGNAA--RSMASIHNNKNVSSSQWHH 344

Query: 229 FDLNVFGSVSEDSTLQLHDQR--EKDTFTSQFKVD--APFNTLAFSKHSQYLFAAAGTDS 284
            + ++  +   DS + L D R   ++  +  + V       T+ F+  +  L   AGTDS
Sbjct: 345 GNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFADENIIL---AGTDS 401

Query: 285 -HVYLFDRRDI--SRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IW 333
            ++Y FD R+   S+P+ ++  HD  ++++  +    G++ T     +A+ +W
Sbjct: 402 GNIYSFDIRNNAGSKPVWTLKAHDAGISSLSVNNFIPGLMSTGAMGEKAVKLW 454

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 94/212 (44%), Gaps = 21/212 (9%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189
           T   + PQ+ +  A  + +       R++     ++ TF   K+  Y  SF  +  GKLL
Sbjct: 43  THISFNPQHPHDFAVTSSTRVQIFSSRTRQ----VIKTFSRFKDVVYSASFRSD--GKLL 96

Query: 190 SGSD-DGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQ 248
              D  G +++++  N  +  + + +S H   V   K+   D  +  + S+D   +L D 
Sbjct: 97  CAGDATGLVSVYDSYNPRTILLSMNASTHPTHVT--KFHTQDSKILATASDDRVTRLWDI 154

Query: 249 REKDTFTSQFKVDAP---FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDI-SRPLHSMAGH 304
              + +  Q ++        TL+F   + +L A    D  V L+D R   S P++S+  H
Sbjct: 155 --SNAYEPQLELTGATDYVRTLSFIPAAPHLIATGSYDGLVRLYDTRSSGSTPIYSL-NH 211

Query: 305 DGAVTN-MEFSPDQDGILMTSGEDRRAIIWDI 335
           D  + N +  SP Q  I+   G + +  +WD+
Sbjct: 212 DQPIENVIAVSPTQ--IVSCGGSNFK--VWDL 239

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 277 FAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG--EDRRAIIWD 334
            A+ G D+ V+++D     +P+ ++A H  AV  M +SP + G+L T G   D+R  IW+
Sbjct: 390 LASGGNDNVVFVYDGTS-RKPILTLAEHTAAVKAMAWSPHRRGVLATGGGTADKRLKIWN 448

Query: 335 I 335
           +
Sbjct: 449 V 449

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 75/178 (42%), Gaps = 26/178 (14%)

Query: 180 FNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSV 237
           +N  D   ++S S D T  +W++ +S+    YV + +  H   V D ++      +F S 
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSH----YVKTQLIAHDSEVFDVRFLTKSTQLFASC 306

Query: 238 SEDSTLQLHDQRE-------------------KDTFTSQFKVDAPFNTLAFSKHSQYLFA 278
             D ++++ D R                        T   K       L  S +   + A
Sbjct: 307 GGDGSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLA 366

Query: 279 AAGTDSH-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
               DS+ + + D R+   P+ ++ GH  +V  +++ P +  +L++  +D +A+ WD+
Sbjct: 367 TFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 82/210 (39%), Gaps = 37/210 (17%)

Query: 226 WSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV-DAPFNTLAFSKHSQYLFAAAGTDS 284
           W+  D N+  S S D+T  + D +      +Q    D+    + F   S  LFA+ G D 
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 285 HVYLFDRRDI----------SRPLH---------SMAGHDGAVTNMEFSPDQDGILMTSG 325
            V +FD R +          S P           S+ G D A+  +E SP    +L T  
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSD-ALLRLEPSPYDPNVLATFA 369

Query: 326 EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEEN 385
            D   II  I D+   + P          ++   GH  ++N+   +P    ++ S  ++ 
Sbjct: 370 ADSNKII--ILDMRNPESP----------ILNLEGHTCSVNEIKWHPTKRNVLLSCSDDC 417

Query: 386 IIQVWKCSHKLPRVGG----TPTVSVSQLE 411
               W  ++    + G    +PT S + LE
Sbjct: 418 QALYWDLNNSFMEINGSDSKSPTASGASLE 447

>CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {ON}
           similar to uniprot|P32479 Saccharomyces cerevisiae
           YBL008w HIR1 histone transcription regulator
          Length = 840

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 5/58 (8%)

Query: 276 LFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
           L +AA  +S V     RD  RPL SM+ H G+VT ++FSPD +  L +  +DR  +IW
Sbjct: 49  LVSAAAGESGV----DRDTHRPLASMSRHTGSVTCVKFSPDGN-YLASGSDDRILLIW 101

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 94/212 (44%), Gaps = 21/212 (9%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189
           T   + PQ+ +  A  + +       R++     ++ TF   K+  Y  SF  +  GKLL
Sbjct: 43  THISFNPQHPHDFAVTSSTRVQIFSSRTRQ----VIKTFSRFKDVVYSASFRSD--GKLL 96

Query: 190 SGSD-DGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQ 248
              D  G +++++  N  +  + + +S H   V   K+   D  +  + S+D   +L D 
Sbjct: 97  CAGDATGLVSVYDSYNPRTILLSINASTHPTHVT--KFHTQDNKILATASDDRVTRLWDI 154

Query: 249 REKDTFTSQFKVDAP---FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDI-SRPLHSMAGH 304
              + +  Q ++        TL+F   + +L A    D  + L+D R   S P++S+  H
Sbjct: 155 --SNAYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSL-NH 211

Query: 305 DGAVTN-MEFSPDQDGILMTSGEDRRAIIWDI 335
           D  V N +  SP Q  I+   G + +  +WD+
Sbjct: 212 DQPVENVIAVSPTQ--IVSCGGNNFK--VWDL 239

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 65/137 (47%), Gaps = 9/137 (6%)

Query: 227 SNFDLNVFGSVSEDSTLQLHDQREKDTFTS-QFKVDAPFNTLAFSKHSQYLFAA--AGTD 283
           SNF+     +V+ + ++ + D R +D   S +   +APF +L  S+H         +G D
Sbjct: 67  SNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLD-SRHGMLACGTELSGVD 125

Query: 284 SHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQ 342
           + ++++D R+ S P+ S    H   VT++ F P    +L++   D    ++D+     +Q
Sbjct: 126 AELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDL----KQQ 181

Query: 343 IPDDAEDGAPEVLMIHA 359
             DDA         IH+
Sbjct: 182 EEDDALHQVINYASIHS 198

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 33/181 (18%)

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSVSEDS 241
           D   L+S S D T  +W++ +SN    YV + +  H   V D K+      +F S   D 
Sbjct: 312 DTNLLISSSIDTTCIVWDLQSSN----YVKTQLIAHDSEVFDVKFLIQSTQLFASCGGDG 367

Query: 242 TLQLHDQRE----------------KDTFTSQF--KVD-APFNTLAF-------SKHSQY 275
           ++++ D R                  +TF +    K+D +  N+L+        S     
Sbjct: 368 SIRVFDLRALQHSTIIYETANDLQGNNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDPN 427

Query: 276 LFAAAGTDSH-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           L A  G D   + + D R+   P+  ++GH  +V  +++ P +  +L++ G+D + + WD
Sbjct: 428 LIATFGLDKKAILILDMRNPGVPVLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWD 487

Query: 335 I 335
           +
Sbjct: 488 L 488

>NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}
           Anc_2.663 YKL021C
          Length = 401

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 65/148 (43%), Gaps = 26/148 (17%)

Query: 253 TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNME 312
            FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G++TN++
Sbjct: 30  VFTPIFHFQAHSLSVKCLDVSKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLK 88

Query: 313 FSPDQDGI----------LMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHR 362
           FS  + G           L+++ ED + IIW + D               E      GH 
Sbjct: 89  FSKTKHGSTEGEGSNNKWLLSASEDHKIIIWRVKD--------------WENFGTLKGHI 134

Query: 363 SAINDFSMNPNIPWLMASSEEENIIQVW 390
           + IND  ++P+    ++ S++ + I++W
Sbjct: 135 ARINDIDIHPSNRVAISVSDDHS-IRLW 161

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 293 DISRPLHSMAGHDGAVTNMEFSPDQDGILMTS-GEDRRAIIWDICD 337
           ++  P  S+ GH   V + +F  ++ G  + S G D + ++WD+ D
Sbjct: 274 NVQEPEFSLLGHTNRVKDFKFYQNEFGTYLVSIGSDGKVVVWDMKD 319

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 73/150 (48%), Gaps = 7/150 (4%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
           ++S S+   I +WN++ S+S  +      H   + D  +      +  + S D+     D
Sbjct: 85  VISTSNQKAI-VWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWD 143

Query: 248 QR--EKDTF-TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGH 304
            R  +K  F TS ++  A    + ++  +  + A + ++  VY++D R  + PL  + GH
Sbjct: 144 MRSPKKPYFRTSNWRSGAA--QVKWNHKNSNVLATSHSNI-VYVWDVRKGTSPLSVLEGH 200

Query: 305 DGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
            G+V +++F+P  +  +M+SG D     WD
Sbjct: 201 SGSVNSIDFNPFNETEIMSSGNDGTVKFWD 230

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 299 HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           H + GH  A+T++ F P Q  IL TS  D  A+ WD+
Sbjct: 108 HVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDM 144

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLS 190
           + ++  +NSN++AT + S  V+++D  K   +  +S  E H  +   + FN  +  +++S
Sbjct: 163 QVKWNHKNSNVLAT-SHSNIVYVWDVRKG--TSPLSVLEGHSGSVNSIDFNPFNETEIMS 219

