Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0F001806.7ON1018101846120.0
Skud_5.346.7ON1019103824240.0
YEL055C (POL5)6.7ON1022103724240.0
Suva_5.136.7ON1023103823760.0
Smik_5.326.7ON1020103923180.0
TDEL0G046406.7ON1017103523030.0
KAFR0L003306.7ON1028104922580.0
KNAG0E009706.7ON1004104421070.0
NDAI0K029106.7ON106373320550.0
KLLA0D00792g6.7ON1020105318630.0
ZYRO0F00440g6.7ON103971018340.0
Ecym_30096.7ON1027106918270.0
ACR020C6.7ON1002104817820.0
Kpol_1045.806.7ON101970417260.0
TBLA0A072106.7ON1041105216990.0
Kwal_56.223346.7ON1008104216270.0
CAGL0B03553g6.7ON102170615500.0
KLTH0C11594g6.7ON1006106015420.0
SAKL0E00770g6.7ON104773215110.0
TPHA0J002506.7ON102471413641e-171
KAFR0F012006.257ON1888124735.7
Suva_3.1106.341ON1376120736.5
TPHA0A018108.262ON45763718.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0F00180
         (1018 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...  1781   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   938   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   938   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   919   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   897   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   891   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   874   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   816   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   796   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   722   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   711   0.0  
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   708   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   691   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   669   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   659   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   631   0.0  
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   601   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   598   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   586   0.0  
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   530   e-171
KAFR0F01200 Chr6 (225381..231047) [5667 bp, 1888 aa] {ON} Anc_6....    33   5.7  
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    33   6.5  
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...    32   8.6  

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score = 1781 bits (4612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/1018 (89%), Positives = 907/1018 (89%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120
            SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR
Sbjct: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120

Query: 121  DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180
            DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES
Sbjct: 121  DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180

Query: 181  CLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSS 240
            CLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSS
Sbjct: 181  CLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSS 240

Query: 241  IEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDIL 300
            IEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDIL
Sbjct: 241  IEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDIL 300

Query: 301  LPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLG 360
            LPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLG
Sbjct: 301  LPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLG 360

Query: 361  FLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSN 420
            FLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSN
Sbjct: 361  FLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSN 420

Query: 421  KLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENK 480
            KLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENK
Sbjct: 421  KLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENK 480

Query: 481  QKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSILA 540
            QKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSILA
Sbjct: 481  QKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSILA 540

Query: 541  ELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSPQ 600
            ELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSPQ
Sbjct: 541  ELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSPQ 600

Query: 601  SPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLA 660
            SPQ                 GETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLA
Sbjct: 601  SPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLA 660

Query: 661  QKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFXXXXXXXXXXXXXX 720
            QKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF              
Sbjct: 661  QKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFEGADEYEEIEDEQE 720

Query: 721  XXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNIDKEATSALAKALNLPENIVND 780
              SNQ                              VNNIDKEATSALAKALNLPENIVND
Sbjct: 721  GESNQSEEKDVSGEESEESEESEIDDEDDSLDTAEVNNIDKEATSALAKALNLPENIVND 780

Query: 781  KGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSTTSTGNQ 840
            KGEVDVAK                               QLSEIFKRRKEALSTTSTGNQ
Sbjct: 781  KGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMMLLDDQLSEIFKRRKEALSTTSTGNQ 840

Query: 841  RKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFVNLISFVEPMVTCVQKTL 900
            RKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFVNLISFVEPMVTCVQKTL
Sbjct: 841  RKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFVNLISFVEPMVTCVQKTL 900

Query: 901  DKSLADKVSKLLKTRIFKIKSSTFKNSANPVXXXXXXXXXXXXXXXXXPGQHPQLYYTLS 960
            DKSLADKVSKLLKTRIFKIKSSTFKNSANPV                 PGQHPQLYYTLS
Sbjct: 901  DKSLADKVSKLLKTRIFKIKSSTFKNSANPVEVLEYLKKLHEKLLTEKPGQHPQLYYTLS 960

Query: 961  SSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
            SSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK
Sbjct: 961  SSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1038 (50%), Positives = 682/1038 (65%), Gaps = 46/1038 (4%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  KVNRDLF+KLASDLQEER  AA++L+K+L+ L LP + EEW+YV+NRLIKGLASDR+
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLALSMKENA-PEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119
            SARLGFSLCLTEV+NL ++M     P+GL++ ++FL  LS  L +  N    G+ K  KG
Sbjct: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVN---DGSKKPVKG 117

Query: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTK-KDGKTEITPFAFKFMNEVVDLALKKNWIK 178
            +DERG+LFGK+FGL+++ NEP+FS +F+   K G TE   F  +FM +++DLAL+KNWI+
Sbjct: 118  KDERGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTE---FVIRFMEQLIDLALRKNWIR 174

Query: 179  ESCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDT 238
            E CLF+LFQTI+ LLP+ N+ T + IL + D ++L+LT+EGL+ YL + Y   +D  L  
Sbjct: 175  EPCLFSLFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKY--ESDESLIP 232

Query: 239  SSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEG-YENSKKQNASNWNPRLHFVW 297
            S+++ +N GWKNNDPL+RGNLPLLT+VLRDSSV   + G  +++KKQ  +NWNPRLHFVW
Sbjct: 233  STLDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVW 292

Query: 298  DILLPILISGKHTTASNTQHISKKRKKNNNELPKH-IEFPEFWQMVVDESFFNEKASSER 356
            D+LLP+  SGK     NT+HI+KKRKK + +  ++ I+FPEFW+M VDESFFNEKASSER
Sbjct: 293  DVLLPLFGSGK---LENTEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSER 349

Query: 357  KYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQE 416
            KYLGFLI   T K V  + + +CFS N MR+LINQS DS+R+L+K++Q  L +I++ C+E
Sbjct: 350  KYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEE 409

Query: 417  DSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEK 476
            D   KLV C+NAM+FGP GSINFDKLTKS  ISKLI+I  L    LA L   F   + EK
Sbjct: 410  DPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEK 469

Query: 477  SENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFF-----AKENEPLNELA 531
              +     ++LD+LLHI+R HK  +    I+ P+L P+I  AFF      +E E L+ELA
Sbjct: 470  RGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELA 529

Query: 532  KERFSSILAELT---SVIPKEPH-HSWQYYALDIILKKERTGKFELVNKLDENLGKIKND 587
            KER  SIL ELT    V  ++P  +SWQY  L++IL  E++ K +L+N LDE+L KIKN+
Sbjct: 530  KERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNE 589

Query: 588  ACDVIVKIIKSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTS 647
            A   + +I KS  + Q                 GET+S+S IEEL EF K      ++ S
Sbjct: 590  AISSLAEISKS-NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKH-----DNNS 643

Query: 648  LVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFX 707
            +VGITEILLS LAQKKA+LRKLSL++W+QFI +VG EEL ILLDVLKARENKQGFA LF 
Sbjct: 644  MVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF- 702

Query: 708  XXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNIDKEATSAL 767
                           +N+                              V NIDKEAT AL
Sbjct: 703  -EGEGEFEEINEEENANEGDSKSESESESESDSDESNEKDEEDEANEDVVNIDKEATGAL 761

Query: 768  AKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKR 827
             KAL+LP+NIVNDKGEVD+ +                               QLSEIFKR
Sbjct: 762  IKALHLPDNIVNDKGEVDMNQ-----LGGLSDDDDDEDEESMDDEKMMELDDQLSEIFKR 816

Query: 828  RKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFVN--- 884
            RKEALS  STGNQRK+E KESRENVI+FK R+VD+LTVYVKY EKL  A+  +   N   
Sbjct: 817  RKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEG 876

Query: 885  ----LISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVXXXXXXXXX 940
                L+ F+ PM+ C+++TLDK LADK+SKLLK +IFKIK++TFK     +         
Sbjct: 877  PLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNIELMNLLKST 936

Query: 941  XXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKS 1000
                    PGQH  ++++  S++SLF SK+Y     +  NA ++LID Y+ TTK WM K 
Sbjct: 937  HELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN--NALDELIDLYAATTKEWMLKG 994

Query: 1001 KFGPNFFADFFNWLASRK 1018
            KF  N F DF NWL+S+K
Sbjct: 995  KFSTNVFIDFTNWLSSKK 1012

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
            POL5DNA Polymerase phi; has sequence similarity to the
            human MybBP1A and weak sequence similarity to B-type DNA
            polymerases, not required for chromosomal DNA
            replication; required for the synthesis of rRNA
          Length = 1022

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1037 (50%), Positives = 679/1037 (65%), Gaps = 41/1037 (3%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  KVNRDLF+KLASDL+EER  AA++L+K+L+ L LPD+ EEW+YV+NRLIKGL+SDR+
Sbjct: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVINLALSMKENA-PEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119
            SARLGFSLCLTEVINLA++M     P+GL++ ++FL  LS  L+++ N   +G  K  KG
Sbjct: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVN---EGTKKSMKG 117

Query: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKE 179
            +DERG+LFGK+FGL+++ NEP+FS +F+  KD +   T F  +F  +++DLALKKNWIKE
Sbjct: 118  KDERGILFGKLFGLKSLLNEPLFSEIFV--KDLEKGNTEFFIRFTEQLIDLALKKNWIKE 175

Query: 180  SCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239
             C FTLFQT++ LLP+ ++ +   IL + D ++L+LT+EGL+ YL + Y    D  L  S
Sbjct: 176  PCFFTLFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKY--EGDESLIPS 233

Query: 240  SIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEG-YENSKKQNASNWNPRLHFVWD 298
             ++ KNPGWK+NDPL+RGNLPLLT+VLR+SSV   + G  + +KKQ  +NWNPRLHFVW 
Sbjct: 234  VLDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWS 293

Query: 299  ILLPILISGKHTTASNTQHISKKRKKNNNELPKH-IEFPEFWQMVVDESFFNEKASSERK 357
            +LLP+  +GK     NT HISKKRKK NN+  ++ I+FPEFW+M VDESFFNEKASSERK
Sbjct: 294  VLLPLFGNGK---LENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERK 350

Query: 358  YLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQED 417
            YLGFLI     K V  + +  CFS N MR+LINQS DS+R+L+K+SQ  L++I++ C+ED
Sbjct: 351  YLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEED 410

Query: 418  SSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKS 477
            S+N+LV C+NAM+FGP GSINFDKLTKS T+SKLI+I  L    LA L D+F   + +K 
Sbjct: 411  SANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKK 470

Query: 478  ENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKEN-----EPLNELAK 532
                   + LD++LHIVR HK  +    I+ P+L P++  AFF   +     E L+ELAK
Sbjct: 471  GVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAK 530

Query: 533  ERFSSILAELT---SVIPKEPH-HSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDA 588
            ER  SIL ELT    +  K+P  +SWQY  L +IL  E +   +L+N LDENL  IKN+A
Sbjct: 531  ERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEA 590

Query: 589  CDVIVKIIKSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTSL 648
               + K+ +S ++ Q                 G+T+S+S IEEL EF K      E+ S+
Sbjct: 591  ISCLSKVCRS-RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKH-----ENNSM 644

Query: 649  VGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFXX 708
            VGITEILLSLLAQKKA+LRKLSL++W+QFI  VG EEL ILLD+LKARENKQGFA LF  
Sbjct: 645  VGITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFEG 704

