Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E028807.346ON42942922590.0
Suva_10.2977.346ON43641417610.0
Skud_12.2667.346ON43641917550.0
Smik_12.2617.346ON43641917500.0
YLR203C (MSS51)7.346ON43641417470.0
NDAI0E044807.346ON44341217430.0
TDEL0C020207.346ON42540417400.0
SAKL0F11286g7.346ON42341817370.0
CAGL0A03927g7.346ON43741517310.0
TPHA0F029307.346ON43641917000.0
Kpol_530.357.346ON42540516980.0
KLTH0H01342g7.346ON42241816800.0
Kwal_56.246317.346ON42240316710.0
KLLA0D12430g7.346ON41840716500.0
KNAG0B026307.346ON43841016350.0
ZYRO0F11616g7.346ON41540316190.0
Ecym_47277.346ON42942916190.0
NCAS0A141207.346ON42743015280.0
TBLA0E005007.346ON43743015260.0
ACL152W7.346ON42841815250.0
KAFR0B008407.346ON42640315170.0
NDAI0A019307.346ON45041615000.0
KNAG0C037507.346ON42440114880.0
KAFR0E035705.487ON52334751.2
Smik_13.68.867ON51264704.4
Kwal_33.14788na 1ON29647678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E02880
         (429 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   874   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   682   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   680   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   678   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   677   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   676   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   674   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   673   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   671   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   659   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   658   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   651   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   648   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   640   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   634   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   628   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   628   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   593   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   592   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   592   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   588   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   582   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   577   0.0  
KAFR0E03570 Chr5 (719253..720824) [1572 bp, 523 aa] {ON} Anc_5.4...    33   1.2  
Smik_13.6 Chr13 complement(11595..13133) [1539 bp, 512 aa] {ON} ...    32   4.4  
Kwal_33.14788 s33 (817935..818825) [891 bp, 296 aa] {ON} [contig...    30   8.8  

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/429 (97%), Positives = 418/429 (97%)

Query: 1   MFLRTSVPVYRTTLLPRNAFNVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQ 60
           MFLRTSVPVYRTTLLPRNAFNVAGNQTRHLMGFVRNALGL           ENRFHPWDQ
Sbjct: 1   MFLRTSVPVYRTTLLPRNAFNVAGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQ 60

Query: 61  SPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLK 120
           SPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLK
Sbjct: 61  SPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLK 120

Query: 121 KVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKML 180
           KVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKML
Sbjct: 121 KVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKML 180

Query: 181 SYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFI 240
           SYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFI
Sbjct: 181 SYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFI 240

Query: 241 LGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLK 300
           LGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLK
Sbjct: 241 LGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLK 300

Query: 301 LIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFT 360
           LIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFT
Sbjct: 301 LIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFT 360

Query: 361 TGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFR 420
           TGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFR
Sbjct: 361 TGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFR 420

Query: 421 GKRYPTIKR 429
           GKRYPTIKR
Sbjct: 421 GKRYPTIKR 429

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/414 (75%), Positives = 355/414 (85%)

Query: 16  PRNAFNVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRT 75
           P+N   V+    RHLMGFVRNALGL           ENRFHPWDQSPS DLRERAA+IRT
Sbjct: 22  PQNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRT 81

Query: 76  LARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPF 135
           LA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLRSGRPF
Sbjct: 82  LAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPF 141

Query: 136 PEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSP 195
           PEFDFP+ QG D+ VN+TNWDLFLYTR+FYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSP
Sbjct: 142 PEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSP 201

Query: 196 YSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWK 255
           YSL PKGPI+LEGLKSLAALRYTLYP++NR V++TT+ R MRIFILGARAE+QLPGHVWK
Sbjct: 202 YSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWK 261

Query: 256 QLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQ 315
           QLQ+LFPEQ FEIHFIGPE  Y +DK++Y++  TP+ + +DETLK  +HT++F   HEAQ
Sbjct: 262 QLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQ 321