Query: 191 GSDDGTIALWNVN 203
             +DGT+  W+ N
Sbjct: 220 SGNDGTVKFWDYN 232

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 101/242 (41%), Gaps = 28/242 (11%)

Query: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSS---PIYVWSSVHSDI 220
           L  T E H      L+ +      LLS S D T+  W +  ++     P+  +   HS I
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKG-HSHI 66

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280
           V DC  +  D     S S D TL+L +    +T+       +   ++A  + +  + + +
Sbjct: 67  VQDCALTA-DGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGS 125

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSP-----DQDGILMTSGEDRRAIIWDI 335
             D  + ++  +     L +M GH+  V+ +  +P     D+   L+++G D+    W++
Sbjct: 126 -RDKTIKVWTIK--GDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNV 182

Query: 336 CDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHK 395
                 QI  D             GH + IN  + +P+   L+AS+ ++  I +W    K
Sbjct: 183 NQF---QIEAD-----------FVGHNNYINTITASPDGT-LIASAGKDGDIMLWNLKEK 227

Query: 396 LP 397
            P
Sbjct: 228 SP 229

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 75/161 (46%), Gaps = 25/161 (15%)

Query: 168 FEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWS 227
           F  HK +   ++ +   A  ++SGS D TI +W +     + +      H+D V+  + +
Sbjct: 102 FTGHKSDVMSVAID-RKASMIISGSRDKTIKVWTIKGDCLATML----GHNDWVSQVRVA 156

Query: 228 NFDLNVFGSVSEDSTLQL----HDQREKDTFTSQFKVDAPF-------NTLAFSKHSQYL 276
                      +D T++L     D+  K    +QF+++A F       NT+  S     L
Sbjct: 157 P------NENEDDETVRLISAGMDKMVKAWNVNQFQIEADFVGHNNYINTITASPDGT-L 209

Query: 277 FAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317
            A+AG D  + L++ ++ S PL+++   D  V  + FSP++
Sbjct: 210 IASAGKDGDIMLWNLKEKS-PLYTLNAQD-EVFALAFSPNR 248

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 10/188 (5%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFD 230
           H      L+F  N    LLSG +D  + +W+  +  +  +      HS  +N   + N D
Sbjct: 154 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRN--LLRDYKGHSKAINSLDF-NDD 210

Query: 231 LNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
              F S S D T+++ D  E+    ++    +  N + F   +   F     +S +Y +D
Sbjct: 211 GTNFISSSFDHTIKIWDT-EQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYD 269

Query: 291 RRDISR---PLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-ICDIGVEQIPDD 346
            R IS     +     H  ++  ++F PD     ++S ED+   IWD   ++ ++QI D 
Sbjct: 270 TR-ISENDGRVQVYDHHMSSILALKFFPDGSK-FISSSEDKTVRIWDNQVNVPIKQISDT 327

Query: 347 AEDGAPEV 354
            +   P +
Sbjct: 328 TQYSMPSI 335

 Score = 36.6 bits (83), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 14/92 (15%)

Query: 299 HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIH 358
           ++M GH    T++ F P+   +L++ G D    +WD                   +L  +
Sbjct: 149 YAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNLLRDY 195

Query: 359 AGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
            GH  AIN    N +    ++SS  ++ I++W
Sbjct: 196 KGHSKAINSLDFNDDGTNFISSS-FDHTIKIW 226

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 132 ARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSG 191
            ++ P NS+       + K++ YD    ++ G V  +++H  +   L F   D  K +S 
Sbjct: 246 VKFRPFNSSEFIVGFANSKIYHYDTRISENDGRVQVYDHHMSSILALKF-FPDGSKFISS 304

Query: 192 SDDGTIALWN 201
           S+D T+ +W+
Sbjct: 305 SEDKTVRIWD 314

>KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON}
           similar to uniprot|P20484 Saccharomyces cerevisiae
           YKL021C MAK11 Protein essential for cell growth and
           replication of M dsRNA virus contains four beta-
           transducin repeats
          Length = 407

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 34/155 (21%)

Query: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
           FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G++T+++F
Sbjct: 31  FTPIFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQK-RKELGTLLSHQGSITSLKF 89

Query: 314 S-----PDQDG-------------ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVL 355
           S     P+QDG              L+++ ED   ++W + D               E  
Sbjct: 90  SRGAAIPNQDGDDSEKPVTHGNSKWLLSASEDHNLVVWRVKD--------------WENF 135

Query: 356 MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
               GH + INDF ++P+    ++ SE+ + I++W
Sbjct: 136 GTLKGHSARINDFDIHPSNRIAISVSEDHS-IRLW 169

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 80/215 (37%), Gaps = 38/215 (17%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLV----STFEYHKENGYGLS----FN 181
           T   + P N+  +      G++ LYD+ +  HS         F +  E+  G+     F 
Sbjct: 277 TCVSFCPYNTYFIVGTKF-GRILLYDQKEFFHSTKTDEKEPVFVFQTESFKGICCLEWFK 335

Query: 182 CNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDS 241
             D  K   G ++G++ L+ + N    P   WS          K   F  +    +   S
Sbjct: 336 PGDVCKFYIGEENGSVTLFEIKNLRF-PAKKWS----------KRQKFQEDNLIGLKLHS 384

Query: 242 TLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSM 301
           T Q   Q+                 ++ ++HS  L A  G D+   L+D  D+ +P+   
Sbjct: 385 TYQAQAQQ--------------VCGISLNEHSN-LLAVGGNDNSCSLWDISDLDKPIKKF 429

Query: 302 A-GHDGAVTNMEFSPDQDGILMTSG--EDRRAIIW 333
              H  AV  + F P    +L T G  +DR    W
Sbjct: 430 VLPHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFW 464

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 79/202 (39%), Gaps = 48/202 (23%)

Query: 175 GYGLSFNC----NDAGKLLSGSDDGTIALWNVN----------------NSNSSPIYVWS 214
           G+  + NC     D G L++G  D  + LWN+N                N   SP     
Sbjct: 439 GHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTF 498

Query: 215 SVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE-----------KDTFTSQFKVDAP 263
             H+D V      + D +   S S+D T++  D R             +  T+   VD  
Sbjct: 499 EAHTDEVTAL---SLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLS 555

Query: 264 FNTLAFSKHS-------QYLFAAAGT---DSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
            +TL   ++        Q   AA  T   D  V L+D R   + + ++ GH  A+T+++F
Sbjct: 556 KSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRS-GKVIRTLKGHTDAITSLKF 614

Query: 314 SPDQDGILMTSGEDRRAIIWDI 335
                  L+T   DR   IWD+
Sbjct: 615 DS---ACLVTGSYDRTVRIWDL 633

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1178

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 74/150 (49%), Gaps = 7/150 (4%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDL-NVFGSVSEDSTLQLH 246
           ++S S+   I +WN+  S+ + +      HS  V D  + NFD  ++  + S D+ +   
Sbjct: 85  VVSTSNQKAI-IWNLARSSVNAVEYVLHGHSRAVTDITF-NFDHPDLLATCSIDTYIHAW 142

Query: 247 DQREKDT-FTSQFKVDAPFNTLAFS-KHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGH 304
           D R  +  F +     +  + + ++ K S  L +A G D  V ++D R  S PL+ ++ H
Sbjct: 143 DMRSPNRPFYTTTDWHSGASQVQWNYKQSNILASAQGND--VCIWDLRMGSTPLYKLSDH 200

Query: 305 DGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
            G+V N++F+  +   +MTS  D     WD
Sbjct: 201 SGSVNNIDFNKHRGTEIMTSSNDGTVKFWD 230

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 45/90 (50%), Gaps = 21/90 (23%)

Query: 130 TRARYMPQNSNLVATINGS---------GKVFLYDRSKDKHSGLVSTFEYHKENGYGLSF 180
           ++ ++  + SN++A+  G+         G   LY  S   HSG V+  +++K  G     
Sbjct: 162 SQVQWNYKQSNILASAQGNDVCIWDLRMGSTPLYKLSD--HSGSVNNIDFNKHRG----- 214

Query: 181 NCNDAGKLLSGSDDGTIALWNVNNSNSSPI 210
                 ++++ S+DGT+  W+ + S++ P+
Sbjct: 215 -----TEIMTSSNDGTVKFWDYSKSSTRPM 239

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 76/172 (44%), Gaps = 20/172 (11%)

Query: 180 FNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSV 237
           +N  D   L+S S D T  +W++     SP YV + +  H   V D ++ +   ++F S 
Sbjct: 254 WNTVDTNLLVSSSIDTTCIVWDL----QSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASC 309

Query: 238 SEDSTLQLHDQREKDTFTSQFK----------VDAPFNTLAFSKHSQY---LFAAAGTDS 284
             D ++++ D R     T  ++          V A  N L   + S     + A    DS
Sbjct: 310 GGDGSVRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADS 369

Query: 285 H-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
             + + D R+   P  ++ GH   V  +++ P +  +L++  +D + + WD+
Sbjct: 370 KDILILDMRNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 215 SVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAP-FNTLAFSKHS 273
           S H D V    W+N   ++  S S D  +   D R  D+F  + +  +     L ++  S
Sbjct: 331 SGHKDRVACLSWNN---HILTSGSRDRRILHRDVRVPDSFFERIETHSQEVCGLKWNPES 387

Query: 274 QYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG--EDRRAI 331
             L A+ G D+ VY++D    S P+     H  AV  + +SP + GIL + G   DR+  
Sbjct: 388 NKL-ASGGNDNMVYVYDGTSRS-PVLKFEEHTAAVKALAWSPHKRGILASGGGTADRKLK 445