Query: 709  XXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNIDKEATSALA 768
                           ++                              + NIDKEATSAL 
Sbjct: 705  EEEFEEIKEENDASEDESKTGSESESESESDSDDADEKDEEDEANEDILNIDKEATSALV 764

Query: 769  KALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRR 828
            KALNLP+NIVNDKGEVD+ +                               QLSEIFKRR
Sbjct: 765  KALNLPDNIVNDKGEVDLDQ----LEGLSDDGGDDEDEESMDDEKMMELDDQLSEIFKRR 820

Query: 829  KEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFVN---- 884
            KEALS+ STGNQRK E K+SRENVI+FK RVVD+L VYVKY EKL  A+ S+   N    
Sbjct: 821  KEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGS 880

Query: 885  ---LISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVXXXXXXXXXX 941
               L+ F+ PM+ CV +TLD+ LADK+SKLLK +IFKIK + FK+    +          
Sbjct: 881  LSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTH 940

Query: 942  XXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKSK 1001
                   PGQH  ++Y++ S++SLF SK+YV    ++    ++LID Y+ TTK WM K K
Sbjct: 941  KLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGND--KLDELIDLYTATTKEWMQKGK 998

Query: 1002 FGPNFFADFFNWLASRK 1018
             GPN F DF NWL+S+K
Sbjct: 999  CGPNIFIDFINWLSSKK 1015

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1038 (50%), Positives = 687/1038 (66%), Gaps = 41/1038 (3%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  KVNRDLF+KLASDLQEER  AA++L+K+L+ L LP ++EEW+YV+NRLIKGLASDR+
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLALSMKENA-PEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119
            SARLGFSLCLTEVINLA++M     P+GL++++DFL  LS    LD N NE G  K  KG
Sbjct: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLS--FILDINVNETGK-KPVKG 117

Query: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKE 179
            +DERG+LFGK+FGL+++ NEP+FS +F+  +D K   T F  +FM +++DLAL+KNWIKE
Sbjct: 118  KDERGILFGKLFGLKSLLNEPLFSGIFV--EDLKRGNTEFIIRFMEQLIDLALRKNWIKE 175

Query: 180  SCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239
             CL++LFQTI+ LLP  N+ T   IL   D ++L+LT+EGL+ YL + Y   +D  L  S
Sbjct: 176  PCLYSLFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKY--ESDKDLVPS 233

Query: 240  SIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEG--YENSKKQNASNWNPRLHFVW 297
            ++  KN GWKNNDPL+RGNLPLLT+VLRDS+V   + G   +N+KKQ  +NWNPRLHFVW
Sbjct: 234  TLGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVW 293

Query: 298  DILLPILISGKHTTASNTQHISKKRKKNNNE-LPKHIEFPEFWQMVVDESFFNEKASSER 356
            +ILLP+  SGK     N +HISKKRKK +N+ +P  I+FPEFWQM VDESFFNEKASSER
Sbjct: 294  NILLPLFGSGK---LENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSER 350

Query: 357  KYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQE 416
            KYLGFLI   T K V  + +  CFS N MR+LINQS DS+R+L+K++Q  L++II+ C+E
Sbjct: 351  KYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEE 410

Query: 417  DSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEK 476
            D  NKLV C++AM+FGP GSINFDKLTK+   SKLI+I  L    L  LF+LF   + EK
Sbjct: 411  DPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEK 470

Query: 477  SENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFA-----KENEPLNELA 531
             ++     +VLD+LLHI+R HK  +    I+ P+L P++  AFF      KE+E L+ELA
Sbjct: 471  KDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELA 530

Query: 532  KERFSSILAELT---SVIPKEPH-HSWQYYALDIILKKERTGKFELVNKLDENLGKIKND 587
            KER  SIL ELT    +  ++P  +SWQ+  L +IL  E++ K +L N LDE L K KN+
Sbjct: 531  KERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNE 590

Query: 588  ACDVIVKIIKSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTS 647
            A   + +I KS  S Q                 GET+S+S IEEL EF K+     E++S
Sbjct: 591  AISSLTEISKSNTS-QSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKD-----ENSS 644

Query: 648  LVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFX 707
            +VGITEILLSLLAQKKA+L+KLSL++W+QFI +VG +EL ILLDVLK RENKQGFA LF 
Sbjct: 645  MVGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLFE 704

Query: 708  XXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNIDKEATSAL 767
                            ++                              V NIDKEATSAL
Sbjct: 705  GEGEFEEVDEEESAVEDE--SKSESESDSDSESNDDEERDEEDEANEDVVNIDKEATSAL 762

Query: 768  AKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKR 827
             KALNLP+NIVNDKGEVD+ +                               QLSEIFKR
Sbjct: 763  IKALNLPDNIVNDKGEVDMDQ-LEGISDDGDGGDDDEDEESMDDEKMMELDDQLSEIFKR 821

Query: 828  RKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFV---- 883
            RKEALS+ STGNQRK+E KESRENVIAFK R+VD+LT+YVK+ EKL  A+  +  +    
Sbjct: 822  RKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGG 881

Query: 884  ---NLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVXXXXXXXXX 940
               NL+ F+ PM+ C+++TLD+ LADK+SKLLK +IFKI++S FK+    +         
Sbjct: 882  PLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSA 941

Query: 941  XXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKS 1000
                    PGQH  ++++  S++SLF SK+YV    +  + ++ LID Y++TTK W  K 
Sbjct: 942  HKEMLTSKPGQHANVFFSACSTSSLFLSKLYV--DINGNDKFDDLIDLYASTTKQWTQKG 999

Query: 1001 KFGPNFFADFFNWLASRK 1018
            KFG N F DF NWL+S+K
Sbjct: 1000 KFGANIFIDFINWLSSKK 1017

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1039 (49%), Positives = 679/1039 (65%), Gaps = 47/1039 (4%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  KVNRDLF+KLASDLQEER  AA++L+++L+ L LP + EEW YV+NRL+KGLASDR+
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLALSMKENA-PEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119
            SARLGFSLCLTEVINLA++M     P+GL++ +DFL  LS  L  D N N+ G  K  KG
Sbjct: 61   SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVL--DVNVNDGGK-KSVKG 117

Query: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKE 179
            +DERG+LFGK+FGL+++ NEP+FS +F+  K+ +   T F  +F  E++DLALKKNWIKE
Sbjct: 118  KDERGILFGKLFGLKSLLNEPLFSEIFI--KNFENGNTDFFIRFTEELIDLALKKNWIKE 175

Query: 180  SCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239
             C FTLFQTI+ LLP+ ++     IL + D +N++LT+EGL+ YL + YG   D  L  S
Sbjct: 176  PCFFTLFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYG--GDKNLIPS 233

Query: 240  SIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEG-YENSKKQNASNWNPRLHFVWD 298
            +++ KN GWK++DPL+RGNLPLLT+VLRDSSV   ++G   ++KKQ  +NWNPRLHFVWD
Sbjct: 234  TLDLKNLGWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWD 293

Query: 299  ILLPILISGKHTTASNTQHISKKRKKNNNELPKH-IEFPEFWQMVVDESFFNEKASSERK 357
            ILLP+  SGK     NT+H+SKKRKK + +  ++ I+FPEFW+M +DESFFNEKASSERK
Sbjct: 294  ILLPLFGSGK---LENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERK 350

Query: 358  YLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQED 417
            YLGFLI     K V  + + +CFS N MR+LINQS DS+R+L+K++Q  L +I++ C+ED
Sbjct: 351  YLGFLIIDAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEED 410

Query: 418  SSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKS 477
             +NKLV C+N+M+FGP GS+NFDKLTKS T+SKLI+I  L    L  L ++F   + +  
Sbjct: 411  LTNKLVPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSK 470

Query: 478  ENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFA-----KENEPLNELAK 532
             +     ++LD++LHI+R HK  ++   ++ P+L P+I  AFF      +E E L+ELAK
Sbjct: 471  RDLTHTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELEQLHELAK 530

Query: 533  ERFSSILAELTSVIPKEPH------HSWQYYALDIILKKERTGKFELVNKLDENLGKIKN 586
            ER  SIL ELT  + KE H      +SWQ+  L +IL  E++ +  L+N LDENL K K 
Sbjct: 531  ERLFSILGELT--MNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKE 588

Query: 587  DACDVIVKIIKSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTEST 646
            +A   + +I +S  + Q                 GET+S+S IEEL EF K+     ++ 
Sbjct: 589  EAISSLAEISRS-STAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEFSKD-----KNN 642

Query: 647  SLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF 706
            S+VGITEILLSLLAQKKA+L+KLSL++W+QFI +VG EEL +LLDVLKARENKQGFA L 
Sbjct: 643  SMVGITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQL- 701

Query: 707  XXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNIDKEATSA 766
                            +++                              V NIDKEATSA
Sbjct: 702  -FEGEGEFEEIKEEESASEDESKSEGDSESESNSDDADEKDEEDDANEEVVNIDKEATSA 760

Query: 767  LAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFK 826
            L KALNLP+NIVNDKGEVD+ +                               QLSEIFK
Sbjct: 761  LVKALNLPDNIVNDKGEVDIDQ----LEGLSDDDEDDEDEESMDDEKMMELDGQLSEIFK 816

Query: 827  RRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQK----- 881
            RRKEALS  STGNQRK+E KESRENVI+FK R+VD+LTVYVKY EKL  A+ S+      
Sbjct: 817  RRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLALANKSEDSSSIG 876

Query: 882  --FVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVXXXXXXXX 939
                 L+ F+ P++ C+ +TLD+ LADK+SKLLK +IFKIK + FK     +        
Sbjct: 877  SPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVNAFKEMDKNIEVMDLLKS 936

Query: 940  XXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSK 999
                     PGQHP ++Y+  S++SLF SK+YV    ++    ++LID Y+ TTK W ++
Sbjct: 937  THKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGND--KLDELIDLYAATTKEWTNR 994

Query: 1000 SKFGPNFFADFFNWLASRK 1018
             KFG N F DF NWL+S+K
Sbjct: 995  GKFGANVFIDFINWLSSKK 1013

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1017

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1035 (48%), Positives = 665/1035 (64%), Gaps = 35/1035 (3%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  +VNRD FYKLASDLQEER QAA++L++EL+ L LPD   EW+YV+ RLI GL+S R+
Sbjct: 1    MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120
            SARLGFSLCLTEVINLAL+++ + PE L +ID FL LLS TLSL  +  +    K+ KG+
Sbjct: 61   SARLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSK--KQIKGK 118

Query: 121  DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180
            DERGLLFGKMFGLQA+ +EP+F  VF++K+ G   I+ FA +FM+E+  LA+ K+W++E 
Sbjct: 119  DERGLLFGKMFGLQALLSEPLFEKVFISKEKG---ISDFALRFMDELCQLAVFKSWLREP 175

Query: 181  CLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSS 240
            CLFTLFQ  +++LP A+ +T   +L LLD + L+LT+EGLA+YL +LY    D       
Sbjct: 176  CLFTLFQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQ 235