Query: 316 DFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVV 375
           DFFPYDPYMDVFF FHPG+AS E    WM +TM  LL+TKCAIFTTGF K DL++DI +V
Sbjct: 322 DFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLV 381

Query: 376 QDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429
           + KYGKE+DILM P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 382 KSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/419 (75%), Positives = 360/419 (85%), Gaps = 3/419 (0%)

Query: 14  LLPRNAFN--VAGNQTR-HLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERA 70
           LL R+ +N  V  +QTR HLMGFVRNALGL           ENRFHPWDQSPS DLRERA
Sbjct: 17  LLRRSPYNRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERA 76

Query: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130
           A+IRTLA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLR
Sbjct: 77  AKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLR 136

Query: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190
           SGRPFPEFDFP+ QG D+ VN+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGSVL
Sbjct: 137 SGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVL 196

Query: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250
           H+FSPYSL PKGPI+LEGLKSLAALRYTLYP++NR V++TTK R MRIFILGARAE+QLP
Sbjct: 197 HKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLP 256

Query: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310
           GHVWKQLQ+LFPEQ FEIHF+GPE  Y +DK++Y++  TP+ + VDETL+ I+HT++F  
Sbjct: 257 GHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDV 316

Query: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370
            HEAQDFFPYDPYMDVFF FHPG+AS E    WM +TM+ LL+TKCAIFTTGF K DL++
Sbjct: 317 FHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMD 376

Query: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429
           DI  V+ KYGKE+DILM P +NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 377 DINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/419 (75%), Positives = 360/419 (85%), Gaps = 3/419 (0%)

Query: 14  LLPRNAFN--VAGNQTR-HLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERA 70
           LL R++ N  V  +QTR HLMGFVRNALGL           ENRFHPWDQSPS DLRERA
Sbjct: 17  LLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERA 76

Query: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130
           A+IRTLA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLR
Sbjct: 77  AKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLR 136

Query: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190
           SGRPFPEFDFP++QG D+ VN+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGS+L
Sbjct: 137 SGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLL 196

Query: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250
           H+FSPYSL PKGPI+LEGLKSLAALRYTLYP++NR +++ TK R MRIFILGARAE+QLP
Sbjct: 197 HKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLP 256

Query: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310
           GHVWKQLQ+LFPEQ FEIHFIGPE  Y +DK++Y++ TTP+ + VDETLK I+ T++F  
Sbjct: 257 GHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEV 316

Query: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370
            HEAQDFFPYDPYMDVFF FHPG+AS E    WM +TMK LL+TKCAIFTTGF K DL +
Sbjct: 317 FHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTD 376

Query: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429
           D+ +V+ KYGKE+DILM P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 377 DLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/414 (76%), Positives = 354/414 (85%)

Query: 16  PRNAFNVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRT 75
           P N   V+    RHLMGFVRNALGL           ENRFHPWDQSPS DLRERAA+IRT
Sbjct: 22  PHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRT 81

Query: 76  LARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPF 135
           LA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLRSGRPF
Sbjct: 82  LAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPF 141

Query: 136 PEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSP 195
           PEFDFP+ QG D+ VN+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSP
Sbjct: 142 PEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSP 201

Query: 196 YSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWK 255
           YSL PKGPI+LEGLKSLAALRYTLYP++NR + +TTK R MRIFILGARAE+QLPGHVWK
Sbjct: 202 YSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWK 261

Query: 256 QLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQ 315
           QLQ+LFPEQ+FEIHFIGPE  Y +DK++Y++ TTP+ + VDETLK IY T +F   HEAQ
Sbjct: 262 QLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQ 321

Query: 316 DFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVV 375
           DFFPYDPYMDVFF FHPG+AS E    WM +TMK LL+TKCAIFTTGF K DL +DI +V
Sbjct: 322 DFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLV 381

Query: 376 QDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429
           + KYGKE+D+LM+P +NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 382 KSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/412 (74%), Positives = 358/412 (86%)