Query: 332 IWDI 335
            W++
Sbjct: 446 TWNV 449

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 98/253 (38%), Gaps = 36/253 (14%)

Query: 142 VATINGSGKVFLYDRSKDKH----SGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           +A+ +  G + ++D S+       SG  ++    K  G GL         L +GS D TI
Sbjct: 251 LASASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWGGQGL---------LYTGSHDKTI 301

Query: 198 ALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQ 257
            +W++       I +  S H+  VN    S       G    D       Q  +D     
Sbjct: 302 RVWDIKAGGKC-INILKS-HAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIAKKN 359

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317
           ++       +  S   + L   A  D  ++L++    ++PL  M GH   V ++ FSPD 
Sbjct: 360 YE-----KVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPDG 414

Query: 318 DGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377
             I+  S  D    +W            D  DG  + +    GH +++   + + +   L
Sbjct: 415 RYIVSAS-FDNSIKLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR-L 458

Query: 378 MASSEEENIIQVW 390
           + S  ++  ++VW
Sbjct: 459 LVSCSKDTTLKVW 471

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 15/110 (13%)

Query: 288 LFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDA 347
           +F  R I+R   ++AGH   +    F+PD    ++T   D  A IWD       Q P   
Sbjct: 126 VFKVRPITRSSAAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDC----ATQTP--- 178

Query: 348 EDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLP 397
                  L +  GH + +   + +P+   L+A+   +N I++W+     P
Sbjct: 179 -------LSVLKGHSNWVLCVAWSPDGE-LIATGSMDNTIRLWESKAGKP 220

>TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1124

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 65/138 (47%), Gaps = 4/138 (2%)

Query: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE--KDTFTS 256
           +WN+  ++S+ I      H   + D  ++    ++  + S D+ +   D R   +  +T+
Sbjct: 95  IWNLERNSSNAIEYSLHGHFRAITDINFNREHPDILATCSLDTYVHAWDLRSPSRPFYTT 154

Query: 257 QFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPD 316
              + A        K S  L ++ G  ++V ++D R+ S PL ++ GH G V +++F+ +
Sbjct: 155 SDWISAASQVKWNFKDSNILASSHG--NNVCIWDLRNGSVPLKTLKGHTGGVNSVDFNRN 212

Query: 317 QDGILMTSGEDRRAIIWD 334
           +   LMT   D     WD
Sbjct: 213 KKTELMTCSNDGYVKFWD 230

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 67/155 (43%), Gaps = 9/155 (5%)

Query: 183 NDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDST 242
           N    +  G  +G I +++V  +    I   S  H+D      W++   ++  S S D T
Sbjct: 478 NTGSHIAIGQSNGIIEIYDV--TKRKCIRTLSG-HTDRTACLSWNS---HILTSGSRDRT 531

Query: 243 LQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMA 302
           +   D R KD F  + K             S     + G D+ V ++D   +  PL ++ 
Sbjct: 532 ILHRDVRMKDPFFERIKSHTQEVCGLKWNESDNKLVSGGNDNTVNIYDG-CMPTPLLTLD 590

Query: 303 GHDGAVTNMEFSPDQDGILMTSG--EDRRAIIWDI 335
            H  AV  + +SP + GIL T G   DR+  IW+I
Sbjct: 591 EHTAAVKALAWSPHKRGILATGGGTADRKLKIWNI 625

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 62/147 (42%), Gaps = 30/147 (20%)

Query: 264 FNTLAFSKHSQYLFAAAG-TDSHVYLF------------DRRDISRPLHSMAGHDGAVTN 310
            ++L FS  S Y  AA G  DS++ ++            +   I+    ++ GH  AV +
Sbjct: 708 MSSLDFS--SDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYS 765

Query: 311 MEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSM 370
           + FSP    +L  SG D+ A +W            D   G    L+ + GH   I D + 
Sbjct: 766 VNFSPCNRFLLSGSG-DKTARLWST----------DTYKG----LVSYKGHEKPIWDVNF 810

Query: 371 NPNIPWLMASSEEENIIQVWKCSHKLP 397
           +P    L A++  +N  +VW C    P
Sbjct: 811 SPTGNNLFATASSDNTARVWSCDRVYP 837

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 98/236 (41%), Gaps = 33/236 (13%)

Query: 167 TFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALW-------NVNNSNSSPI-YVWSSV-- 216
           T+   ++N   L F+  D     +G  D  I +W       N N  N S I  ++ ++  
Sbjct: 700 TYTNTEKNMSSLDFSS-DYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVG 758

Query: 217 HSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYL 276
           HSD V    +S  +  +  S S D T +L          S    + P   + FS     L
Sbjct: 759 HSDAVYSVNFSPCNRFLL-SGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNL 817

Query: 277 FAAAGTD--SHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           FA A +D  + V+  DR     P+  +AGH   V  + F P+   +  T   D+ + +WD
Sbjct: 818 FATASSDNTARVWSCDR---VYPVRILAGHLSDVDCVSFHPNGQYVF-TGSSDKTSRMWD 873

Query: 335 ICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           +               + + + +  GH SA+   +++P+  WL  ++ E+  I VW
Sbjct: 874 LS--------------SGDSVRLFIGHSSAVTATAVSPDGRWLSTAN-EDGTITVW 914

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 9/192 (4%)

Query: 145 INGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN 204
           ++GSG       S D + GLVS ++ H++  + ++F+        + S D T  +W+ + 
Sbjct: 776 LSGSGDKTARLWSTDTYKGLVS-YKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCDR 834

Query: 205 SNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPF 264
               P+ + +   SD+  DC   + +     + S D T ++ D    D+        +  
Sbjct: 835 V--YPVRILAGHLSDV--DCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAV 890

Query: 265 NTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDG-ILMT 323
              A S   ++L + A  D  + ++D     + L SM GH G  +    S ++ G IL++
Sbjct: 891 TATAVSPDGRWL-STANEDGTITVWDIGS-GKKLKSMRGH-GKNSIYSLSYNKTGNILVS 947

Query: 324 SGEDRRAIIWDI 335
           SG D    +WDI
Sbjct: 948 SGADNSVRVWDI 959

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 84/193 (43%), Gaps = 8/193 (4%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDC 224
           ++ +  HK     L F       LLSG +D  I LW+  +     +      HS  + D 
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERE--LLRTYEGHSMTIKDL 185

Query: 225 KWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDS 284
            +++ + + F S S D  +++ +  EK     + + ++  N + F    +       ++S
Sbjct: 186 NFTD-NGHSFASASFDKWVKIWNT-EKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNS 243

Query: 285 HVYLFDRR--DISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-ICDIGVE 341
            +  +D R  +    +     H G++  +++ PD    L++S ED+   IW+   +I ++
Sbjct: 244 EIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKK-LISSSEDKTVRIWENRINIPIK 302

Query: 342 QIPDDAEDGAPEV 354
           QI   A+   P +
Sbjct: 303 QISGTAQHSMPWI 315

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 34/88 (38%), Gaps = 14/88 (15%)

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHR 362
           GH    T++ F P    +L++ G D    +WD                  E+L  + GH 
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYH-------------ERELLRTYEGHS 179

Query: 363 SAINDFSMNPNIPWLMASSEEENIIQVW 390
             I D +   N     AS+  +  +++W
Sbjct: 180 MTIKDLNFTDN-GHSFASASFDKWVKIW 206

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 75/208 (36%), Gaps = 51/208 (24%)

Query: 171 HKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFD 230
           H E    +SFN  D+ K ++ SDD  + +WN +N       V S  H D V  C W +  
Sbjct: 164 HTECIRDISFNNADS-KFVTCSDDNILKIWNFSNGQQE--RVLSGHHWD-VKSCDW-HPT 218

Query: 231 LNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
           + +  S S+D+ ++L D R  +  ++  K         F      L  A   D    +FD
Sbjct: 219 MGLIASASKDNLIKLWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFD 278

Query: 291 RR--------------------------------------------DISRPLHSMA-GHD 305
            R                                            D+S P HS+   HD
Sbjct: 279 IRHSMKELMVVRDEVDYMTLLWHPINESVFTVGNYDGSLKHFDILQDLSNPTHSIPFAHD 338

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIW 333
             +T+M ++     +L ++ +DR    W
Sbjct: 339 KCITSMSYNA-MGTVLASASKDRTVRFW 365

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 87/204 (42%), Gaps = 30/204 (14%)

Query: 141 LVATING-----SGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDG 195
           +VAT NG     +G  F ++     H   V+T +Y            N    ++SG  DG
Sbjct: 97  VVATYNGEFSLWNGSSFNFESLMQAHDSAVTTMKY-----------SNAGDWMVSGDTDG 145

Query: 196 TIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL----HDQREK 251
            I +W     N + +    + H++ + D  ++N D + F + S+D+ L++    + Q+E+
Sbjct: 146 NIKIW---QPNFNMVKELENAHTECIRDISFNNAD-SKFVTCSDDNILKIWNFSNGQQER 201

Query: 252 DTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNM 311
                 + V +          +  L A+A  D+ + L+D R     + ++      V   
Sbjct: 202 VLSGHHWDVKS-----CDWHPTMGLIASASKDNLIKLWDPRS-GNCVSTILKFKHTVLKT 255

Query: 312 EFSPDQDGILMTSGEDRRAIIWDI 335
            F P +  +L+   +D+   ++DI
Sbjct: 256 RFQPTKGNLLVAISKDKSCRVFDI 279

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 89/240 (37%), Gaps = 36/240 (15%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLS-GSDDGTIALWNVNNSNSSPIYVWSSV------- 216
           V  + +H  NG       +D  +L + G  D TI +W ++ S    I    +        
Sbjct: 489 VCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSAT 548