Query: 241  IEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDIL 300
            ++F++  WK+NDPL+RGNLPLL++VLRDSSV       E+     ASNW PRLHFVWDIL
Sbjct: 236  MDFESKSWKSNDPLARGNLPLLSQVLRDSSV-----ATEDESSPKASNWTPRLHFVWDIL 290

Query: 301  LPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLG 360
            LPI+   +  +   ++    K KK   E    I+FPEFWQM VDES FNEKAS+ERK+LG
Sbjct: 291  LPIIT--QDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLG 348

Query: 361  FLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSN 420
             +IF K ++V     +  CFS N MR+LIN ++DSKRLL K+S   LN+I+++C++    
Sbjct: 349  LVIFQKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKE 408

Query: 421  KLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENK 480
            KLV C++A++FGP GSINFDKLTKSKT + L++++ LD   L +LF L +SN+ E S  +
Sbjct: 409  KLVPCLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVE 468

Query: 481  QKN-RYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSIL 539
            QKN +++LDT+LH VR+HK+ L  D IVT +L P+I  AFF  ++E  + LAKERF SIL
Sbjct: 469  QKNQQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFTVKDEHTSNLAKERFYSIL 528

Query: 540  AELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSP 599
            +E+T +  + P  S+Q  ALDII  +   GK EL  KLD+ L  +K++A   +  I  + 
Sbjct: 529  SEITHLNNEGP--SYQNMALDIIRDEIAAGK-ELTTKLDDTLEDVKSEALRTLQAISNNE 585

Query: 600  QSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLL 659
            ++PQ                 GE+E++S IEEL  FY++   D  STSLVGITEILLSLL
Sbjct: 586  KNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQD--TDENSTSLVGITEILLSLL 643

Query: 660  AQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFXXXXXXXXXXXXX 719
            AQKKAVLRKLSL  W+QF++ +G+ EL  LLDVL ARENK+GF+ LF             
Sbjct: 644  AQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLFEGEDDFEEAEEEF 703

Query: 720  XXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNN-----IDKEATSALAKALNLP 774
               + +                               N      IDKEATSALAKALNLP
Sbjct: 704  DEDAEKDNEEDNEEESEEDEESEEDDLSSSTGEDSNENQDDVAKIDKEATSALAKALNLP 763

Query: 775  ENIVNDKGEVDV---------AKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIF 825
            +NIVNDKGEVD+                                          QLS+IF
Sbjct: 764  DNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDEDSMDDEKMMELDDQLSQIF 823

Query: 826  KRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEK--LQTADHSQKFV 883
            KRRK+ALS  STGNQRK EAKESRE+VIAFK RV+D+L +YVK+VEK  L+  ++S K  
Sbjct: 824  KRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIYVKFVEKQSLKEENYS-KIS 882

Query: 884  NLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVXXXXXXXXXXXX 943
            + +  +EPM+ C+Q+T DKSLA++++KLL+T++FK+K+S F  S +              
Sbjct: 883  SCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKTSAFCGSCDQDELMEMLRMTHEK 942

Query: 944  XXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKSKFG 1003
                 PGQH  +YY++ S+ASLF +KI + +S  +  A + +ID Y+ T K W S  KFG
Sbjct: 943  IQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKDAAVHDIIDLYAETMKQWASNGKFG 1002

Query: 1004 PNFFADFFNWLASRK 1018
            PN F DF NWL+SRK
Sbjct: 1003 PNIFIDFSNWLSSRK 1017

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1028

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1049 (48%), Positives = 669/1049 (63%), Gaps = 58/1049 (5%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  KVNRDLFYKLAS+L EER QAA+S+++EL+ L LPD TEEW YV+ RLIKGL+SDR+
Sbjct: 4    MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61   SARLGFSLCLTEVINLALSMKENAPE--GLQTIDDFLQLLSKTLSLDTNANEKGALKKKK 118
             ARLGFSLCLTEVINLA+ +     E   L  ID +L +LS+TLS+D  A  K   KK K
Sbjct: 64   GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSID--AGNKQNNKKMK 121

Query: 119  GRDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIK 178
            G+DERGLLFGKMFGL+A+ NEP+FS  FL  K   +    F  +FM E++DLA +KNWI+
Sbjct: 122  GKDERGLLFGKMFGLKALLNEPLFSKTFLPNKKVASN---FCERFMVELLDLASRKNWIR 178

Query: 179  ESCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDT 238
            E CLFTLFQT++KLLP+A+ +    +L LLD H  +LT+EGLA+YL +L+      K   
Sbjct: 179  EPCLFTLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFN 238

Query: 239  SSIE---FKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHF 295
              I+    KN  WK NDPL+RGNLP LT+VLR+SS+    +  E      ++NW PRLHF
Sbjct: 239  DKIKLLVLKNSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVE----VMSANWQPRLHF 294

Query: 296  VWDILLPILISGKHTTASNTQHISKKRKKNNN-ELPKHIEFPEFWQMVVDESFFNEKASS 354
            VWDILLP + + +  + S+ +H+SK+RKKN   E   +I FPEFWQM VDESFFNEKASS
Sbjct: 295  VWDILLPTVSTIE--SNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASS 352

Query: 355  ERKYLGFLIFIKTIKVVSQTQLNN--CFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIE 412
            ERKYLGF IF + I +V Q  L++  CFS NFMRSLINQS+D+ RLLHK+S   +NTI++
Sbjct: 353  ERKYLGFSIFERAISIV-QNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVK 411

Query: 413  VCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSN 472
             C+E  S KL+  +++++F  +GS NFDKLTKSKT+SKLISI  L + TL  LFD+ TS 
Sbjct: 412  ACEESPSTKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQ 471

Query: 473  IS-EKSENKQKNRYVLDTLLHIVRTHKTGL--------EYDAIVTPLLDPLIQWAFFA-- 521
            I    SE+ +K +++LD+LLHIVR+HK  +        E + I+   + PL++ AFFA  
Sbjct: 472  IKVGTSEDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQT 531

Query: 522  ----KENEP---LNELAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELV 574
                KE+E    ++ELAKER  S+L+ELT+   K+  HSWQYY L  I+ +E      L+
Sbjct: 532  DIAKKEDESDNQVDELAKERLFSVLSELTTTTNKQL-HSWQYYTLLEIIDRENENPNSLI 590

Query: 575  NKLDENLGKIKNDACDVIVKIIKSPQ---SPQXXXXXXXXXXXXXXXXXGETESLSTIEE 631
            NK+D++L  ++++A  VI  I    +   S                   G+ +S++TIEE
Sbjct: 591  NKMDDDLKTVRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEE 650

Query: 632  LIEFYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLD 691
            LI FY   +   E  ++VGITEILLSLLAQKKAVL+KLSL+VWEQF++ + ++ LN+LLD
Sbjct: 651  LITFYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLD 710

Query: 692  VLKARENKQGFAHLFXXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXX 751
            VL ARENKQGFA LF                  +                          
Sbjct: 711  VLPARENKQGFAELFENADEYEEDDEEENEYKEENESDDESSSDDEDDEEGDEDDEGAEG 770

Query: 752  XXXXVNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXX 811
                +  IDKEATSALAKALNLP++I+N+ GEV+                          
Sbjct: 771  GNEAIAKIDKEATSALAKALNLPDDIINENGEVNF-------DDLSDGSDISSDEESLDD 823

Query: 812  XXXXXXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVE 871
                    QL+EIFKRRKEALS+ STGNQRKIE KESRE+VIAFK RV DLL++Y+K+ E
Sbjct: 824  EKMMELDDQLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAE 883

Query: 872  KLQTADHSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKN-SANP 930
                ++   K+   I F+EPM+ CVQ+TLDKSLADK+SKLLKT+++K+K+   +  +A  
Sbjct: 884  D---SELPAKYA--ILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNMEEITAEQ 938

Query: 931  VXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYS 990
            V                 PGQ+   +Y+L SS S+F SK+ +  S D+  AY K++D YS
Sbjct: 939  V--FDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDIYS 996

Query: 991  NTTKSWMSK-SKFGPNFFADFFNWLASRK 1018
             TTK W+ K SKFG N F DF+NWL+S+K
Sbjct: 997  ETTKKWVLKDSKFGSNIFIDFYNWLSSKK 1025

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/1044 (45%), Positives = 653/1044 (62%), Gaps = 69/1044 (6%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  KVNRD FYKLASDL EER QAA+SL+KEL++L LP   +EW+YVVNRLIKGL+SDR+
Sbjct: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVINLALSMKEN-APEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119
             ARLGFSLCLTEV++LA+ M ++ APE L+++D FL LLSKT S+D     +   KK+KG
Sbjct: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDP----QDEKKKRKG 116

Query: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKE 179
            ++ERGL+FGK+F LQA+ NEP+FS +F+  KDGK  IT F  KF++E+V+LA +KNWIK+
Sbjct: 117  KEERGLMFGKLFALQALLNEPLFSDIFI--KDGK--ITKFTTKFIDELVNLASRKNWIKQ 172

Query: 180  SCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239
             CLFTL+QTI++LLPY++     +++++LD +  +LT+EGLA+YL  +    +   L   
Sbjct: 173  PCLFTLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALL--- 229

Query: 240  SIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDI 299
            SI   N GWK N+PL +GNL L++EV+R+S+V       +N  K N +NW+P+LHFVWDI
Sbjct: 230  SINVTNKGWKYNNPLLKGNLSLVSEVVRESAVVVD----DNETKTNNANWHPKLHFVWDI 285

Query: 300  LLPILISGKHTTASNTQHISKKRKKNNN-------ELPKHIEFPEFWQMVVDESFFNEKA 352
            LLPIL +         +   KK+KK+NN       E    IEFPEFW+ +VDE++F++KA
Sbjct: 286  LLPILYNDPR------EEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKA 339

Query: 353  SSERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIE 412
            SSERK+LG LIF+K +  V    +  CFS N MR LINQ +DS+R LHK+++  L +I++
Sbjct: 340  SSERKFLGLLIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVK 399

Query: 413  VCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSN 472
             C+ D  +KLV  V A++FG +GSINFD+LTKSKT++KLI+   L+  ++  LF LFTS 
Sbjct: 400  TCEADPGHKLVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSE 459

Query: 473  ISEKSENKQKN----RYVLDTLLHIVRTHKTGLEYDAIVTPLLD----PLIQWAFF-AKE 523
            +     N QKN     ++LDTLLHI+R+HK  L+ + I T L+     PL++  FF A E
Sbjct: 460  L-----NSQKNEAVLHFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATE 514

Query: 524  NEP-----LNELAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLD 578
              P     ++E+A+ER  SIL+EL+SV P    HSWQ++ L+ +   E   +  L N LD
Sbjct: 515  TSPEDKINVSEIARERIYSILSELSSV-PTGDAHSWQFHILNELTTVE--NELTLTNALD 571

Query: 579  ENLGKIKNDACDVIVKI-IKSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYK 637
            E+L  +K+    VI  + +K+ +S +                 GE +S++TI+E+ ++  
Sbjct: 572  EDLTTVKDTGLSVIHSLSVKNDKSSR--GIESLLAMCLLQLYSGEADSVATIKEICDYLT 629

Query: 638  EHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARE 697
            E K    S SLVGITEILL LLAQKK VL K SL+VWEQ I +VG +ELN++LDVL ARE
Sbjct: 630  EEKSSKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARE 689