Query: 17  RNAFNVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTL 76
           RN  +V+ + +R LMGFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTL
Sbjct: 31  RNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTL 90

Query: 77  ARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFP 136
           A CPVT KEINYTCPISGIPTHHS+ AWE D+ YH++K YE+LKKVNIYEHDLRSGRPFP
Sbjct: 91  AHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFP 150

Query: 137 EFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPY 196
           EF FP+DQ  DRM+NMTNWDLFLYTR+FYSMDTEFQMAAVTKMLSYPITIGS+LHQFSPY
Sbjct: 151 EFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPY 210

Query: 197 SLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQ 256
           SLQPKGPI+LEGLKS+AALRYTLYP  N+  ++ TK RPMRIF+LGARAE+QLPGH+WKQ
Sbjct: 211 SLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQ 270

Query: 257 LQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQD 316
           LQYLFPEQ FE+ FIGPE+YYDK+KK+Y++L  P+ +++D+TLKL + TEYFH LHE+QD
Sbjct: 271 LQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQD 330

Query: 317 FFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQ 376
            FPYDPYMDVFFIFHPGF++ E  EHWM DTMK LL+T+CAIF TGF++ND+L D+ ++ 
Sbjct: 331 LFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILD 390

Query: 377 DKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           +KY  +LDILMKP KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRYPT++
Sbjct: 391 EKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/404 (76%), Positives = 349/404 (86%), Gaps = 1/404 (0%)

Query: 25  NQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGK 84
           NQ R ++GFVRNALGL           ENRFHPWDQSP  DLRERAARIRTLARCPVTGK
Sbjct: 22  NQRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGK 81

Query: 85  EINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQ 144
           EINYTCP+SGIPTHHSREAWEQDK+YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFP+ Q
Sbjct: 82  EINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQ 141

Query: 145 GQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPI 204
             DR VNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPI+I SVLHQFSPYSL PKGP+
Sbjct: 142 DFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPV 201

Query: 205 SLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQ 264
           +LEGLKSLAALRYTLYP++N+  IS+TK RPMRIFILGARAE+QLPGHVWKQLQYLFPEQ
Sbjct: 202 TLEGLKSLAALRYTLYPLENK-TISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQ 260

Query: 265 TFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYM 324
            FE+HF+GPE   +K+K +Y+  +TP+ + VDET+  +YHT++FH LHEAQDFFPYDPY+
Sbjct: 261 MFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYL 320

Query: 325 DVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELD 384
           DVFF FHPGF + E    W+ +TMKGLL+TKCAIFTTGF K DLL D+  V+DKYGKE+D
Sbjct: 321 DVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVD 380

Query: 385 ILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           +LM+P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 381 VLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/418 (73%), Positives = 354/418 (84%), Gaps = 3/418 (0%)

Query: 11  RTTLLPRNAFNVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERA 70
           R ++ P +A  +   Q RH++GFVRNALGL           +NRFHPWDQSPSPDLR RA
Sbjct: 8   RCSIAPASATRI---QKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRA 64

Query: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130
           A IR LARCPVTGKEINYTCP SGIPTHHSREAWEQD  YHA+K+YE+LKKVNIYEHDLR
Sbjct: 65  ATIRALARCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLR 124

Query: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190
           SGRPFPEFDFP+DQ  DRMVNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP T+GSVL
Sbjct: 125 SGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVL 184

Query: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250
           H+FSPY+L PKGPI+LEGLKSLAALRYTLYP Q+R V + TK RPMRIFILGARAE+QLP
Sbjct: 185 HEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLP 244

Query: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310
           GHVWKQ Q+LFPE  FE+HFIGPES+YD++K++YI  +TPI   VDETL  +YHT+YFH 
Sbjct: 245 GHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHV 304

Query: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370
            HEAQDFFPYDPY+D+FF FHPGFA+ E  EHWM  TM+GLL+TKCAIFTTGF + DL+ 
Sbjct: 305 FHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVR 364