Query: 217 ---HSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDA---PFNTLAFS 270
              HS  V    +S  D     S SED T++L      DTFT          P   + FS
Sbjct: 549 LVGHSGPVYSVAFSP-DNRYLLSASEDKTVRLWSL---DTFTCLVCYKGHNHPVWYVKFS 604

Query: 271 KHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRA 330
               Y F  A  D    L+    I  PL   +GH   V    F P+    + T   D+  
Sbjct: 605 PLGHY-FITASHDQTARLWSCDHI-YPLRIFSGHLNDVDCSTFHPN-GCYVFTGSSDKTC 661

Query: 331 IIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
            +WDI      Q  D         + +  GH S +    ++P+  WL   SE+  II VW
Sbjct: 662 RMWDI------QTGDS--------VRLFLGHTSPVTALEVSPDGRWLTTGSEDGTII-VW 706

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 76/178 (42%), Gaps = 24/178 (13%)

Query: 161 HSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI 220
           HSG V +  +  +N Y           LLS S+D T+ LW+++       Y     H+  
Sbjct: 552 HSGPVYSVAFSPDNRY-----------LLSASEDKTVRLWSLDTFTCLVCY---KGHNHP 597

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQL--HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFA 278
           V   K+S    + F + S D T +L   D        S    D   +T  F  +  Y+F 
Sbjct: 598 VWYVKFSPLG-HYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCST--FHPNGCYVFT 654

Query: 279 AAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIWDI 335
            + +D    ++D +     +    GH   VT +E SPD  G  +T+G ED   I+WDI
Sbjct: 655 GS-SDKTCRMWDIQ-TGDSVRLFLGHTSPVTALEVSPD--GRWLTTGSEDGTIIVWDI 708

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 16/98 (16%)

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA 359
           ++ GH G V ++ FSPD +  L+++ ED+   +W +                   L+ + 
Sbjct: 548 TLVGHSGPVYSVAFSPD-NRYLLSASEDKTVRLWSLDTF--------------TCLVCYK 592

Query: 360 GHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLP 397
           GH   +     +P   + + +S ++   ++W C H  P
Sbjct: 593 GHNHPVWYVKFSPLGHYFITASHDQT-ARLWSCDHIYP 629

>Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 58/134 (43%), Gaps = 28/134 (20%)

Query: 215 SVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQ 274
           S H D V    W+N   +V  S S D  +   D R  D F         F T+    H+Q
Sbjct: 341 SGHVDRVACLSWNN---HVLTSGSRDHRILHRDVRMPDPF---------FETI--ESHTQ 386

Query: 275 YL-----------FAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMT 323
            +            A+ G D+ V++++    S P+ +   H  AV  M +SP + GIL T
Sbjct: 387 EVCGLKWNVIDNKLASGGNDNMVHVYEGTSKS-PILTFDEHKAAVKAMAWSPHKRGILAT 445

Query: 324 SG--EDRRAIIWDI 335
            G   DRR  IW++
Sbjct: 446 GGGTADRRLKIWNV 459

>YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}
           PEX7Peroxisomal signal receptor for the N-terminal
           nonapeptide signal (PTS2) of peroxisomal matrix
           proteins; WD repeat protein; defects in human homolog
           cause lethal rhizomelic chondrodysplasia punctata (RCDP)
          Length = 375

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 101/262 (38%), Gaps = 62/262 (23%)

Query: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199
           N V    G G + L+D +  +    ++ F+ H+   +  ++N  +    LS S DG+I +
Sbjct: 74  NQVLVAQGDGTLRLFDTTFKEFP--IAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKI 131

Query: 200 WNVNNSNS------SPI------------------YVWSSVHSDIVNDCKWSNFDLNVFG 235
           W+     S       P+                  +   S + + V   ++S  D N+  
Sbjct: 132 WSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVL 191

Query: 236 SVSEDSTLQLHDQR-----EKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFD 290
           S S +S   L D R      ++ F     ++A   T  F+K+  Y+ A  G D+ + ++D
Sbjct: 192 SCSGNSYASLFDIRLPSGKNQNNFLVHSGLEAL--TCDFNKYRPYVVATGGVDNAIRIWD 249

Query: 291 ------------RRDISRPLHSMA-------GHDGAVTNMEFSPDQDGILMTSGEDRRAI 331
                       +R +   LH+ +        H  A+  + +SP    ILM++  D    
Sbjct: 250 IRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCR 309

Query: 332 IWDICDIGVEQIPDDAEDGAPE 353
           IW           D + DGA E
Sbjct: 310 IWR----------DLSNDGAKE 321

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 75/180 (41%), Gaps = 41/180 (22%)

Query: 131 RARYMPQNSNLVATINGSGKVFLYD----RSKDK-----HSGLVS-TFEYHKENGYGLSF 180
           +A++ P + NLV + +G+    L+D      K++     HSGL + T +++K   Y ++ 
Sbjct: 179 QAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFLVHSGLEALTCDFNKYRPYVVA- 237

Query: 181 NCNDAGKLLSGSDDGTIALWNV-----NNS------------NSSPIYVWSSVHSDIVND 223
                    +G  D  I +W++     N S            NSS I    + H   +  
Sbjct: 238 ---------TGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRK 288

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNT----LAFSKHSQYLFAA 279
             WS    N+  S S D T ++      D     +K ++   T      F++HS+++F A
Sbjct: 289 VTWSPHHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNFTQHSEFVFGA 348

>YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40
           repeat-containing subunit of the Set3C histone
           deacetylase complex, which represses early/middle
           sporulation genes; antagonizes telomeric silencing;
           binds specifically to the Sir4p N-terminus
          Length = 535

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 68/170 (40%), Gaps = 26/170 (15%)

Query: 149 GKVFLYDRSKDK-------HSGLVSTFEYHKENGYGLSFNCNDAGKLL-SGSDDGTIALW 200
           G +F+Y  ++         H G +S  E+            ND  KLL S SDDGT+ +W
Sbjct: 339 GAIFVYQITEKTPTGKLIGHHGPISVLEF------------NDTNKLLLSASDDGTLRIW 386

Query: 201 NVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV 260
           +  N NS   +     HS  +    W   D  +  S S D +++L   ++          
Sbjct: 387 HGGNGNSQNCFYG---HSQSIVSASWVGDDKVI--SCSMDGSVRLWSLKQNTLLALSIVD 441

Query: 261 DAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTN 310
             P      S+  Q  +A A  D  V ++D + ++    S+ G+   + N
Sbjct: 442 GVPIFAGRISQDGQK-YAVAFMDGQVNVYDLKKLNSKSRSLYGNRDGILN 490

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 110/256 (42%), Gaps = 31/256 (12%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSN 206
           G   V LYD  +  +   V++FE H+ N   +SF   D   ++S S+DGTI +W+V    
Sbjct: 51  GHQNVRLYD-IRTTNPNPVASFEGHRGNVTSISFQ-QDNKWMVSSSEDGTIKVWDVR--- 105

Query: 207 SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKV--DAPF 264
            +P    +  H+  VN+    + +     S   D  +++ D  E +  T Q     D P 
Sbjct: 106 -APSVPRNYKHNAPVNEVV-IHPNQGELISCDRDGNIRIWDLGE-NQCTHQLTPEDDTPL 162

Query: 265 NTLAFSKHSQYLFAAAGTDSHVYLFD---RRDIS--RPLHSMAGHDGAVTNMEFSPDQDG 319
            +L+ +     +  AA +  + Y+++   R D S  +P+     H   +T +  S D   
Sbjct: 163 QSLSLASDGS-MLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKH 221

Query: 320 ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMA 379
            L T   D  A +W I             D   E+     GH+  + D + + +  +L+ 
Sbjct: 222 -LATCSADHTARVWSI-------------DNNFELETTLDGHQRWVWDCAFSADSAYLVT 267

Query: 380 SSEEENIIQVWKCSHK 395
           +S  ++ +++W  S K
Sbjct: 268 AS-SDHYVRLWDLSTK 282

>Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}
           YKL213C (REAL)
          Length = 717

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 12/105 (11%)

Query: 234 FGSVSEDSTLQL--HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSH---VYL 288
             SVS D T++L   D + KDT    +K D   N++ +    + L    G D+    V L
Sbjct: 27  IASVSRDGTVRLWTKDDQWKDTVV--YKGDGFLNSVCYDSEKELLL-FGGKDTMINGVPL 83

Query: 289 FDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
           F       PL+++ GH+G V ++ F   QDGI+++   D+ A +W
Sbjct: 84  FATLG-EDPLYTLIGHEGNVCSLCF---QDGIVVSGSWDKTAKVW 124

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 70/163 (42%), Gaps = 13/163 (7%)

Query: 182 CNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDS 241
           C   G ++SGS D T  +W     + S +Y   + HS  V D K  +   N F + S D 
Sbjct: 106 CFQDGIVVSGSWDKTAKVWK----DGSLVYDLQA-HSASVWDAKVVSLTENKFLTASADK 160

Query: 242 TLQL-HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300
           T++L  + +   TFT           +    H    F +   D  + L D     + L +
Sbjct: 161 TIKLWQNDKVIKTFTGIHNDVVRHLAMVDDGH----FISCSNDGLIKLVDIH-TGKVLKT 215

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQI 343
             GH+  V  ++  P+ D  +++ GEDR   +W   D  ++Q+
Sbjct: 216 YEGHESFVYCVKLLPNGD--IVSCGEDRSIRVWSKEDGSLKQV 256

>NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663
          Length = 384