Query: 698  NKQGFAHLFXXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVN 757
            NK+GF++LF                 N+                              V 
Sbjct: 690  NKEGFSYLF----EGAEEYEKVSGDENEVAPEEESASSDTSDSSSDSDDESEEADNKDVT 745

Query: 758  NIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 817
            NID++   ALAKAL LPEN+VN+ GEV   +                             
Sbjct: 746  NIDRQTACALAKALKLPENVVNEDGEVKFNE-------IDDLEDESSDDESMDDEAMMAL 798

Query: 818  XXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTAD 877
              QL++IFKRRK+ALS   TGN RKIE ++SRE+VI FK R++D+LT+YVKYVEKL   D
Sbjct: 799  DGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLED 858

Query: 878  HS---QKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVXXX 934
                 +K   + +FVEPM+ CVQ+TLD+ LADK+ KLLK +IFK+K              
Sbjct: 859  KDVMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPVSAEDGERFVES 918

Query: 935  XXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTK 994
                           GQ+  +YY+L SSAS+FF K+ + S  ++  A+N++ID Y+ TTK
Sbjct: 919  LQRIHGTYLLAEKS-GQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTK 977

Query: 995  SWMSKSKFGPNFFADFFNWLASRK 1018
             WM K KF  + F DF+NWL+S++
Sbjct: 978  KWMDKKKFPTSVFFDFYNWLSSKR 1001

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/733 (57%), Positives = 539/733 (73%), Gaps = 29/733 (3%)

Query: 1   MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
           M  KVNRDLFYKLASDL+EER Q+A+SL+KEL+ L +PD+ EEWTYV+NRLIKGLASDR+
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTN---ANEKGALKKK 117
           SARLGFSLCLTE INLAL M +NAP+G+Q+I++FL LLSKTL +D+N      K ALKKK
Sbjct: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120

Query: 118 KGRDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWI 177
           KGRDERG+LFGK+F LQA+ NEP+FS++FL++   K + + F  ++++E+  L  KKNWI
Sbjct: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLF-IRYVDELFTLGSKKNWI 179

Query: 178 KESCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLD 237
           +ESC FTL+QTI+KLLPYA+ + Y  +L+LLD + L+L+ EGLA+YL I+Y   N  +L+
Sbjct: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239

Query: 238 T--SSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYE---NSKKQNASNWNPR 292
              S I+  N  WK+N+PL+RGNLP LT +LRDS+VT+  +  +    + KQ  +NW PR
Sbjct: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299

Query: 293 LHFVWDILLPILISGKHTTASNTQH----ISKKRKKNNNELPKHIEFPEFWQMVVDESFF 348
           LHFVWDILLPIL +      +N+        +K+ K N +  + I FPEFWQM +DESFF
Sbjct: 300 LHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDESFF 359

Query: 349 NEKASSERKYLGFLIFIKTIKVVSQTQ---LNNCFSHNFMRSLINQSTDSKRLLHKMSQN 405
           NEKASSERKYLGFLIF KTI+ + +     ++ CF+ NFMRSLINQS+D+KRLLHKMSQ 
Sbjct: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419

Query: 406 ALNTIIEVCQEDSSNKLVKCVNAMVFGP--SGSINFDKLTKSKTISKLISIHPLDVKTLA 463
           A++TI++VC++D SNKL+ C++A++F     GSINFDKLTKSKT+SKLISI  L   TL 
Sbjct: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLR 479

Query: 464 DLFDLFTSNISEKSENKQ---KNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFF 520
            L  LF S I+  S  K+    N++ LDT+LH+VR+HK+  +YD++V PLL+PL++ AFF
Sbjct: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539

Query: 521 AKENEPLNELAKERFSSILAELTSVI--PKEPH--HSWQYYALDIILKKERTGKFELVNK 576
           +K+NE LNELAKER  SIL+ELT     PK  +  HSW YY L +IL+ E++G  ELVNK
Sbjct: 540 SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNK 599

Query: 577 LDENLGKIKNDACDVIVKIIKS---PQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELI 633
           LD +L  IKN+   V+ +I  +     + Q                 G+TESLSTIEEL+
Sbjct: 600 LDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELV 659

Query: 634 EFYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVL 693
           EFY   K + ESTSLVGITEILLSLLAQKKA+LRKLSL VWE FI+++GK ELN+LL VL
Sbjct: 660 EFYSNSKQE-ESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVL 718

Query: 694 KARENKQGFAHLF 706
             RENKQGFAHLF
Sbjct: 719 PVRENKQGFAHLF 731

 Score =  259 bits (661), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 147/274 (53%), Positives = 176/274 (64%), Gaps = 11/274 (4%)

Query: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXX 815
            + NIDKEATSALAKALNLPENIVN+KGEVD+AK                           
Sbjct: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMD 846

Query: 816  XXXX-----QLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYV 870
                     QLSEIFKRRKEALS  STGNQRKIE KESRENVIAFK RV+D+L +Y+KYV
Sbjct: 847  DEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906

Query: 871  EKLQ-TADHSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKN--- 926
            E L  T ++ +KF NL+ F+EPM+ CV++TLDKSLADKV KL+KT++FKIKSS F+    
Sbjct: 907  EGLTLTTENGEKFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSNFQIESL 966

Query: 927  SANPVXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYV-ASSTDETNAYNKL 985
            +A+                    GQ P LYY+L S+ S+F  KI V   S D+  AY KL
Sbjct: 967  NADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIAYGKL 1026

Query: 986  IDQYSNTTKSW-MSKSKFGPNFFADFFNWLASRK 1018
            ID Y  TTKSW MSK KFG N F DF+NWL+S++
Sbjct: 1027 IDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1053 (42%), Positives = 606/1053 (57%), Gaps = 75/1053 (7%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLL---PDETEEWTYVVNRLIKGLAS 57
            +V++VNRDLF+K+AS+L++ER +AAI L+ E++ +      D   EW YV+ RL+KGLAS
Sbjct: 6    VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 58   DRSSARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKK 117
            +R  ARLGFS+CLTEVI LAL  ++  P    +I  FL  L +TL   T          K
Sbjct: 66   NRGGARLGFSMCLTEVIALALERRDILP----SIYAFLNQLEQTLPAGTAF--------K 113

Query: 118  KGRDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWI 177
             G++ERG+LFG+MF LQ++ NEPVFS +FL+  D    +  F   ++N+++ LAL K W+
Sbjct: 114  NGKEERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINM-EFLLTYLNKLIQLALSKTWL 172

Query: 178  KESCLFTLFQTIQKL-LPYANKDTYLS-ILSLLDSHNLSLTSEGLAVYLTILYGDTNDNK 235
            +E CL++++QTIQK      N  T ++ IL LLD   L+LT+EGL++YL  ++    D  
Sbjct: 173  REPCLYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYL--MFNAQRDTY 230

Query: 236  LDTSSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHF 295
              +SS+   N GWKNNDPLS+GN+ LL  VL+D     P    E S  +    W PRLH+
Sbjct: 231  --SSSLVIHNSGWKNNDPLSKGNVQLLASVLKD---VVP---VEKSDLKQKGTWAPRLHY 282

Query: 296  VWDILLPILISGKHTTASNTQHISKKRKKN----NNELPKHIEFPEFWQMVVDESFFNEK 351
            VWDILLP+L        S   HISKKRKKN    ++E    I+FP+FWQ VVDESFFNEK
Sbjct: 283  VWDILLPLLEDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEK 342

Query: 352  ASSERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTII 411
            +S+ERKYLGFLI  + IKV S   +    S N +R +INQS DS+R+L+K+S  AL +I+
Sbjct: 343  SSNERKYLGFLILEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIV 402

Query: 412  EVCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTS 471
              C E S  K+V  V    FG +GSINFDKL KSK ++ LIS   L+ + L DL +L  S
Sbjct: 403  AEC-ERSPAKVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLIS 461

Query: 472  NISEKSENKQK---NRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAK-ENEPL 527
             + +    K      R++ DT LHI R HKT LE    V PLL  +I+ AFF + +N  L
Sbjct: 462  QLPQDQSTKDSFNLTRFIFDTFLHITRAHKTRLE-SHWVKPLLSAIIKAAFFNESDNSKL 520

Query: 528  NELAKERFSSILAELTSVIPKEPHHS------WQYYALDIILKKERTGKFELVNKLDENL 581
            +ELAKER  SIL EL S    EP  S      W Y AL IILK E +G   L   LDE+L
Sbjct: 521  SELAKERLYSILGELIS----EPSKSSGDISTWPYIALQIILKIEGSGS-TLSIDLDEDL 575

Query: 582  GKIKNDACDVIVKIIKSPQS-------PQXXXXXXXXXXXXXXXXXGETESLSTIEELIE 634
              ++  A    +K +K   S       P+                 G+ ES+S +++LI 
Sbjct: 576  ESVRKSA----IKSLKQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLIS 631

Query: 635  FYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLK 694
            FY+E   D EST LVGITEILLSL+AQ+K++L+KLSL+VWE F+ ++G+ ELN+LL  L 
Sbjct: 632  FYEE--CDKESTDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLT 689

Query: 695  ARENKQGFAHLFXXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXX-XXXXXXXXXXXXXXX 753
            ARENKQGFA LF                 +                              
Sbjct: 690  ARENKQGFADLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKD 749

Query: 754  XXVNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXX--XXXXXXXXX 811
              +  I+KEATSALAKALNLP++IV + G+V +                           
Sbjct: 750  AALEKIEKEATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDD 809

Query: 812  XXXXXXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVE 871
                    QLSEIFKRRKEAL +  TGN+RK+E +ESRENVI+FK RVVD+L +YVK  +
Sbjct: 810  EAMMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFD 869

Query: 872  KLQTADHS-----QKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKN 926
            +    +++     +++ NL S + P++ C+Q TLDK+LADK +KL+K R+ K+K++  K 
Sbjct: 870  RAVARNNTSIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKE 929

Query: 927  SANPVXXX-XXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKL 985
                                   PGQ  QL+++  S ASLF SK+Y++S     N    L
Sbjct: 930  EKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGGSHEN----L 985

Query: 986  IDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
            ID Y++T+K+WM   K   NFF DF NWL +++
Sbjct: 986  IDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/710 (53%), Positives = 506/710 (71%), Gaps = 23/710 (3%)

Query: 1   MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
           M  KVNRD FY+LASDLQ+ER +AA+SL++EL+ L LP   EEW+YV+ RLI GLAS R+
Sbjct: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61  SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120
           SARLGFSLCL+EV+ +AL     AP+ L + D +L+LLS  LS D     K   K  KG+
Sbjct: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSK---KDLKGK 117

Query: 121 DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180
           DERG+LFGKMFGLQA+ NEP+F+S+F    D + +++PFA +F  E+ +LA+KKNW++ES
Sbjct: 118 DERGILFGKMFGLQAILNEPLFTSIFF---DQEGKVSPFALRFAQELAELAVKKNWLRES 174

Query: 181 CLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLD--- 237
           CL+TLFQT+Q+L+P    +   SIL LLD + L++T+EGLA+YL + +G    N      
Sbjct: 175 CLYTLFQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKV 234