Query: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           D+  V++KYG E+D+LM+P +N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 365 DMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/415 (75%), Positives = 350/415 (84%), Gaps = 14/415 (3%)

Query: 28  RHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEIN 87
           R LMGFVRNALGL           +NRFHPWDQSP+ DLRERAARI+TLA+CPVT K I 
Sbjct: 22  RQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPIQ 81

Query: 88  YTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQD 147
           YTCPISGIPTHHSREAWEQDKEYHASK+YE+LKKVNIYEHDLRSGRPFPEFDFPRDQG D
Sbjct: 82  YTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGPD 141

Query: 148 RMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLE 207
           R VN+TNWDLFLYTR+FYSMDTEFQ+AAVTKMLSYPITIGSVLHQFSPYSL PKGPI+LE
Sbjct: 142 RTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLE 201

Query: 208 GLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTFE 267
           GLKSLAALRYTLYP+QNR V +T K +PMRIFILGARAE+QLPGHVWKQLQ+LFP+Q FE
Sbjct: 202 GLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNFE 261

Query: 268 IHFIGPESYYDKDKKKYIQLTT--------------PITESVDETLKLIYHTEYFHKLHE 313
           IHFIGPES YD+++ +YI+  T              P+T+ +DET+K  YHT+YFH LH 
Sbjct: 262 IHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLHT 321

Query: 314 AQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIA 373
           AQDFFPYDPY DVFF+FHPG AS E  + WMKDT+KGLLDTKCAIFTTGF K D+ +DI 
Sbjct: 322 AQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDIQ 381

Query: 374 VVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           ++QD YGKE+D+LM P KNVFGSTKWEL+D +P  VYQFNMYIAGFRGKRY  IK
Sbjct: 382 ILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIK 436

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/419 (72%), Positives = 349/419 (83%), Gaps = 2/419 (0%)

Query: 13  TLLPRNAF-NVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAA 71
            +L +N   ++  +Q R LMGFV+NALGL           ENRFHPWDQSPSPDLRERAA
Sbjct: 18  NILNKNTLTSLPSSQKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAA 77

Query: 72  RIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRS 131
           RIRTLA+CPVT KEINYTCP+SGIPTHHSREAWE DK+YH SKRYE+LKKVNIYEHDLRS
Sbjct: 78  RIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRS 137

Query: 132 GRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLH 191
           GRPFPEFDFP DQ  DR+VN+TNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TIGS+LH
Sbjct: 138 GRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILH 197

Query: 192 QFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVIS-TTKARPMRIFILGARAESQLP 250
           QFSPYSL PKGPI+LEGLKSLAALRY+LYP Q +  IS     RPMRIFILGARAE+QLP
Sbjct: 198 QFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLP 257

Query: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310
           GHVWKQLQ+LFP+QTFEIHFIG E   + +K KYI+   P+ + +DET+KLIYH++YFH 
Sbjct: 258 GHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHV 317

Query: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370
            HEAQDF PYDPY+DVFF FHPGFA+ E  + WM DTMK LL+TKCAIFTTGF K D+  
Sbjct: 318 YHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITN 377

Query: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429
           D+ +V+ +YGKE+D LM P KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRY TIKR
Sbjct: 378 DVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/405 (75%), Positives = 345/405 (85%), Gaps = 2/405 (0%)

Query: 26  QTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKE 85
           Q R LMGFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA+CPVT K+
Sbjct: 20  QKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79

Query: 86  INYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQG 145
           INYTCP+SGIPTHH +EAW  DK+YH SKRYE+LKKVNIYEHDLRSGRPFPEFDFP+DQ 
Sbjct: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139

Query: 146 QDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPIS 205
            DR++N+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGS+LHQFSPYSL PKGP++
Sbjct: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199