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 66/147 (44%), Gaps = 26/147 (17%)

Query: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
           FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G++TN++F
Sbjct: 31  FTPIFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKF 89

Query: 314 SPDQ----DG------ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRS 363
           S  +    DG       L+++ ED + IIW + D               E      GH +
Sbjct: 90  SKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKD--------------WENFGTLKGHIA 135

Query: 364 AINDFSMNPNIPWLMASSEEENIIQVW 390
            IND  ++P+    ++ SE+ + I++W
Sbjct: 136 RINDVDIHPSNRVAISVSEDHS-IRLW 161

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 17/119 (14%)

Query: 284 SHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQI 343
           S + L+D R +   LH   GH+G V  ++F P Q  I  +SG+D    +W +        
Sbjct: 33  STIQLWDYR-MGTLLHRFEGHEGPVRGIDFHPTQP-IFASSGDDSTIKLWSL-------- 82

Query: 344 PDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENI-IQVWKCSHKLPRVGG 401
                    + L    GH   I     +  +PW++++S+++ I I  W+   +L  + G
Sbjct: 83  ------DTNKCLYTFTGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKELACITG 135

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 72/177 (40%), Gaps = 35/177 (19%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
           ++SGSDD  + LW ++ + +  +      HS+ V DC   +   N+  S  ED TL++ D
Sbjct: 223 IVSGSDDRQVKLWRMSATKAWEVDTCRG-HSNNV-DCVIFHPHQNLIISAGEDKTLRVWD 280

Query: 248 QREKDTFTSQFKVD---------APFNTLAFSKH--------------------SQYLFA 278
             +K     QFK D          P   L  + H                    +Q +F 
Sbjct: 281 -LDKRMPVKQFKRDDDRFWLIAAHPHINLFGAAHDSGIMIFKLDRERPPNVVHQNQLIFV 339

Query: 279 AAGTDSHVYLFDRRDISRPLHSMAGHD---GAVTNMEFSPDQDGILMTSGEDRRAII 332
                   + F ++  S P  ++ G      +  N+ ++P Q  +L+ + +D+ A++
Sbjct: 340 NKSKQIQAFDFQKKVTSLPYINLKGIGELWSSFRNISYNPSQHSVLVNTADDKFALV 396

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 47/245 (19%), Positives = 96/245 (39%), Gaps = 66/245 (26%)

Query: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVND 223
           L+  FE H+    G+ F+        S  DD TI LW+++                  N 
Sbjct: 45  LLHRFEGHEGPVRGIDFHPTQP-IFASSGDDSTIKLWSLD-----------------TNK 86

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTD 283
           C +                          TFT          T+ F K   ++ +A+  D
Sbjct: 87  CLY--------------------------TFTGHLDY---IRTVFFHKELPWIISASD-D 116

Query: 284 SHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIG---- 339
             + +++ ++  + L  + GH+  V   +F P +D +++++  D    +WDI  +     
Sbjct: 117 QTIRIWNWQN-RKELACITGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISALRKKHS 174

Query: 340 --VEQIPD---------DAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQ 388
             V+++ +         D+  G   V  I  GH   +N  + +P +P +++ S++   ++
Sbjct: 175 APVDRLEEMMIQQQNLLDSGFGDYVVKFILEGHTRGVNWATFHPTLPLIVSGSDDRQ-VK 233

Query: 389 VWKCS 393
           +W+ S
Sbjct: 234 LWRMS 238

>CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {ON}
           similar to uniprot|P36037 Saccharomyces cerevisiae
           YKL213c DOA1
          Length = 715

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 232 NVFGSVSEDSTLQLHDQREKDTF--TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLF 289
           N   SVS D +L++  +     +     ++ D   N + + K SQ ++   G D+ +   
Sbjct: 24  NKIASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAVCYDKTSQTVYYG-GQDTLINGS 82

Query: 290 DRRDI----SRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
              D+    + P++++ GH G V  + F   Q+G+L++S  D+ A IWD
Sbjct: 83  HIEDVIGSSADPMYTLVGHTGNVCGLRF---QNGLLLSSSWDKTAKIWD 128

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 73/175 (41%), Gaps = 27/175 (15%)

Query: 184 DAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSVSEDS 241
           D   L+S S D T  +W++ +SN    YV + +  H   V D ++      +F S   D 
Sbjct: 247 DTNILISSSIDTTCIVWDLQSSN----YVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 302

Query: 242 TLQLHDQR--------------EKDTFTSQFKVDA------PFNTLAFSKHSQYLFAAAG 281
           ++++ D R              E  T  +  + D+          L  S H   + A   
Sbjct: 303 SVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFA 362

Query: 282 TDSH-VYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
             S+ + + D R+   PL  + GH  ++  +++ P +   L++  +D + + WDI
Sbjct: 363 IASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 74/187 (39%), Gaps = 20/187 (10%)

Query: 165 VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNN------SNSSPIYVWSSVHS 218
           V+  + H      L FN   +  L+SG   G I +W+ N       S   P    + +  
Sbjct: 97  VAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQGYSPFGPGVAMTPIEE 156

Query: 219 DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLA--------FS 270
             V    W+    +VF S        + D + K          +P + L           
Sbjct: 157 --VQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVI-HLSYTSPTSGLKNQLSVVEWHP 213

Query: 271 KHSQYLFAAAGTDSH--VYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGED 327
            +S  +  A G D+   + ++D R+ + PL  ++ GH   + ++++    D ++++SG D
Sbjct: 214 SNSTKVATATGNDNEPVILVWDLRNSNAPLKVLSQGHSKGILSLDWCQQDDKLMISSGRD 273

Query: 328 RRAIIWD 334
              I+W+
Sbjct: 274 NTCILWN 280

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 17/143 (11%)

Query: 162 SGL---VSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL-WNVNNSNSSPIYVWSSVH 217
           SGL   +S  E+H  N   ++          +G+D+  + L W++ NSN+ P+ V S  H
Sbjct: 200 SGLKNQLSVVEWHPSNSTKVA--------TATGNDNEPVILVWDLRNSNA-PLKVLSQGH 250

Query: 218 SDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDA--PFNTLAFSKHSQY 275
           S  +    W   D  +  S   D+T  L +  E    T QF       F T  F+  +  
Sbjct: 251 SKGILSLDWCQQDDKLMISSGRDNTCILWNPEEAQKLT-QFPTRGNWCFKT-KFAPEAPD 308

Query: 276 LFAAAGTDSHVYLFDRRDISRPL 298
           LFA+A  D+ V +   ++++  L
Sbjct: 309 LFASASFDNKVQVQTLQNLANKL 331

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 110/269 (40%), Gaps = 30/269 (11%)

Query: 138 NSN--LVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFN-CNDAGKLLSGSDD 194
           NSN  L+ + + +G V ++D  K K    + T + H     GL      D  +L+SG  D
Sbjct: 161 NSNVWLLCSGDTNGMVKVWDLVKRK---CLHTMQEHSNAVRGLDVREVGDEWQLISGGRD 217

Query: 195 GTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLN-VFGSVSEDSTLQLHDQREKDT 253
               LWN N      +     VH   V  C + N + + +  +   D+ LQ     EK T
Sbjct: 218 NVCTLWNFNLKKKCTLLKTIPVHQQ-VESCGFINHEHDDLIYTAGGDALLQFI-SLEKAT 275

Query: 254 FTSQFK--VDAPF--NTLAFSKHSQ-YLFAAAGTDSHV-----YLFDRRDISRPLHSMAG 303
              + K  ++  F    L   ++ + YL  +  T   V      L +  DI      +AG
Sbjct: 276 MIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIEIESCIAG 335

Query: 304 HDGAVTNMEF-SPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHR 362
           ++G + +M+F  P+ D + + +      II          +P   ++  P  + ++ GH 
Sbjct: 336 NNGTIADMKFVGPNHDKLALATNSPTLRII---------PVPSSEQEELPINVEMYEGHE 386

Query: 363 SAINDFSMNPNIPWLMASSEEENIIQVWK 391
             +N      +  W+  +S++   I VWK
Sbjct: 387 DLLNSLDTTDDGLWMATASKDHTAI-VWK 414

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 65/137 (47%), Gaps = 2/137 (1%)

Query: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE-KDTFTSQ 257
           +WN++ S+S+ +      HS  + D  +   +  +  + S D+ +   D R  +  F S 
Sbjct: 95  VWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSA 154

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317
               A    + ++  +  + A+A ++  ++++D R    PLH + GH  +V +++FS   
Sbjct: 155 SVWSAGAAQVKWNFKNPNVMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFN 213

Query: 318 DGILMTSGEDRRAIIWD 334
           +  +M+S  D     WD
Sbjct: 214 ETEIMSSSNDGTVKFWD 230

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 98/216 (45%), Gaps = 28/216 (12%)

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYH------KENGYGLSFNC----ND 184
           M QN     +IN SG+   +  SK    G +  +E+       K+ G+  S N      D
Sbjct: 288 MGQNPVNTVSINSSGEWLAFGSSK---LGQLLVYEWQSESYILKQQGHFDSLNALTYSPD 344

Query: 185 AGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQ 244
             ++++ ++DG I +W+V    S    V    H+  V   +++     +F S S D T++
Sbjct: 345 GSRVVTAAEDGKIKVWDV---ISGFCLVTLEGHTSSVTAVQFAKRGQVLF-SASLDGTVR 400

Query: 245 LHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA--GTDSHVYLFDRRDISRPLH 299
             D    R    FT+  ++   FN LA     + + A +    D HV+       S+ L 
Sbjct: 401 AWDLIRYRNFRVFTAAERIQ--FNCLAVDPSGECVCAGSVDSFDIHVW---SVQTSQLLD 455