Query: 238 TSSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVW 297
            SS+  +   WKNNDPLS+GNLP L+ VLRD+     SE  + S  ++A NWNPRLHFVW
Sbjct: 235 PSSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPAND-SEVADGSHPKSA-NWNPRLHFVW 292

Query: 298 DILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERK 357
           DIL+PIL  GK      ++   KK+KK+  E    IEFPEF+Q  VDE+FF+EKASSERK
Sbjct: 293 DILIPILAPGKSDEEIPSKKSHKKKKKDTVE---GIEFPEFFQAAVDETFFSEKASSERK 349

Query: 358 YLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQED 417
           YLGFL+FI+ ++VVS   + +CF+ NFMR+LINQS+DSKRLL+K+SQ AL+ I++ C++D
Sbjct: 350 YLGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKD 409

Query: 418 SSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKS 477
           +S K+  C+ AM+FGP G+I+FDKLTKSKT SKL++I  +    L  LF++ ++ +S + 
Sbjct: 410 ASEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREE 469

Query: 478 E-NKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFS 536
           E NKQ  ++VLDT+LH VRTH+  +  + I  PLLD ++  AFF+K+ E +++LA+ER  
Sbjct: 470 EPNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLF 529

Query: 537 SILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKII 596
           SIL+ELT  I K+   SWQ+Y L +IL KE  G  E +NKLDE+L  I+ +A D++  I 
Sbjct: 530 SILSELT--IQKD-GQSWQHYTLKLILSKEAEGN-EPINKLDEDLKAIETEALDILQNI- 584

Query: 597 KSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTSLVGITEILL 656
            S  SPQ                 G++ESLS +EEL  FY+E  G  ES SLVGITEILL
Sbjct: 585 -SSDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYRE--GLNESNSLVGITEILL 641

Query: 657 SLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF 706
           SLLAQKKA+LRKLSL+VWEQF++ VG++EL ILL+VL ARENK+GFA LF
Sbjct: 642 SLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLF 691

 Score =  237 bits (604), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 164/280 (58%), Gaps = 17/280 (6%)

Query: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXX----------XXXXXXXXXX 805
            V  ID+EATSALAKALNLPENIVNDKGEVDV +                           
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 806  XXXXXXXXXXXXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTV 865
                          QLS+IFKRRKEALS  +TGN+RK+E KE+RENVI FK R+VD+L  
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 866  YVKYVEKLQTADHSQK------FVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKI 919
            Y+K+ +++   D++ +      F NL  FVEPM+ C+Q TLDK LADK+SKLLK R++KI
Sbjct: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934

Query: 920  KSSTFKNSANPVXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVA-SSTDE 978
            K S FK + +                   PGQ P LY++  S+ SLF  K+ V  +S D 
Sbjct: 935  KISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDP 994

Query: 979  TNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
              +Y ++ID Y++TTK W+   KFG N FADF NWL SRK
Sbjct: 995  AISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1069 (40%), Positives = 604/1069 (56%), Gaps = 101/1069 (9%)

Query: 4    KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRSSAR 63
            +VNRDLFY+LASD++EER +AA+ +V EL+ ++  D  +EW YV+ RLIKGLAS R  AR
Sbjct: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 64   LGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRDER 123
            LGFS+CL+EV+ L L         L++++ ++  L + L+ D +         K G++ER
Sbjct: 63   LGFSMCLSEVVTLGLEKGR-----LESVEVYIGQLFEKLA-DGHV--------KNGKEER 108

Query: 124  GLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESCLF 183
            GL+FGK+FGLQA+ NEP+F  +F+   DGK     F   FM+ +V LAL K W++E CLF
Sbjct: 109  GLVFGKLFGLQALLNEPLFGRIFM---DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLF 165

Query: 184  TLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSIE 242
            TL+Q I+KL     +  +L +I  LLD H L+LT+EGLA+YL ++Y       ++T S+ 
Sbjct: 166  TLYQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIY-----ECVETKSLL 220

Query: 243  FKN---------PGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRL 293
             K+           WKNNDPLS+GN+ +L+ VL+D     P E  +N  KQ  S W PRL
Sbjct: 221  IKSKILSKITLRSCWKNNDPLSKGNVTILSSVLKD---IIPVE--DNVMKQKGS-WAPRL 274

Query: 294  HFVWDILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFP----EFWQMVVDESFFN 349
            HFVWDIL+PIL   +    +  +H+ KKRK +  +  + +  P    EFWQ+VVDESFFN
Sbjct: 275  HFVWDILIPILCRQQEIPGA-AEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFN 333

Query: 350  EKASSERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNT 409
             KASSERKYLG LI  K ++ V  + + + FS N MR+LINQS++S R LHK+S N L  
Sbjct: 334  AKASSERKYLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKN 393

Query: 410  IIEVCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLF 469
            I+ +C+ D + K++  VN++ FGP+GSINFD LTKSKT+  +I++  L  + LA L  L 
Sbjct: 394  IVSICESDPT-KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALI 452

Query: 470  TSNISEKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVT-PLLDPLIQWAFF-------- 520
             S I ++S    K RY+LD LLHIV+ HK  L+ D   T PLL  +++ +FF        
Sbjct: 453  VSEIDKESSPVSKVRYLLDILLHIVQAHK--LKADMFWTKPLLSSIVKLSFFNDKLSDFE 510

Query: 521  ----------AKENEPLNELAKERFSSILAELTSVIPKEPHH----SWQYYALDIILKKE 566
                        E++ +  L++ER  SIL +L   IP    +    +W Y  L I++ +E
Sbjct: 511  DVDLDAHADADAESKKIPVLSRERLFSILGQL---IPTSKQNVDGPTWPYVTLQIVIAEE 567

Query: 567  RTGKFELVNKLDENLGKIKNDACDVIVKIIK----SPQSPQXXXXXXXXXXXXXXXXXGE 622
               +  L+ KLDE L + K  A   I  I K    SPQ+ +                 G+
Sbjct: 568  H--RRSLIFKLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGD 625

Query: 623  TESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVG 682
             ES S +EEL  FYK    DT+   LVGITEILLS++AQKKAVLR+L+L+VWE  I  + 
Sbjct: 626  AESASILEELTTFYKSI--DTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIE 683

Query: 683  KEELNILLDVLKARENKQGFAHLFXXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXX 742
             +ELN+L D+L  RENKQGFA LF                                    
Sbjct: 684  GDELNLLFDILSVRENKQGFAALFEAADEYVEVDDDEINEDVDISHENCDSSDHNDSHSS 743

Query: 743  XXXXXXXXXXXXXVNN--------IDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXX 794
                          NN        I+KE TSALA AL LPEN++++ G+V          
Sbjct: 744  SYFEECGSNEEDSGNNGYNEYIDKINKETTSALADALKLPENMIDENGDVGFED------ 797

Query: 795  XXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIA 854
                                     QLSEIFKRRKEALS   TGN+RK+E +ESRE+VI+
Sbjct: 798  -FDDGDEEEEEEESMDDEAMMELDGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVIS 856

Query: 855  FKSRVVDLLTVYVKYVEKLQTADH---SQKFVNLISFVEPMVTCVQKTLDKSLADKVSKL 911
            FK RV+D+L +Y KYV +L        + K +N+ S ++P++ C+Q+T+D+ LA+K +KL
Sbjct: 857  FKHRVLDMLEIYCKYVVRLAGKSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKL 916

Query: 912  LKTRIFKIKSSTFKNSANPVXXXX--XXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSK 969
            LK  I K+K   FK   + V                   PGQ  QLY+   S++SLF  K
Sbjct: 917  LKNHICKLKLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGK 976

Query: 970  IYVASSTDETNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
            I V +  DE   YN++ID YS + K+W  K KFGPNFF DF NWLAS++
Sbjct: 977  ILVVTKPDEV-TYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1048 (42%), Positives = 603/1048 (57%), Gaps = 79/1048 (7%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            M  +VNRDLFYKL SDL +ER Q+AI+L+ EL  L + +  +EW YV+ RL++GLAS   
Sbjct: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120
            SARLGFSLCLTEV   AL   EN   G  + +++L+ L   L +D         K K G+
Sbjct: 61   SARLGFSLCLTEVAAAAL---ENGHIG--SAEEYLERLEAALPVD---------KVKNGK 106

Query: 121  DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180
            +ERG LFG+MFGLQA+ NEP+FS VF+   DG+ +   FA +FM  +V LAL K W+++ 
Sbjct: 107  EERGQLFGRMFGLQAMLNEPLFSRVFVAG-DGQIQ-QAFAHQFMQRLVQLALTKAWLRQP 164

Query: 181  CLFTLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILYGDTNDNK--LD 237
            CLFTL+Q I++L P A    +L ++L+LLD HNL+ TSEGLA+YL  L     + K  LD
Sbjct: 165  CLFTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYL-FLQNKCPEIKRILD 223

Query: 238  TSSIEFKNP---GWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLH 294
             + I    P    WK ++PL++GN   L  VL+D ++       E    +    W PRLH
Sbjct: 224  ETKIFDALPLVKRWKADNPLAKGNAKALASVLKDDALI------EGDGPKQKGVWTPRLH 277

Query: 295  FVWDILLPILISGKHTTASNTQHISKKRKKNNNELPKH---IEFPEFWQMVVDESFFNEK 351
            FVWD+LLP+L   K +  ++  HI+KK K            + F EFWQ+VVDESFF+EK
Sbjct: 278  FVWDLLLPLLAEEKVSPDTHV-HIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEK 336

Query: 352  ASSERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTII 411
            ASSERKYLG LI  K ++ V  + + + FS N +R+LINQS+++ R LHK+S N L TI+
Sbjct: 337  ASSERKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIV 396

Query: 412  EVCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTS 471
              C+ D+S K+V  + A+ FGP+G+INFDKLTKSKT   L++   L    LA L  L   
Sbjct: 397  SACETDAS-KVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQ 455

Query: 472  NISEKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFF------AKENE 525
             +  ++ +  K +++LDTLLH++R HK    + +   PLL  L+++AFF      ++++E
Sbjct: 456  QLEHENTDISKIKFILDTLLHVIRAHKWK-AHLSWTNPLLLALVRYAFFSAPSHLSEQSE 514

Query: 526  PLNELAKERFSSILAELTSVIPKEPHH----SWQYYALDIILKKERTGKFELVNKLDENL 581
             +  L++ER  S+L EL   IP   H     SW Y  L+++L+++   K  L  +LD  L
Sbjct: 515  EIITLSRERLFSVLGEL---IPLSKHDMGAPSWAYATLELLLQEKE--KHPLALQLDAEL 569

Query: 582  GKIKNDACDVIVKII----KSP-QSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFY 636
              + ++A  ++ KII    KSP ++PQ                 G+ +S ST+EEL  FY
Sbjct: 570  ETVTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFY 629

Query: 637  KEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKAR 696
             E         LVGITEILLSL+AQKK++LRKL+L+VWE FI  VGKEEL +LL+ L AR
Sbjct: 630  -ESATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSAR 688

Query: 697  ENKQGFAHLFXXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV 756
            ENK GFA LF                 N+                              V
Sbjct: 689  ENKAGFAQLFEGADEYEELGSDEAGTDNE------DQSSESNEDSSDEVSDQEDYSDEDV 742