Query: 206 LEGLKSLAALRYTLYPMQNRL--VISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPE 263
           LEGLKSLAALRYTLYP QN+   V   T+ RPMRIFILGARAE+QLPGHVWKQ QYLFPE
Sbjct: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259

Query: 264 QTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPY 323
           Q FEIHFIGPE Y +K+K +YI  +TPI + VD+TLKL++H +YFH  HEAQDFFPYDP+
Sbjct: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319

Query: 324 MDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKEL 383
           +DVFF FHPG+A  E  E W+ +TMK LLDTKCAIFTTGF+K DLL DI VV+++YG EL
Sbjct: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379

Query: 384 DILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           D+LM P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/418 (72%), Positives = 343/418 (82%), Gaps = 2/418 (0%)

Query: 13  TLLPRNAFNVAGN--QTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERA 70
            +L RN      +  Q RH+MGFVRNALGL           ENRFHPWDQSPSPDLRERA
Sbjct: 4   CILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERA 63

Query: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130
           A IR LA+CPVTG+EINYTCP SGIPTH+SREAWE D EY  SKR E+LKKVNIYEHDLR
Sbjct: 64  ATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLR 123

Query: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190
           SGRPFPEFDFP DQ  DRMVN+TNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TIGSVL
Sbjct: 124 SGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVL 183

Query: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250
           HQFSPYSL PKGP++LEGLKSLAALRYTLYP QNR V S TK  P+RIFILGARAE+QLP
Sbjct: 184 HQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLP 243

Query: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310
           GHVWKQLQ++FPE   E+HF+GPESYYD++K++Y+  ++PI   VDETL  +YHT+YFH 
Sbjct: 244 GHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHV 303

Query: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370
            HEAQDFFPYDPY D+FF FHPGFA+ E  E+WM  TM+ LL+TKCA+FTTGF + DL  
Sbjct: 304 FHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRR 363

Query: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           D+  V  K+GKELD+LM+P  N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRY  I+
Sbjct: 364 DVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/403 (74%), Positives = 336/403 (83%)

Query: 26  QTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKE 85
           Q RH+MGFVRNALGL           ENRFHPWDQSPSPDLRERAA IR LA+CPVTG+E
Sbjct: 19  QKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGRE 78

Query: 86  INYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQG 145
           INYTCP SGIPTHHSREAWE+D +Y  SKR E+LKKVNIYEHDLRSGRPFPEFDFP DQ 
Sbjct: 79  INYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQD 138

Query: 146 QDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPIS 205
            DRMVN+TNWDLF YTR F+SMDTEFQ+AAVTKMLSYPITIGSVLHQFSPYSL PKGPI+
Sbjct: 139 FDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 198

Query: 206 LEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQT 265
           LEGLKSLAALRYTLYP QNR V S  K  P+RIF+LGARAE+QLPGHVWKQLQ++FPE  
Sbjct: 199 LEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQ 258

Query: 266 FEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYMD 325
            EIHF+GPESYYD++K++Y+    PI   VDETL  +YHT+YFH  HEAQDFFPYDPY D
Sbjct: 259 MEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTD 318

Query: 326 VFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDI 385
           +FF FHPGFA+ E  E+WM  TM+ LL+TKCAIFTTGF + DL  D+  V  +YGKELDI
Sbjct: 319 IFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDI 378

Query: 386 LMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           +M P KN FGSTKWELND+NPQEVYQFNM++AGFRGKRY  I+
Sbjct: 379 IMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIE 421

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/407 (73%), Positives = 341/407 (83%), Gaps = 2/407 (0%)

Query: 23  AGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVT 82
           A   TR +MGFVRNALGL           ENRFHPWDQSPSPDLRERAARI+ +A CPVT
Sbjct: 12  AKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVT 71

Query: 83  GKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPR 142
            K+I +TCP+SGIPTHHSREAWE+D EYH SKRYELLKKVNIYEHDLRSGRPFPEFDFP+
Sbjct: 72  HKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQ 131