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           +++GH+G V+ + FS  ++ +L ++  D+   IW I
Sbjct: 456 TLSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSI 490

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 6/97 (6%)

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDIC-DIGVEQIPDDAEDGAPEVL---MIH 358
           GH   V + +FSP  D I+ +  +D +  IW+I  D G+ +  D  E+G P+ L    + 
Sbjct: 91  GHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVD--EEGNPKDLKPVRML 148

Query: 359 AGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHK 395
           +GH   +     +P    ++ASS  +  +++W  S +
Sbjct: 149 SGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQE 185

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 296 RPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDIC 336
           +P+  ++GH   V ++ F P  + IL +S  D    IWDI 
Sbjct: 143 KPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDIS 183

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 32/174 (18%)

Query: 188 LLSGSDDGTIALWNV--------------NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNV 233
           + SGSDDG I +W +              N  +  P+ + S  HS  V    +     N+
Sbjct: 109 VASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSG-HSRKVGHLLFHPLAENI 167

Query: 234 FGSVSEDSTLQLHDQREKDTFTSQFKVDAP--FNTLAFSKHSQYLFAAAGTDSHVYLFDR 291
             S S D T+++ D  +++    +F +  P    +++FS   ++L   +  D  + ++D 
Sbjct: 168 LASSSLDYTVKIWDISQEEV---KFTLKHPDMVTSMSFSYDGKHLVTVS-RDKKLRVWDV 223

Query: 292 RD---ISR-PLHSMAGHDGAVTNMEFSPDQDGILMTSG---EDRRAIIWDICDI 338
           R    +S  P HS A +   V    +  D D +  T      DR+  +WD  ++
Sbjct: 224 RAEKIVSEGPAHSGAKNQRVV----WLGDTDKVATTGFSRLSDRQIGVWDAFNL 273

>TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON}
           Anc_2.663 YKL021C
          Length = 390

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 62/152 (40%), Gaps = 30/152 (19%)

Query: 253 TFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNME 312
            FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G++T + 
Sbjct: 30  VFTPIFHFQAHTLSVKCLDISKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITTLR 88

Query: 313 FS--------------PDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIH 358
           FS              P     L+++ ED + IIW + D               E   + 
Sbjct: 89  FSNSAKEKQEEGSEIKPSASKWLLSASEDNKIIIWRVRDW--------------ENFGVL 134

Query: 359 AGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
            GH + IND  ++P+   +  S  E++ I++W
Sbjct: 135 KGHTARINDLDIHPS-NRIAVSVSEDHSIRLW 165

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 104/216 (48%), Gaps = 28/216 (12%)

Query: 135 MPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYH------KENGYGLSFNC----ND 184
           M QN     T+N +G+   +  SK    G +  +E+       K+ G+  S N      D
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSK---LGQLLVYEWQSESYILKQQGHFDSTNSLTYSPD 352

Query: 185 AGKLLSGSDDGTIALWNVNNSNSSPIYVWSSV--HSDIVNDCKWSNFDLNVFGSVSEDST 242
             ++++ ++DG I +W+V +      +  +++  H+  V   +++     +F S S D T
Sbjct: 353 GSRVVTAAEDGKIKVWDVVSG-----FCLATLDEHTAAVTQVQFAKKGQVLF-SASLDGT 406

Query: 243 LQLHD---QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLH 299
           ++  D    R    FT+  ++   FN+LA     + + A +  +  ++++  +   + L 
Sbjct: 407 VKAWDLIRYRNFRVFTAAERIQ--FNSLAVDPSGEVVCAGSMDNFDIHVWSVQ-TGQLLD 463

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           S++GH+G V+ + FS  ++G+L ++  D+   IW I
Sbjct: 464 SLSGHEGPVSCLAFS-QENGVLASASWDKTIRIWYI 498

>KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|Q12523 Saccharomyces
           cerevisiae YPL247C Hypothetical ORF
          Length = 493

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%)

Query: 276 LFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           +   A   + + + D R    PL ++ GH G V  +++ P + G+L++ G+D + + WD
Sbjct: 371 IVTVAQDSNAIIVLDMRYPGTPLLTLEGHIGPVNQVQWHPKKSGVLVSCGDDCQVLYWD 429

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 72/178 (40%), Gaps = 36/178 (20%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189
           +R ++MPQN+  +AT + S +++  D S  +   L S ++Y K                 
Sbjct: 134 SRIQWMPQNNTRLATCSDSLRIWSLDGSLQEQINL-SLYKYGKHPS-------------- 178

Query: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249
           S S   T+ L  +      P+   +S H        WS    N+  S S D+T  + D  
Sbjct: 179 SASQKDTVTLGQL-----PPV---TSFH--------WSPISPNLLLSCSIDTTCTVWDLS 222

Query: 250 EKDTF--TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHD 305
               +  T     D+    + F   S  LFA+ G D  V +FD R ++   HS   +D
Sbjct: 223 NSTNYVKTQLIAHDSEVFDVKFLAQSTQLFASCGGDGSVRVFDLRSLA---HSTIVYD 277

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 81/183 (44%), Gaps = 23/183 (12%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDL---NVFGSVSEDSTLQ 244
           LL+G  +G I L + N     P+    +  + I ND K  + D    N+  S S DS ++
Sbjct: 29  LLTGLSNGEICLLDWNTGK--PLQKIRASETAI-NDMKIIDSDFVAGNLISSASIDS-VK 84

Query: 245 LHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT-----DSHVYLFDRRDISRPLH 299
           + D R  D      K++   N+   S  S++   A GT     D+ ++++D R    PL 
Sbjct: 85  VFDIRSNDCVA---KINNETNSPFLSLDSRHGLLACGTELQGIDAAIHIYDVRKWDAPLR 141

Query: 300 SMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIH 358
           S+   H   VT ++F P    +L++   D    I+D+         DD ED   +V+   
Sbjct: 142 SLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL-------KQDDEEDALHQVINYA 194

Query: 359 AGH 361
           + H
Sbjct: 195 SIH 197

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 16/97 (16%)

Query: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG 360
           + GH GA+ +  FSPD + +L+++ ED+   +W +                   L+ + G
Sbjct: 549 LVGHSGAIYSTSFSPD-NKLLVSASEDKTIRLWSM--------------DTRTTLVTYKG 593

Query: 361 HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLP 397
           H   + D   +P +    A++  +   ++W C H  P
Sbjct: 594 HNHPVWDVQFSP-VGHYFATASHDQTARLWSCDHIFP 629

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 92/227 (40%), Gaps = 46/227 (20%)

Query: 176 YGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFG 235
           Y  SF+  D   L+S S+D TI LW+++   +   Y     H+  V D ++S    + F 
Sbjct: 557 YSTSFSP-DNKLLVSASEDKTIRLWSMDTRTTLVTY---KGHNHPVWDVQFSPVG-HYFA 611

Query: 236 SVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLF----DR 291
           + S D T +L            +  D  F    FS H   +       +  Y+F    D+
Sbjct: 612 TASHDQTARL------------WSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDK 659

Query: 292 R----DIS--RPLHSMAGHDGAVTNMEFSPDQDGILMTSG-EDRRAIIWDICDIGVEQIP 344
                DI+    +    GH   + ++  +P  DG+ + +G ED    IWDI         
Sbjct: 660 TCRMWDITTGESVRLFIGHTAPILSVAVAP--DGLRLATGSEDGVIHIWDI--------- 708

Query: 345 DDAEDGAPEVLMIHAGH-RSAINDFSMNPNIPWLMASSEEENIIQVW 390
                G  + L    GH +SA+N  S N     ++ S   +N +++W
Sbjct: 709 -----GTGKSLKKLIGHGKSAVNSLSYNKE-SNILVSGGSDNSVRIW 749

>SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 471

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 94/218 (43%), Gaps = 17/218 (7%)

Query: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVND 223
           ++ TF+ H      L F        LSG +D  I +W++ +  +  +      H   V D
Sbjct: 170 IIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERT--LLRDYRGHRKAVRD 227

Query: 224 CKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTD 283
             + N D   F SVS D TL++ D  E     S+ K  +  N   +   +   +    ++
Sbjct: 228 INF-NSDGTEFLSVSFDQTLKVWDT-ETGKVKSRLKWHSVPNCATYHPTNNNEYIVGLSN 285

Query: 284 SHVYLFDRRDISRP--LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD-ICDIGV 340
           S +  +D R  ++   + +   H  ++ ++++ PD     ++S ED+   IW+   +I +
Sbjct: 286 SEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSK-FISSSEDKTVRIWENQVNIPI 344

Query: 341 EQIPDDAEDGAPEVLMIHAGHR--------SAINDFSM 370
           +QI D ++   P  L IH            +AI  FSM
Sbjct: 345 KQISDTSQYSMP-YLEIHPEQHYFSAQSMDNAIYSFSM 381

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 41/93 (44%), Gaps = 14/93 (15%)

Query: 298 LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMI 357
           +++  GH    T ++F P+   + ++ G D    IWD+                  +L  
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYH-------------ERTLLRD 217

Query: 358 HAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           + GHR A+ D + N +    ++ S ++  ++VW
Sbjct: 218 YRGHRKAVRDINFNSDGTEFLSVSFDQT-LKVW 249

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 132 ARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSG 191
           A Y P N+N       + ++  YD       GL+ T+ +H  +   L +   D  K +S 
Sbjct: 269 ATYHPTNNNEYIVGLSNSEIRHYDSRVSNKEGLIQTYNHHLSSIISLKY-FPDGSKFISS 327