Query: 757  NNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXX 816
              IDKEATSALA AL LP+NI+++ G V   +                            
Sbjct: 743  AKIDKEATSALAHALRLPDNILDEDGNVGFEE----------MDDEEEEEESMDDEAMME 792

Query: 817  XXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTA 876
               QLSEIFKRRK+AL+   TGNQRKIEAKESR++VIAFK RVVD+L +Y K VE+  T 
Sbjct: 793  LDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTK 852

Query: 877  D---HSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFK---NSANP 930
            +    +    N++S  EPMV  +Q+TLD+ LA+K+SKLLK  + K+K + +K   +  N 
Sbjct: 853  NKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINE 912

Query: 931  VXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYS 990
                              PGQ PQL+++  SS SLF SK+ +A   D + +  ++I  YS
Sbjct: 913  ESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTS-EQVIGIYS 971

Query: 991  NTTKSWMSKSKFGPNFFADFFNWLASRK 1018
             T K W    KFGPNFF DF NWLAS+K
Sbjct: 972  TTMKHWNVSGKFGPNFFIDFINWLASKK 999

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/704 (49%), Positives = 499/704 (70%), Gaps = 25/704 (3%)

Query: 4   KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETE-EWTYVVNRLIKGLASDRSSA 62
           KVNRD FYKLASDL EER Q+A++L+K+L+ L  P E E E+ YV+NRLI GL+S+R+SA
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61

Query: 63  RLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRDE 122
           RLGFSLCLTEV+NLAL  K+     L++IDDFL ++ KTL LD+ A  K   K KKG+DE
Sbjct: 62  RLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGK---KLKKGKDE 118

Query: 123 RGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESCL 182
           RG++FG+MF LQA+ NEP+F+ VF+  K+GK  I+ FA +F  ++V+LA+ KNW++E CL
Sbjct: 119 RGIMFGRMFALQALLNEPLFAKVFI-DKNGK--ISKFAIRFQTQLVELAVLKNWLREPCL 175

Query: 183 FTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSIE 242
           FTL+QT++K +PY +     S++ LLD + L+LT+EGLA+YL++++  TN  K+  SS+ 
Sbjct: 176 FTLYQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIH--TNGKKI-ASSLP 232

Query: 243 FKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDILLP 302
            ++ GWK NDPL++GNLP LT+VL +S++ Q       + + NA+NW+PRLHFVWDILLP
Sbjct: 233 LESQGWKLNDPLAKGNLPTLTQVLLNSNINQSE-----TPQGNAANWSPRLHFVWDILLP 287

Query: 303 ILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLGFL 362
           IL+    TT  N +H+SKK+K         I+F  FW+MVVDESFFNEK+SSERKYLGFL
Sbjct: 288 ILLGQDSTT--NDEHVSKKQKSKTTS-STSIKFQSFWKMVVDESFFNEKSSSERKYLGFL 344

Query: 363 IFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSNKL 422
           I  K++++V    + + F  N +RS+INQS D+KR+LHK+SQ  LN+IIE C++D++ K+
Sbjct: 345 IIQKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KI 403

Query: 423 VKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENKQK 482
              V  ++FG +G+ NFDKLTK+KTI+K++SI  L+ +TL+ +F + ++ I   SE+ QK
Sbjct: 404 TPIVKVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQK 463

Query: 483 NRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSILAEL 542
           +++VLDT+LH+VR HK  +    I+  LL P+I  AFF KENE ++ +AKERF S+L+EL
Sbjct: 464 DQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSEL 523

Query: 543 TSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSPQSP 602
            ++       SWQY AL++I  KE +G   L  ++D++L  IK    + + ++ K   + 
Sbjct: 524 AAITT--STRSWQYTALELISNKEASGS-PLNQEMDQDLIAIKEKGIECLKEVTKKSDTV 580

Query: 603 QXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLAQK 662
           Q                 G+ +S+S +E+L  FY E + D  S SLVGITEILL+LLAQ+
Sbjct: 581 QLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDD--SVSLVGITEILLALLAQR 638

Query: 663 KAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF 706
           KAVL+K++L+ WEQF+  +G EE+ +L+DVL ARENK+GFA LF
Sbjct: 639 KAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  212 bits (539), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 159/275 (57%), Gaps = 15/275 (5%)

Query: 759  IDKEATSALAKALNLPENIVNDKGEVDV----AKXXXXXXXXXXXXXXXXXXXXXXXXXX 814
            I+KE TSALAKALNLP+NI+N+ GEVD+                                
Sbjct: 739  INKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEKM 798

Query: 815  XXXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKL- 873
                 QLSEIFKRRKEALS+ ++GNQRK++ KESRENVIAFK R++DLL  Y+KYVEK+ 
Sbjct: 799  MELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858

Query: 874  ------QTADHSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNS 927
                  Q  +  Q    +   +  MV C+Q TLD+ LADK+SKLLK ++FKI  + F N 
Sbjct: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918

Query: 928  --ANPVXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASST--DETNAYN 983
              +N                   PGQH  LY+++ S++SLF SK+ + ++   + + A++
Sbjct: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978

Query: 984  KLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
            +LID Y   +K W+ K +FGP  F DF+NWL S+K
Sbjct: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1052 (39%), Positives = 615/1052 (58%), Gaps = 59/1052 (5%)

Query: 5    VNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETE-------EWTYVVNRLIKGLAS 57
            VNRD+FY+LASDL+EER Q+ + LVKEL  L   +  E       EW YVVNRLI GLAS
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58   DRSSARLGFSLCLTEVINLALSMKEN--APEGLQTIDDFLQLLSKTLSLDTNANEKGALK 115
            +R  ARLGFSLCLTEV+NLALS K     P  L  I  FL L+S TLS+   ++++G  +
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIP--SSKQGEPR 121

Query: 116  KK-KGRDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKK 174
            K  KG+DERGLLFGK+F LQ++ N+P+F  +F   KD K       F+F+ E++ L+  K
Sbjct: 122  KLLKGKDERGLLFGKLFALQSLLNDPIFGKIF--NKDNKA----ILFEFIYELIALSNLK 175

Query: 175  NWIKESCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDN 234
            NWIKE  LFTLF  IQK++ + ++   + +L++L S+NL+LT+EGL++Y+ ++Y + + +
Sbjct: 176  NWIKEPTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHIS 235

Query: 235  KLDTSSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLH 294
              D       N  WKNNDP  + N+ LL++VL ++S    SE     K  + +NW PRLH
Sbjct: 236  PEDIQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSE-----KHTSNANWTPRLH 290

Query: 295  FVWDILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASS 354
            +VWD++LPIL++ K +     ++ +K+RK + +     I+F EFW+ V+DESFFNEKAS 
Sbjct: 291  YVWDVILPILLNPKSSDKLLNKNGNKRRKVSRD----RIKFNEFWRQVIDESFFNEKASH 346

Query: 355  ERKYLGFLIFIKTIKVV-SQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEV 413
            ERKYLGFLI  KT  ++ +   + + F+ N +RS+INQ  DSKR L+K+S   ++ I+  
Sbjct: 347  ERKYLGFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQ 406

Query: 414  CQEDSSNKLVKCVNAMVFGP--SGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTS 471
            CQ +S  +L+  +N  +F    S SINFDKLTK+KTIS+LI++  L   TL+ LF LFTS
Sbjct: 407  CQSNSELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTS 466

Query: 472  NISEKSENKQKNRYVLDTLLHIVRTHKTGLEYD-AIVTPLLDPLIQWAFFAKENE-PLNE 529
             +   +   +  +++LD++LHI+R+HK+ +      + P+L+P+I   FF +  +  ++ 
Sbjct: 467  KLDSFTTTTEL-QFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETADVSISN 525

Query: 530  LAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDAC 589
            + K+R  SIL +LT+V   E   S QY  L++I+      K  L  K D++L ++K+ A 
Sbjct: 526  ILKDRLISILNDLTTV--GENSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVKDSAI 583

Query: 590  DVIVKIIK-SPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDT----- 643
              + + I+ S +  +                  + +S++TI++L +FY  +K +T     
Sbjct: 584  TTLKRAIEHSKRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSNTIMKND 643

Query: 644  ESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFA 703
            ++   +GI EILL+L AQKK++L+KL L +WE FI  +   E + + DVL  RENK+GFA
Sbjct: 644  KNRPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRENKEGFA 703

Query: 704  HLFXXXXXXXXXXXXXXXXSNQXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNIDKE 762
             LF                 ++                               +N IDKE
Sbjct: 704  RLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSDDDNSSDEENDSIVESNDDINRIDKE 763

Query: 763  ATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXX 818
            ATSALAKAL LP+NI+NDKGEVD+ K                                  
Sbjct: 764  ATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDEQMMELD 823

Query: 819  XQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADH 878
             QLS+IF RRKEALS   TGN+RK++ KESRENVIAFK R+VD++ VY+K++E +  +  
Sbjct: 824  GQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEIITKSSE 883

Query: 879  S------QKFVNLISF-VEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPV 931
            +       K +N I   ++ ++ C+Q+TLD++LA+K+SKLLK ++FKIK   FK+  +  
Sbjct: 884  NIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVEFKDCGDLT 943

Query: 932  XXXX---XXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQ 988
                                 GQ+  LY+ L S +SLF+ +I+  +ST+  + Y+ LID 
Sbjct: 944  SENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTN-ADLYDSLIDL 1002

Query: 989  YSNTTKSWM--SKSKFGPNFFADFFNWLASRK 1018
            Y  TTK+W   S+ K     F+DF NWL+S++
Sbjct: 1003 YGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1042 (39%), Positives = 567/1042 (54%), Gaps = 68/1042 (6%)

Query: 4    KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRSSAR 63
            ++NRDLFYKLASDL EER QA I LV +L+ L    ++ EW YV++RLIKGL+S R+ AR
Sbjct: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKL--EKDSSEWQYVLDRLIKGLSSSRNGAR 62

Query: 64   LGFSLCLTEVINLALSMKENAPEG-LQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRDE 122
            LGFSLCLTEV+ LAL       +G L  +D ++ LL   LS +   N         G++E
Sbjct: 63   LGFSLCLTEVVALALE------KGVLARVDQYMHLLISALSKENVKN---------GKEE 107

Query: 123  RGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESCL 182
            RGLLFGK+FGLQ + NEP+FS VF T  + +  +   +  +M+ ++D+AL K WI+ES L
Sbjct: 108  RGLLFGKLFGLQVLLNEPLFSKVF-TPDENQLNVELMS-SYMSYLIDIALAKTWIRESSL 165

Query: 183  FTLFQTIQKLLPY-ANKDTYLSILSLLDSHNLSLTSEGLAVYLTILY-----GDTNDNKL 236
            FTLFQ ++KL P   ++    ++L LLDS  L+ TSEGLA+YL +L+     G     K 
Sbjct: 166  FTLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKG 225

Query: 237  DTSSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFV 296
                +  KNP WKNNDPL RGNLP ++  L+DS         ++        W PRLHF 
Sbjct: 226  FLDELNLKNP-WKNNDPLKRGNLPAISNALKDSG------ARDDPSLTQKGVWAPRLHFA 278