Query: 143 DQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKG 202
           DQ  DRMVNM+NWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGSVLHQ+SPYSL PKG
Sbjct: 132 DQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKG 191

Query: 203 PISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFP 262
           PI+LEGLKSLAALRYTLYP Q+       +  P+RIFILG RAE+QLPGHVWKQLQYL P
Sbjct: 192 PITLEGLKSLAALRYTLYPEQSGR-FRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIP 250

Query: 263 EQTFEIHFIGPESYYDKDKKKYIQLTTP-ITESVDETLKLIYHTEYFHKLHEAQDFFPYD 321
           + + E+HF+GPES+YD++K+ Y+Q +T  I + +DE ++L YHT++FH  HEAQDFFPYD
Sbjct: 251 DTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYD 310

Query: 322 PYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGK 381
           PY DVFF FHPGFA+ E  E+WM DTMK L+ TKCA+FTTGF+K DLL DI++VQDKYG 
Sbjct: 311 PYNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGS 370

Query: 382 ELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           ELD+LM+P  NVFGSTKWELND NP EVYQFNMYIAGFRGKRY  I+
Sbjct: 371 ELDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/410 (72%), Positives = 341/410 (83%), Gaps = 8/410 (1%)

Query: 28  RHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEIN 87
           R LMGFVRNALGL           ENRFHPWDQSP   LRERAARI+TLA+CPVTG  + 
Sbjct: 29  RQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNVE 88

Query: 88  YTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQD 147
           YTCP+SGIPTHHSREAWEQD +YHA+KRYE LKKVNIYEHDLRSGRPFPEFDFP++QG D
Sbjct: 89  YTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGYD 148

Query: 148 RMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLE 207
           ++VNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TI S+L QFSPYSL PKGPI+LE
Sbjct: 149 KVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITLE 208

Query: 208 GLKSLAALRYTLYPM----QNRLVISTT----KARPMRIFILGARAESQLPGHVWKQLQY 259
           GLKSLAA+RYTLY        R    TT    K RPMR+F+LGARAE+QLPGHVWKQL Y
Sbjct: 209 GLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLSY 268

Query: 260 LFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFP 319
           LFPEQ+FE+ FIGPESYYD+ + +Y++  TP+ E VDETLK I++T+YFH LHE+QDFFP
Sbjct: 269 LFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDFFP 328

Query: 320 YDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKY 379
           YDPY D FF FHPGFAS E  + W+ +T+  LLDTKCAIFTTGF ++DL+ D+A++ +K+
Sbjct: 329 YDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEKF 388

Query: 380 GKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429
           G E+DILM+PTKNVFGSTKWELND+NP EVYQFNMYIAGFRGKRY TIKR
Sbjct: 389 GSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/403 (71%), Positives = 336/403 (83%), Gaps = 1/403 (0%)

Query: 26  QTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKE 85
           Q R ++GFVRNALGL           ENRFH WDQSP+ DLRERAARIR LA+CPVTGKE
Sbjct: 13  QRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKE 72

Query: 86  INYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQG 145
           INYTCP+SGIPTHHS+EAWEQDK+YH SK++ELLKKVNIYEHDLRSGRPFPEFDFP+D  
Sbjct: 73  INYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLE 132

Query: 146 QDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPIS 205
            DR VNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPITI SVL+QFSPYSL PKGPI+
Sbjct: 133 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPIT 192

Query: 206 LEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQT 265
           LEGLKSLAALRYTLYP +N+  ++ TK RPMR+FILGARAE+ LPGHVWKQLQ+LFPE  
Sbjct: 193 LEGLKSLAALRYTLYPFENK-TVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETA 251

Query: 266 FEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYMD 325
           FE+HFIGPE   +K+K +Y+    P+ + +DETL  +YHT+YFH  H+AQDFFPYDPY+D
Sbjct: 252 FELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLD 311