Query: 192 SDDGTIALW 200
           S+D T+ +W
Sbjct: 328 SEDKTVRIW 336

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 69/149 (46%), Gaps = 5/149 (3%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247
           ++S S+   I +WN+  S+S+ I      HS  + D  ++    +V  + S D+ +   D
Sbjct: 84  IVSTSNQKAI-IWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWD 142

Query: 248 QR--EKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHD 305
            R   +  +++     A        K    L ++ G D  V+++D R  S PL S+ GH 
Sbjct: 143 MRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGND--VFVWDLRKGSTPLCSLKGHV 200

Query: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
            +V +++F+  +   LM+S  D     WD
Sbjct: 201 SSVNSIDFNRFKSTELMSSSNDGTVKFWD 229

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 60/137 (43%), Gaps = 19/137 (13%)

Query: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRP---LHSMAGHDGAVTNMEFS 314
            KVD  FN ++ +   + +  A+     +Y+ D  D   P   LH +      V ++++S
Sbjct: 20  LKVDGGFNAVSINPSGRDVVLASRQG--LYIIDLDDPFTPPRWLHHIT--PWQVADVQWS 75

Query: 315 PD-QDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPN 373
           P       + S  +++AIIW++           A+  +  +  +  GH  AI D + NP 
Sbjct: 76  PHPAKPYWIVSTSNQKAIIWNL-----------AKSSSNAIEFVLHGHSRAITDINFNPQ 124

Query: 374 IPWLMASSEEENIIQVW 390
            P ++A+   +  +  W
Sbjct: 125 HPDVLATCSVDTYVHAW 141

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/116 (20%), Positives = 49/116 (42%), Gaps = 16/116 (13%)

Query: 276 LFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTS-GEDRRAIIWD 334
           + A    D++V+ +D R   RP +S +    A + ++++     +L +S G D    +WD
Sbjct: 128 VLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGND--VFVWD 185

Query: 335 ICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
           +              G+  +  +  GH S++N    N      + SS  +  ++ W
Sbjct: 186 L------------RKGSTPLCSL-KGHVSSVNSIDFNRFKSTELMSSSNDGTVKFW 228

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 113/260 (43%), Gaps = 35/260 (13%)

Query: 147 GSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSN 206
           G   V LYD  +  +   V+TFE HK N   +SF   D   +++ S+DGTI +W+V    
Sbjct: 71  GYQNVRLYD-IRTTNPNAVATFEGHKGNVTSVSFQ-QDNKWMVTSSEDGTIKVWDVR--- 125

Query: 207 SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVD---AP 263
            SP    +  H+  VN+    + +     S   D T+++ D  E +  T Q   D     
Sbjct: 126 -SPSVPRNYKHNAPVNEVV-IHPNQGELISCDRDGTIKIWDLGE-NQCTHQLIPDDDNTS 182

Query: 264 FNTLAFSKHSQYLFAAAGT-DSHVY-LFDRRDIS--RPLHSMAGHDGAVTNMEFSPDQDG 319
             +L+ +     L AA    D +V+ + +  D S  +P++  + H   +T +  S D   
Sbjct: 183 LQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKH 242

Query: 320 ILMTSGEDRRAIIWDIC----DIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIP 375
            + T   DR A IW +     D  +E   D              GH+  + D + + +  
Sbjct: 243 -MATCSADRTAKIWSVGETEDDFNLETTLD--------------GHQRWVWDCAFSADSA 287

Query: 376 WLMASSEEENIIQVWKCSHK 395
           +L+ +S  ++ +++W  S +
Sbjct: 288 YLVTAS-SDHYVRLWDLSTR 306

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 87/216 (40%), Gaps = 40/216 (18%)

Query: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVS----TFEYHKENGYGLS----FN 181
           T   + P N+  +      G++ LYD+ +  HS   +     F +  E+  G+     F 
Sbjct: 277 TCVSFCPYNTYFIVGTKF-GRILLYDQKEFFHSSNTNEKEPVFVFQTESFKGICCLEWFK 335

Query: 182 CNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNF-DLNVFGSVSED 240
             +  K   G ++G ++L+ +            S+H  I N  K     D N+ G     
Sbjct: 336 PGEICKFYVGEENGNVSLFEIK-----------SLHFPIKNWSKRQKLEDENLIG----- 379

Query: 241 STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300
             L+LH      T+ +Q +       ++ ++H+  L A  G D+   L+D  D+ +P+  
Sbjct: 380 --LKLHS-----TYQAQAQQVC---GISLNEHAN-LLAVGGNDNSCSLWDISDLDKPIKK 428

Query: 301 MA-GHDGAVTNMEFSPDQDGILMTSG--EDRRAIIW 333
               H  AV  + F P    +L T G  +DR    W
Sbjct: 429 FVLPHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFW 464

>Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W
           (REAL)
          Length = 612

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 6/106 (5%)

Query: 141 LVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALW 200
           LVAT + SG++ + D    +H  +VST+E H     GLS+  +D  +L SG +D T+ +W
Sbjct: 356 LVATGSRSGEIQINDVRIKQH--IVSTWEEHTGEVCGLSYK-SDGLQLASGGNDNTVMIW 412

Query: 201 NVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLH 246
           +     S P +     H+  V    W  +  N+  S    +   +H
Sbjct: 413 DTR--TSLPQFS-KKTHTAAVKALSWCPYSPNILASGGGQTDKHIH 455

>KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} similar
           to uniprot|P21304 Saccharomyces cerevisiae YLR196W PWP1
          Length = 579

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 78/161 (48%), Gaps = 14/161 (8%)

Query: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI-VNDCKWSNFDLNVFGSVSEDSTLQLH 246
           L S S D T+ LW++N   ++     +S+HS+  V+  +W +   +V  +   DS + L 
Sbjct: 309 LASTSADHTVKLWDLNEGIAARSV--ASIHSNKNVSSSQWHSTSGSVLLTGGYDSRVALS 366

Query: 247 DQR-EKDTFTSQF---KVDAPFNTLAFSKHSQYLFAAAGTDS-HVYLFDRR--DISRPLH 299
           D R  +D+  S++           + F+  + ++    GTDS +VY FD R  + S+PL 
Sbjct: 367 DVRIAEDSQMSKYWSVMTGEDVECVQFADENTFM---CGTDSGNVYSFDIRQGEGSKPLW 423

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDIG 339
           ++  HD  ++ +  +P    +L T     + +  W I + G
Sbjct: 424 TLNAHDAGISALNVNPFIPNLLATGAMGEKTVKFWKISESG 464

>TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.67
           YFL009W
          Length = 862

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 21/119 (17%)

Query: 275 YLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334
           Y+   A  D  + ++D + + + L  +AGHDG V  +++  D+DGIL++   DR   +WD
Sbjct: 453 YIITGAD-DRMIRVYDSK-LKKFLLELAGHDGGVWALKY--DEDGILVSGSTDRTVRVWD 508

Query: 335 ICDIGVEQIPDDAEDGAPEVLMIHAGHRSAIN--DFSMNPNIPWLMASSEEENIIQVWK 391
           I            + G      I  GH S +   D     N  +++  S +   + VWK
Sbjct: 509 I------------KRGC--CTHIFKGHTSTVRCLDIVKYKNTKYIITGSRDTT-LHVWK 552

>TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON}
           Anc_7.338 YLR208W
          Length = 298

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 120/274 (43%), Gaps = 38/274 (13%)

Query: 142 VATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL-SGSDDGTIALW 200
           +AT +    + +Y+   D H  L++T   H+   + + +     G +L S S DG + +W
Sbjct: 24  LATCSSDKTIKIYEIDGDSHK-LLTTLTGHEGPVWRIDWAHPKFGTILASCSYDGKVIIW 82

Query: 201 NVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLN-VFGSVSEDSTLQLHDQREKDTFTSQFK 259
              N   S I V  SVHS  VN  KW+  +   V  + S D  + + + +E  T  +   
Sbjct: 83  KEENGTWSQIAV-HSVHSASVNSVKWAPHEYGAVLLAASSDGKISVVEFKENGT-QNPMV 140

Query: 260 VDA---PFNTLAFSKHS-------------QYLFAAAGTDS--HVYLFDRRDISRPLH-S 300
           +DA     N+ A++  +                F   G D+   ++ FD+   +  L  +
Sbjct: 141 LDAHAVGVNSAAWAPATIQSPKNPTEKPLPLRRFVTGGADNLVKIWKFDQAANTYILEDT 200

Query: 301 MAGHDGAVTNMEFSPD--QDGILMTSGEDRRAIIWDIC-DIGVEQIPDDAEDGAPEVLMI 357
           + GH   V ++ +SP       + +  +DR  IIW    + GV +     ++  P+VL  
Sbjct: 201 LEGHSDWVRDVTWSPSVLLGSCIASVSQDRTCIIWTQSGNEGVWRKTSLQQERFPDVLW- 259

Query: 358 HAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
               R++   +S++ N+   +A S  +N I +WK
Sbjct: 260 ----RAS---WSLSGNV---LALSGGDNRITLWK 283

>Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C
           (ASC1) - G-beta like protein [contig 54] FULL
          Length = 218

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 48/92 (52%), Gaps = 10/92 (10%)

Query: 300 SMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA 359
           ++ GH+G VT++  SP Q  +L++   D+  I W +         DD + G P  +    
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTG-------DDQQYGVP--VRSFR 62

Query: 360 GHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391
           GH   + D ++ P+  + +++S ++  +++W+
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKT-VRLWE 93

>Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON}
           complement(17489..19777) [2289 nt, 763 aa]
          Length = 762