Query: 297  WDILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSER 356
            WDI+L  L+  +++  +  Q  SKKRKK   E    I+FPEFW+ VVDESFFNEK+SSER
Sbjct: 279  WDIVLQTLLHAENSEITTMQPPSKKRKKEEKE--AFIKFPEFWKSVVDESFFNEKSSSER 336

Query: 357  KYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQE 416
            KYLG L+F KT ++     L   FS N +R LINQ   ++R LHK+SQ AL TI+EVC+ 
Sbjct: 337  KYLGILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKA 396

Query: 417  DSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEK 476
                K       + FG  G+INFD LTK+KT++ L+S   L    L  L +   SN+   
Sbjct: 397  -QPEKTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGN 455

Query: 477  SENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKEN-----------E 525
             +   + R++LD +LH+VR HK   + +  + P+L  L+   FF +              
Sbjct: 456  LKELSRARFILDAILHLVRAHKAHAD-EVWLKPVLKALVCLGFFQQSELKDVKDSQESFH 514

Query: 526  PLNELAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIK 585
             L+ +A ER  SILA+L +V        W + A+ ++  K  T +  L+  +DE LG I 
Sbjct: 515  SLSSIASERLFSILADLLTVEQDTYSVCWPFIAVQLL--KTDTNQKTLLQSMDEELGDIL 572

Query: 586  NDACDVIVKIIKSPQSP---QXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGD 642
            + +  V+  I +        Q                 GE ES+S +E+L+ F  E +  
Sbjct: 573  DSSMTVLSSISQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDG 632

Query: 643  TESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGF 702
             +S  L G  EILLSL AQKKA+ RK SL+ WE F+ +V +++L +LL+VL  RENK+GF
Sbjct: 633  AKSAPLAGFIEILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGF 692

Query: 703  AHLFXXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNNIDKE 762
            ++LF                 N                               +  IDKE
Sbjct: 693  SNLF-EGGSESEGDSEEDEEMNDEEEPEKDASDDEIEESDNNVSEDDSSSDDDMGKIDKE 751

Query: 763  ATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLS 822
            ATSALAKALNLP++IV+DKGEV                                   QLS
Sbjct: 752  ATSALAKALNLPDSIVDDKGEVRFED------LGDTDEEEEESEEDLDDEKMMELDGQLS 805

Query: 823  EIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVE-KLQTADHSQK 881
            EIFKRRKEALS   TGN+RK E KESRENVIAFK RVVD+L + V+++E K++   H +K
Sbjct: 806  EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGHIEK 865

Query: 882  FV--NLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPV---XXXXX 936
             V   + + + P++ C++ TLDK LA+K++KLLK +I K+K S F ++   V        
Sbjct: 866  SVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPS-FSSTTEKVDKKAVLSL 924

Query: 937  XXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSW 996
                         GQ   LY++  S+ S+F +++ V  +  E   Y +L   Y  T   W
Sbjct: 925  LRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARL-VVDTFPELETYEELTGIYHKTLDGW 983

Query: 997  MSKSKFGPNFFADFFNWLASRK 1018
                KFG + F +F NWL+ +K
Sbjct: 984  FVTGKFGVSMFVEFLNWLSVKK 1005

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/706 (44%), Positives = 480/706 (67%), Gaps = 15/706 (2%)

Query: 2   VTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRSS 61
           + KVNRD FYKLASDL EER QAA+ ++K+L+ L +P E EEW Y +NRL+KGL S R+S
Sbjct: 1   MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNS 60

Query: 62  ARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRD 121
           ARLGFS+CL+E +NLALS+ + APEGL +I+++L++L++TL  D +       KK+KG+D
Sbjct: 61  ARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEG-----KKRKGKD 115

Query: 122 ERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESC 181
           ERG+LFGK+FGLQA+ NEP+FS+VF+TK DG +   P    F+ E+++L+  KNWI+E  
Sbjct: 116 ERGILFGKLFGLQALLNEPLFSNVFVTK-DGISNFVPV---FVQEMINLSKCKNWIREPA 171

Query: 182 LFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSI 241
           LF+L+QT++KL+   +K    +++S LD +NL++T+EGLA+YL ++      ++ + + I
Sbjct: 172 LFSLYQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEI 231

Query: 242 EFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDILL 301
           + +N GWK+NDPL++GNLP LT+VL D+     +E  E  K++  +NWNPRLHFVW+ LL
Sbjct: 232 KLQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLL 291

Query: 302 PILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLGF 361
             +I+G H+     +H+SKKRKKNN      I+F EFWQMVVDE++FN+KASSERKYLGF
Sbjct: 292 STIINGSHSLNVEDKHVSKKRKKNNT--IASIKFHEFWQMVVDETYFNDKASSERKYLGF 349

Query: 362 LIFIKTIKVV-SQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSN 420
           LIF +   ++ S   + +    NF+RSLINQ ++ KR L+K++   +  I+E C+ D++ 
Sbjct: 350 LIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT- 408

Query: 421 KLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENK 480
           K++     + FG SGSI FD+L+K+K +S+L+ I  +  + L+ LFD+ +  +S KSE K
Sbjct: 409 KILPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEK 468

Query: 481 QKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSILA 540
             ++++LD++LH+VR  K  ++   +   +L  +++ AFF  +NE L E++KER  SIL+
Sbjct: 469 SFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFSILS 528

Query: 541 ELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSPQ 600
           EL S+   E     QY  + ++ +    G+ ++ ++LD+ L + ++ A  ++ +I K+  
Sbjct: 529 ELNSLHLSESQEIPQYVVIKLVQQHIEGGE-KMTSELDDELRETESSALRILAEIAKATD 587

Query: 601 SPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLA 660
            P                  G++ES+ T++EL + Y++   D E   L  ITEILLSLLA
Sbjct: 588 KPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDER-PLSSITEILLSLLA 646

Query: 661 QKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF 706
           QKKA+L+K S+ VWEQ +  V ++ELN+LLD+L ARENKQGFA LF
Sbjct: 647 QKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

 Score =  221 bits (564), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 165/270 (61%), Gaps = 14/270 (5%)

Query: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXX 815
            VNNIDKE TSALAKAL+LP +I+N  GEVD+ K                           
Sbjct: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDD 812

Query: 816  XXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKL-Q 874
                QLSEIFKRRKEALS   TGN+RK E KESRE+VIAFK R+VDLL VY+K+VEK+ Q
Sbjct: 813  ----QLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQ 868

Query: 875  TAD-----HSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFK-NSA 928
              D      + K   L++F  PM+ C+++TLDKSLA+K++KLLKTR+FKI+ +  K ++A
Sbjct: 869  REDVDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIKLDTA 928

Query: 929  NPVXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQ 988
            + V                 PGQ P LYY++ SS SL+FSKI V ++  +   Y  L+D 
Sbjct: 929  DVV---EDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDT 985

Query: 989  YSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
            YS T K W+  +KF  + F DF NWLAS+K
Sbjct: 986  YSTTIKEWLKDTKFPHSIFLDFVNWLASKK 1015

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1060 (38%), Positives = 569/1060 (53%), Gaps = 102/1060 (9%)

Query: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
            +  +V+RDLFYKLASDL EER QA I LV +L+ +    E+ EW YV+NRLIKGL+S R+
Sbjct: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKV--EKESREWEYVLNRLIKGLSSSRN 59

Query: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120
             ARLG+ LCLTEV+  AL         L   D++L+LL  TLS +   N         G+
Sbjct: 60   GARLGYCLCLTEVVASALE-----KSVLAHADEYLRLLLSTLSRENIKN---------GK 105

Query: 121  DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180
            +ERG+LFGK+FGLQ + NEP+FS VF  + +   E   F   ++  ++D+AL K WI+ES
Sbjct: 106  EERGILFGKLFGLQVLLNEPLFSQVFKAEDEINLE---FMLTYVGTLIDVALAKTWIRES 162

Query: 181  CLFTLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILY----------- 228
             +FTL+Q I+KL P       L ++L+LLDS  L+ TSEGLAVYL + +           
Sbjct: 163  SMFTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRK 222

Query: 229  -GDTNDNKLDTSSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNAS 287
             G   D KL        N  WKNNDPLS+GNLP +   L++ + ++     + S KQ   
Sbjct: 223  KGLLEDLKL--------NSPWKNNDPLSKGNLPAIANALKEINSSE-----DLSVKQKGI 269

Query: 288  NWNPRLHFVWDILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESF 347
             W PRLHFVWDI+L     G       ++   KKRKK++ E  + I+FPEFW+ VVDESF
Sbjct: 270  -WMPRLHFVWDIILTSFFEGGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESF 328

Query: 348  FNEKASSERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNAL 407
            FNEK+SSERKYLGFL+F K   +   +  +   S N  R LINQ   S+R LHK+SQ  L
Sbjct: 329  FNEKSSSERKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVL 388

Query: 408  NTIIEVCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFD 467
             TI++VC+ +   K       +     GSI+FD+LTKSKT++ L+S   L  + L  L +
Sbjct: 389  TTIVDVCK-NQPEKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGE 447

Query: 468  LFTSNISEKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFF------- 520
            + T+++     +  + R++LD +LH+VR HK+  +    + PLLD L+Q  FF       
Sbjct: 448  VLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKSAAD-KVWLAPLLDSLVQQGFFELDENDR 506

Query: 521  ----AKENEPLNELAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNK 576
                  E   +++LA ER  SILA+L S   K     W  + ++I++ K +  K  L+N 
Sbjct: 507  QPEVGDETFTVSKLAVERLYSILADLISADYKSEKVCWPRFTVEILMSKLKKNK--LLNP 564

Query: 577  LDENLGKIKNDACDVIVKII----KSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEEL 632
            +DE L +I N +      I     K  +  Q                 GET+S+  +++L
Sbjct: 565  MDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDL 624

Query: 633  IEFYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDV 692
              F++  + + +S S  G  EILLSL AQKKA+LRK SL+VWE F+    ++++ +LL++
Sbjct: 625  NSFHQTLE-ENKSGSYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEI 683

Query: 693  LKARENKQGFAHLFXXXXXXXXXXXXXXXXSNQXXXXXXXXXXXXXXXXXXXXXXXXXXX 752
            L ARENK+GF+ LF                                              
Sbjct: 684  LPARENKEGFSKLFEGDDEGGSDEEEI-----SDELFAEEGASGDNTEEEESGPDSDDQD 738

Query: 753  XXXVNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXX 812
                  IDKEATSAL KALNLPE+IVND GEV                            
Sbjct: 739  GEDTEQIDKEATSALVKALNLPESIVNDNGEVHFED-------LEDTEDEEISDEDLDDE 791

Query: 813  XXXXXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVE- 871
                   QLSEIFKRRKEALS   TGN+RK E KESRENVIAFK RVVD+L ++V++ E 
Sbjct: 792  KMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAES 851

Query: 872  KLQTADHSQKFVN--LISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSST------ 923
            +L+     +K V   +IS + P+++CV+ TLDK LA+KV+KLLK +I K+K +T      
Sbjct: 852  ELKQGGRPEKSVTSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTSLDG 911

Query: 924  -----FKNSANPVXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASSTDE 978
                 F+NS   V                  GQ   LY++  S+AS+F +K++V  S   
Sbjct: 912  LEENLFENSLKSVHEAMLLKKC---------GQFQNLYFSACSTASMFLAKLFVHRSP-R 961