Query: 326 VFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDI 385
            FF FHPGF + E  + W++ T+ GLL+TKCAIF TG  K+ LL DI  V DK+ KE+DI
Sbjct: 312 AFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDI 371

Query: 386 LMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           LM+PTKN++GSTKWELND+NPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 372 LMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/429 (67%), Positives = 344/429 (80%), Gaps = 2/429 (0%)

Query: 1   MFLRTSVPVYRTTLLPRNAFNVAGNQTR-HLMGFVRNALGLXXXXXXXXXXXENRFHPWD 59
           M L  +  + R   +  ++  V G Q R  +MGFVRNALGL           +NRFHPWD
Sbjct: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60

Query: 60  QSPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELL 119
           QSPSP+LRERAARI+ LA+CPVTGK I ++C  SGIPTHHS EAW+ D EYH SKRY LL
Sbjct: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120

Query: 120 KKVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKM 179
           KKVNIYEHDLRSGRPF EFDFP  Q  DRMVNM NWDL+ YTR+F+SMDTEFQ+AAVTKM
Sbjct: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180

Query: 180 LSYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIF 239
           LSYPITIGS+LHQ+SPYSL PKGPI+LEGLKSLAALRYTLYP QNR V S  + +P+R+F
Sbjct: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRS-IQDKPLRVF 239

Query: 240 ILGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETL 299
           ILGARAE+QLPGHVWKQLQYLFPE   E+HF+GPES YD++K++Y+  + P+ + +D+T+
Sbjct: 240 ILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTM 299

Query: 300 KLIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIF 359
           K+ YHT+YFH  HEAQDFFPYDPY D+FF FHPGF S E  + WM  T++ LL TKCAIF
Sbjct: 300 KMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIF 359

Query: 360 TTGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGF 419
           TTGF K DL++D+  V++KYG ELD+L+ PTKNVFGSTKWELND+NP EVYQFNMYIAGF
Sbjct: 360 TTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGF 419

Query: 420 RGKRYPTIK 428
           RGKRY  I+
Sbjct: 420 RGKRYHAIE 428

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/430 (65%), Positives = 335/430 (77%), Gaps = 6/430 (1%)

Query: 1   MFLRTSVPVYRTTLLPRNAFNVAGNQTRH--LMGFVRNALGLXXXXXXXXXXXENRFHPW 58
           MF   S    + +L P + F +    + H  L+GFV+NALG+            NRF+PW
Sbjct: 1   MFAFKSPAATQLSLHPVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPW 60

Query: 59  DQSPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYEL 118
           D+SPSP +RERAARI+  A+CPVTGKEI +TCP+SGIPTH+S+EAWE D  YH +K YE 
Sbjct: 61  DESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEK 120

Query: 119 LKKVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTK 178
           L+KVNIYEHDLRSGRPFPEFDFP +Q +D  VNMTNWDLF YTR FYSMDTEFQ+A VTK
Sbjct: 121 LRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTK 180

Query: 179 MLSYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRI 238
           MLSYPITIGS+L+++SPY+L PKGP++LEGLKSLAALRYTL         +TTK RPMRI
Sbjct: 181 MLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTRPMRI 236

Query: 239 FILGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDET 298
           FILGARAESQLP H+WKQLQ+LFP Q FEI+FIGPE    +    Y+   + I + VDE+
Sbjct: 237 FILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDES 296

Query: 299 LKLIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAI 358
           L L Y+ +YF K H+AQDFFPYDPY D+FF FHPGFAS E  + WM DTMK LLDTKCAI
Sbjct: 297 LTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAI 356

Query: 359 FTTGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAG 418
           FTTGF+++D+++DI  VQD YG+E+D+LM P KNVFGSTKWELND+NPQ+VYQFNMYIAG
Sbjct: 357 FTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAG 416

Query: 419 FRGKRYPTIK 428
           FRGKRY T+K
Sbjct: 417 FRGKRYHTVK 426

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/430 (64%), Positives = 332/430 (77%), Gaps = 18/430 (4%)