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 23/103 (22%)

Query: 298 LHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMI 357
           L  ++GHDG V  +++  D+DGIL++   DR   +WDI            + G      +
Sbjct: 421 LLELSGHDGGVWALKY--DEDGILVSGSTDRTVRVWDI------------KRGC--CTHV 464

Query: 358 HAGHRSAIN--DFSMNPNIPWLMASSEEENIIQVWKCSHKLPR 398
             GH S +   D     N+ +++  S  +N + VW    KLPR
Sbjct: 465 FKGHTSTVRCLDIVEYKNVKYIVTGS-RDNTLHVW----KLPR 502

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 96/235 (40%), Gaps = 38/235 (16%)

Query: 165 VSTFEYHKENGYGLSFNC---NDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIV 221
           VS    +  +G+  S +C      G L SGS D T+ +W++N+       + S  H    
Sbjct: 266 VSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAH---- 321

Query: 222 NDCKWSNFDLNVFGSVSEDSTLQL-----HDQREKDTFTSQFKVDAPFNTLAFSK-HSQY 275
               W N       S+S D  L++       Q+      +Q K  A +  +     +S+ 
Sbjct: 322 ----WVNHL-----SLSTDYALRVGAFDHTGQKPTSPEDAQKKALANYEKICKKNGNSEE 372

Query: 276 LFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           +   A  D  ++L++    ++P+  M GH   V ++ FSPD   I+  S  D    +W  
Sbjct: 373 MMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSAS-FDNSIKLW-- 429

Query: 336 CDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
                     D  DG  + +    GH +++   + + +   L+ S  ++  ++VW
Sbjct: 430 ----------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 51/129 (39%), Gaps = 21/129 (16%)

Query: 268 AFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGED 327
           AF+ H+         D+   ++D  D   P+H++ GH   V  + +SPD + ++ T   D
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDC-DTQTPMHTLKGHFNWVLCVAWSPDGE-VIATGSMD 207

Query: 328 RRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFS------MNPNIPWLMASS 381
               +WD         P   E     +     GH   I   S      + P     +ASS
Sbjct: 208 NTIRLWD---------PKTGECLGDAL----RGHSKWITSLSWEPIHLVKPGSKPRLASS 254

Query: 382 EEENIIQVW 390
            ++  I++W
Sbjct: 255 SKDGTIKIW 263

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 46/103 (44%), Gaps = 15/103 (14%)

Query: 288 LFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDA 347
           +F  + ++R   ++AGH   +    F+P     ++T   D  A IWD CD    Q P   
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWD-CD---TQTP--- 178

Query: 348 EDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
                  +    GH + +   + +P+   ++A+   +N I++W
Sbjct: 179 -------MHTLKGHFNWVLCVAWSPDGE-VIATGSMDNTIRLW 213

>TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1262

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 73/203 (35%), Gaps = 33/203 (16%)

Query: 140 NLVATINGSGKVFLYD--RSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197
           N VA  + S  + ++D  R+    S  V+    H  +     FN      ++SG  D  I
Sbjct: 189 NYVAVCSSSTAISVFDMNRTGSSESSFVTALSEHTRSINSFDFNTVQTNLIISGGQDSCI 248

Query: 198 ALWNV---NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF 254
            +W++   N  NS    +  +  SD + D KW  F    F           H Q  K+  
Sbjct: 249 KVWDLRSSNAKNSKNCDLSINTASDSIRDVKWMPFQNYAFN----------HQQEFKNGS 298

Query: 255 TSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFS 314
            + FK                 FA+      +  FD R   +    +  H G    + + 
Sbjct: 299 NAGFK-----------------FASIHYSGLLLNFDLRQPGQIEKRINAHSGPGLCLSWH 341

Query: 315 PDQDGILMTSGEDRRAIIWDICD 337
           P+ + I  T G D +  +W + D
Sbjct: 342 PNLEYI-ATGGRDGKCGLWYVGD 363

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 89/213 (41%), Gaps = 31/213 (14%)

Query: 133 RYMPQNSNLV-ATING-----SGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAG 186
           ++ P+   LV AT +G     +G  F ++     H   V+T EY     +          
Sbjct: 88  KWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDW---------- 137

Query: 187 KLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL- 245
            L+SG  DG I +W     N + + V    H + V D  +S  D + F + S+D+ L++ 
Sbjct: 138 -LISGDSDGIIKIW---QPNFNMVKVLDQAHMECVRDVSFSGTD-SKFVTCSDDNILKIW 192

Query: 246 ---HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMA 302
              + Q+E+      + V +          +  L  +   D+ + L+D R   + + ++ 
Sbjct: 193 NFSNGQQERVLSGHHWDVKS-----CDWHPTMGLIVSGSKDNLIKLWDPRS-GQCISTIL 246

Query: 303 GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335
           G    +   +F P +  +L    +D+   I+DI
Sbjct: 247 GFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDI 279

>Suva_8.91 Chr8 complement(165427..168063) [2637 bp, 878 aa] {ON}
           YOR038C (REAL)
          Length = 878

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249
           SGS DGT+ +WN       P++    V S  +ND  WS   L +F ++S D+TL     +
Sbjct: 296 SGSTDGTVLVWNT--KRMKPLFNALQVSSTAINDMSWSQDGLTLF-AISNDTTLYTFAFQ 352

Query: 250 EKD 252
           EKD
Sbjct: 353 EKD 355

>Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON}
           (85899..87926) [2028 nt, 676 aa]
          Length = 675

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 54/120 (45%), Gaps = 21/120 (17%)

Query: 274 QYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333
           +Y+   A  D  + ++D  D  R L  ++GH+G V  +++  D+DGI+++   DR   +W
Sbjct: 302 EYIITGAD-DKMIRVYDSVD-KRFLLELSGHEGGVWALKY--DEDGIIVSGSTDRSVRVW 357

Query: 334 DICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSM--NPNIPWLMASSEEENIIQVWK 391
           DI                     I  GH S +    +    N+ +++  S  +N + VWK
Sbjct: 358 DI--------------KQGRCTHIFKGHTSTVRCLEIVEYKNVKYIITGS-RDNTLHVWK 402

>SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} similar
           to uniprot|P20484 Saccharomyces cerevisiae YKL021C MAK11
           Protein essential for cell growth and replication of M
           dsRNA virus contains four beta-transducin repeats
          Length = 394

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 65/152 (42%), Gaps = 31/152 (20%)

Query: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313
           FT  F   A   ++     S+    +   D H+ ++D +   + L ++  H G+VTN+ F
Sbjct: 31  FTPIFHFQAHSLSVKCLDVSKRYLVSGSNDEHIRIYDLQK-RKELGTLLSHQGSVTNLRF 89

Query: 314 S----PDQ-----DGI------LMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIH 358
           S    PD      DG       L++S ED + I+W + D               E     
Sbjct: 90  SRGKKPDSSEETVDGKGSGNKWLLSSSEDHKIIVWRVKDW--------------ENFGTL 135

Query: 359 AGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
            GH + IND  ++P+   +  S  +++ I++W
Sbjct: 136 KGHTARINDLDIHPS-NRVAVSVSDDHSIRLW 166

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 297 PLHSMAGHDGAVTNMEFSPDQDG-ILMTSGEDRRAIIWDI 335
           P  S+ GH   V + +F  +++G  L+T G D R ++WD+
Sbjct: 276 PEFSLLGHSNRVKDFKFYNNENGKYLVTVGSDGRIVVWDM 315

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 60/146 (41%), Gaps = 29/146 (19%)

Query: 264 FNTLAFSKHSQYLFAAAGTDSHVYLF--------DRRDISRP----LHSMAGHDGAVTNM 311
             +L FS   + L AA   DS + LF        +R D   P      ++ GH G V + 
Sbjct: 499 MTSLEFSDDCR-LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYST 557

Query: 312 EFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMN 371
            FSPD +  L++S ED+   +W +                   L+ + GH   + D   +
Sbjct: 558 SFSPD-NRYLVSSSEDKTVRLWSL--------------DTHSALVSYKGHNHPVWDVKFS 602

Query: 372 PNIPWLMASSEEENIIQVWKCSHKLP 397
           P +    A++  ++  ++W C H  P
Sbjct: 603 P-LGHYFATASHDHTARLWSCDHIYP 627

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 82/230 (35%), Gaps = 75/230 (32%)

Query: 161 HSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDI 220
           HSG V +  +  +N Y           L+S S+D T+ LW+++  ++    V    H+  
Sbjct: 550 HSGTVYSTSFSPDNRY-----------LVSSSEDKTVRLWSLDTHSA---LVSYKGHNHP 595

Query: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280
           V D K+S    + F + S D T +L            +  D                   
Sbjct: 596 VWDVKFSPLG-HYFATASHDHTARL------------WSCD------------------- 623

Query: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGV 340
               H+Y         PL   AGH   V  + F P+    L T   D+   +WDI     
Sbjct: 624 ----HIY---------PLRIFAGHLNDVDCVSFHPN-GCYLFTGSSDKTCRMWDI----- 664

Query: 341 EQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVW 390
                       + + +  G  + +    ++P+  WL   S E+ II VW
Sbjct: 665 ---------ATGDCVRLFLGLTAPVISTCVSPDGRWLSTGS-EDGIINVW 704

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,018,016
Number of extensions: 2143663
Number of successful extensions: 8863
Number of sequences better than 10.0: 908
Number of HSP's gapped: 7954
Number of HSP's successfully gapped: 1373
Length of query: 411
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 299
Effective length of database: 40,638,807
Effective search space: 12151003293
Effective search space used: 12151003293
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)