Query: 979  TNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
               Y  L + Y  T   W    KF  N F +F NWL+ +K
Sbjct: 962  PETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKK 1001

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/732 (46%), Positives = 464/732 (63%), Gaps = 54/732 (7%)

Query: 1   MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60
           MV K+NRDLFYKLASDLQEER QAAISL+KEL +L   +   EW YV+NRLIKGL+S+R+
Sbjct: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASL--ENNDSEWEYVLNRLIKGLSSNRN 58

Query: 61  SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120
           SARLGFSLCLTEV+++AL         L +I++++QLL  TL  +T  N         G+
Sbjct: 59  SARLGFSLCLTEVLSVALEKGY-----LNSIEEYIQLLQSTLLKETVKN---------GK 104

Query: 121 DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180
           +ERGLLFG+MFGLQA+ NEP+ S +FL K  G      F   FM E+V +AL K WI+E 
Sbjct: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLN--AHFMVNFMGELVQVALSKTWIREP 162

Query: 181 CLFTLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239
           CLFTLFQ ++KL P+ N    + SI  LLD + LSLT+EGLA+YL +++     +K    
Sbjct: 163 CLFTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKK 222

Query: 240 SIEFKN----PGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHF 295
           S   KN      WKNNDPL++GNLP L+ VL+D S        E+S  +   +W PRLHF
Sbjct: 223 SGLLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPV------EDSGLKQKGSWAPRLHF 276

Query: 296 VWDILLPILISGKHTTASNTQHISKKRKKNN--NELPKHIEFPEFWQMVVDESFFNEKAS 353
           VW+I+LPIL        S+ +HI+KKRKK    +   K IEFPEFW+ VVDESFFNEK+S
Sbjct: 277 VWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSS 336

Query: 354 SERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEV 413
            ERKYLGFLI     K V  + ++  FS N MR+LINQS+DSKR+LHK+SQ  L +I+E+
Sbjct: 337 GERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILEL 396

Query: 414 CQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNI 473
           C E   +K V  + AM+F  +G+INFDKLTK+KT+  L++   +  K L+ L DLF S++
Sbjct: 397 C-ESHPDKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHL 455

Query: 474 -SEKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFA-------KENE 525
             + +E     R++LD++LH+VRTHKT +     V PL+  +I   FF        +EN+
Sbjct: 456 PDDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKVDQENQ 514

Query: 526 PLNEL------AKERFSSILAELTSVIPKEPHH-SWQYYALDIILKKERTGKFELVNKLD 578
             +        A+ER  SILA+L  +  +  H  SW Y  L ++L +E++   EL++ LD
Sbjct: 515 DDDHTDGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQSK--ELIHPLD 572

Query: 579 ENLGKIKNDACDVIVKIIK----SPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIE 634
           + L KIK DA + +  I +     P + Q                 G+TESLS +E+L+ 
Sbjct: 573 DGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVT 632

Query: 635 FYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLK 694
           FY   +  +E  SL+G+ EILL+LLAQKKA+LR+LSL+VWE F+  VG  EL +L D+L 
Sbjct: 633 FYHSMRDSSEENSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILS 692

Query: 695 ARENKQGFAHLF 706
           ARENK+GF  LF
Sbjct: 693 ARENKEGFTALF 704

 Score =  208 bits (530), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 160/267 (59%), Gaps = 7/267 (2%)

Query: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXX 815
            +N IDKE TSALAKALNLP+ I+N+ GEV+  +                           
Sbjct: 779  INKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMEL 838

Query: 816  XXXXQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQT 875
                QLS+IF+RRKEALS  STGN+RK+EAKESRENVIAFK +VVD+L V+VK+VE+   
Sbjct: 839  DD--QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSK 896

Query: 876  ADHS--QKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVXX 933
                   +  ++ S  +P++ CVQ+T DK+LADK+SKL+K R+ K+K     N ++ +  
Sbjct: 897  NKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEE 956

Query: 934  XXXXXXXXXXXXXXXP--GQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSN 991
                              GQ P LY++  S  SLF SK+ V +ST+++  Y++LID Y +
Sbjct: 957  LTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDS-IYDRLIDIYLS 1015

Query: 992  TTKSWMSKSKFGPNFFADFFNWLASRK 1018
            T K W SK KFG +FF DF NWLAS+K
Sbjct: 1016 TMKKWFSKGKFGTSFFFDFINWLASKK 1042

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  530 bits (1364), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 308/714 (43%), Positives = 456/714 (63%), Gaps = 42/714 (5%)

Query: 4   KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETE-EWTYVVNRLIKGLASDRSSA 62
           +V+RDLFYKLASD+ EER  + + +V  L  L + DE E EW YVV+RL+KGL S+R+SA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63  RLGFSLCLTEVINLALSMK-ENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRD 121
           RLGFS+CLTE ++L LS      P  L+ + D+L+ +     L +      A  K KG+D
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPL-SAVGTGKAKVKVKGKD 120

Query: 122 ERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESC 181
           ERG LFG++F  + + NEP+FS +F  K         F  +F   V+ L   KNW+ E C
Sbjct: 121 ERGTLFGRLFAYKVLLNEPLFSLLFDQK---------FLIEFQERVIQLGSMKNWLLEPC 171

Query: 182 LFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSI 241
            F+L+Q I+KLLP  +++   + ++ +D H L++T+EGL+VYL +        K   S  
Sbjct: 172 FFSLYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA------KKFTLSDF 225

Query: 242 EFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDILL 301
             +N  WK NDPL +GNL ++ +V+ D++V       + +      NW PRLH++WDI+L
Sbjct: 226 TLENSAWKANDPLQKGNLSVMAKVMLDTNV-------DGANSNTNKNWAPRLHYIWDIIL 278

Query: 302 PILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLGF 361
                 +    S+ +H+ +K+K + ++ P+ +EF  FWQ VVDESFFN+KAS ERKY G+
Sbjct: 279 REFFDNEQH-GSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGY 337

Query: 362 LIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSNK 421
           LIF K ++ V  +++  CF+ N MRS+INQ++DSKR+L+K+SQ  LNT++ +C+ + + K
Sbjct: 338 LIFQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-K 396

Query: 422 LVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTS--NISEKS-- 477
           L   + A++F   GS+NFD LTKSKT+S+L++    D   LA L  LFTS  N+S+K+  
Sbjct: 397 LTPVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPE 456

Query: 478 --ENKQKNRYVLDTLLHIVRTHKTGLEYD-AIVTPLLDPLIQWAFFAKENEPLNELAKER 534
             E   + +++LD+LL+++R+ K  LE D  IV  +L+  IQ AFF K+NE +N +AKER
Sbjct: 457 LEELNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDNEYINNIAKER 516

Query: 535 FSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVK 594
            SS+LAEL  V+P     SW Y AL+II+ KE++    L++ LD++L  +K ++ D++ K
Sbjct: 517 LSSMLAELI-VLPS-TDGSWPYLALEIIVTKEKSET--LIDSLDDSLVAVKAESLDILKK 572

Query: 595 I--IKSPQSPQXXXXXXXXXXXXXXXXXGETESLSTIEELIEFYKEHKGDTESTSLVGIT 652
           I  +KS +S Q                 G+ ES+  IE+L  FY E   + E+ +  G+T
Sbjct: 573 ISELKS-KSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHE-TSNHETANFTGVT 630

Query: 653 EILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF 706
           EILLSLLAQ+K++LRKLSL+VWEQFI  +GKEE+N+LL+ L ARENK+GF+ LF
Sbjct: 631 EILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684

 Score =  201 bits (510), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 152/277 (54%), Gaps = 14/277 (5%)

Query: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKXXXXXXXXXXXXXXXXXXXXXXXXXXX 815
            ++ IDKE TSALAKALNLP+NI+N+ GEV++                             
Sbjct: 744  ISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKM 803

Query: 816  XXXX-QLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQ 874
                 QLSEIFKRRK+ALST STGNQRK++ KESRENVIAFK R++D+L +Y+K++E+L 
Sbjct: 804  MELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863

Query: 875  -----------TADHSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSST 923
                       T    Q    +++ V+    CVQ+TLDK L +K+ KL K R  KI+ + 
Sbjct: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923

Query: 924  FKNSANPVXXXXXXXXXXXXXXXXXPGQHPQLYYTLSSSASLFFSKIYVASS--TDETNA 981
            F++                      PGQ    YY   SS SL+  +  + ++   ++T  
Sbjct: 924  FEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKM 983

Query: 982  YNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018
            + KL+D Y+ TTK WM + K+G   F DF+NWLAS+K
Sbjct: 984  FEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020

>KAFR0F01200 Chr6 (225381..231047) [5667 bp, 1888 aa] {ON} Anc_6.257
           YPL231W
          Length = 1888

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 22/124 (17%)

Query: 95  LQLLSKTLSLDTNANEKGALKKKKGRDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKT 154
           LQ+L++ L +D N+ E+  LK+K    E          LQ+  +       FLT++ G+ 
Sbjct: 340 LQVLARYLKMDLNSGERKLLKEKDAVSE----------LQSQLD-------FLTQELGEF 382

Query: 155 EITPFAFKFMNE---VVDLALKKNWIKESCLFTLFQTIQKLLPYANKDTYLSILSLLDSH 211
            ++  A  F  +   V D +   NW K+S L   F+ I  +L   +++     +++++  
Sbjct: 383 YVSGLATYFSRKKARVFDSSW--NWAKQSLLSLYFEIIHGVLKNVDREVVSEAINIMNRS 440

Query: 212 NLSL 215
           N +L
Sbjct: 441 NAAL 444

>Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {ON}
            YNR031C (REAL)
          Length = 1376

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 380  FSHNFMRSLINQSTDSKR-------LLHKMSQNALNTIIEVCQEDSSNKLVKCVNAMVFG 432
            F  +F RS +  +  S +       L+ K+S N L  ++EVC          CV AM F 
Sbjct: 894  FERDFGRSFLKNNVFSSKKKSIIILLMVKLSINWLKFLVEVCDPTEQQTFRWCVPAMEFA 953

Query: 433  PSGSINFDKLT----KSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENKQKNRYVLD 488
               +  ++ LT    + + + + IS+    +  L   FD+  +  +E  +  Q+ R  +D
Sbjct: 954  MQMTSGYNILTLDNSQFQELKEKISVC---MSLLISHFDVMGARATEAEKGTQQARLNID 1010

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score = 32.0 bits (71), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 475 EKSENKQKN-RYVLDTLLHIVRTHKTGLEYDAIVTPLLDP-LIQWAFFAKENEPLNELAK 532
           EK  N+ K+  +VL  + +I+   + G +YD+++TPLLD  L+Q    A  N   N L+K
Sbjct: 13  EKDRNEFKDPEHVLANIKYII--PRIGQKYDSLITPLLDKQLLQKGEIAVANSKTNYLSK 70

Query: 533 ERF 535
           E +
Sbjct: 71  ELY 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,035,944
Number of extensions: 4068711
Number of successful extensions: 15714
Number of sequences better than 10.0: 60
Number of HSP's gapped: 15908
Number of HSP's successfully gapped: 99
Length of query: 1018
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 898
Effective length of database: 39,721,479
Effective search space: 35669888142
Effective search space used: 35669888142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)