Query: 9   VYRTT--LLPRNAFNVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDL 66
           +Y TT  +L +N    +    R+LMGFVR+ LGL           ENRFHPW+ SP  DL
Sbjct: 4   LYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDL 63

Query: 67  RERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYE 126
           RERAARI+T+A+CPV+  +INYTCPISGIPTHHSR+ WE D  YH +   ++LKKVNIYE
Sbjct: 64  RERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYE 123

Query: 127 HDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITI 186
           HDLRSGRPFPEFDFPR+Q  D ++N+ NWDL+ YTR F+SMDTEFQ+AAVTKMLSYP+TI
Sbjct: 124 HDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTI 183

Query: 187 GSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRL------------VISTTKAR 234
            SVLHQFSPYSL PKGP++LEGLKSLAALRYTL    N L            + +T+K R
Sbjct: 184 ASVLHQFSPYSLTPKGPVTLEGLKSLAALRYTL--NNNSLSDTSSGNSDSTTITATSKNR 241

Query: 235 PMRIFILGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITES 294
           PMRIFILGARAE+QLP HVWKQLQYLFP   FEIHFIGPES   KDK  Y+  TTPIT+ 
Sbjct: 242 PMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKR 301

Query: 295 VDETLKLIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDT 354
           +D+++ L+YHT+YFH  H+AQDF+PYDPY D+FF+FHPG A+ +  E W+ +TM+GLLD+
Sbjct: 302 IDDSMSLVYHTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAATK--ETWLNETMQGLLDS 359

Query: 355 KCAIFTTGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNM 414
           KC IF TGF + D+  DI+V+   + K++DILMKP KNVFGSTKWELND NPQEVYQFNM
Sbjct: 360 KCPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNM 419

Query: 415 YIAGFRGKRY 424
           YIAG+RGKRY
Sbjct: 420 YIAGYRGKRY 429

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/418 (68%), Positives = 335/418 (80%), Gaps = 2/418 (0%)

Query: 11  RTTLLPRNAFNVAGNQTRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERA 70
           R   + R     A  Q R +MGFVRNALGL           ENRFH W+QSPSPDLRERA
Sbjct: 12  RPYAVGRGCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERA 71

Query: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130
           ARIR LARCPVTGK+I Y+C  SGIPTHHSREAWEQD+EYH SKR+  L+KVN+YEHDLR
Sbjct: 72  ARIRALARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLR 131

Query: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190
           SGRPF EFDFP++QG+DRMVNM NWDLFLYTR FYSMDT+FQ+AAVTKMLSYPITIGS+L
Sbjct: 132 SGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLL 191

Query: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250
           HQFSPY+L+P+GPI+LEGLKSLAALRYTLYP          +++PMRIFILGARAE+QLP
Sbjct: 192 HQFSPYALEPRGPITLEGLKSLAALRYTLYPESES--ARAVRSKPMRIFILGARAEAQLP 249

Query: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310
           GHVWKQLQYLFP    EIHFIGPE+ YD+ +K+Y+  +TP+++ VD TLKL++HT+Y H 
Sbjct: 250 GHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHV 309

Query: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370
            HEAQDFFPYDPY DVFF FHPGFASAE    WM  T+  LL+TKCAIF TGF ++D+  
Sbjct: 310 FHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFG 369

Query: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           D   ++  +  E+D+LM PTKN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRY  I+
Sbjct: 370 DFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/403 (68%), Positives = 322/403 (79%), Gaps = 2/403 (0%)

Query: 27  TRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEI 86
           +R L+GFVRNALGL            NRF+PWDQSPSP+LRERAA+I+ +ARCP+TGKEI
Sbjct: 24  SRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEI 83

Query: 87  NYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQ 146
           NYTCPISGIPTHHSREAWEQD+ YH +K  ++LKKVNIYEHDLRSGR FPEFDFP DQ  
Sbjct: 84  NYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTF 143

Query: 147 DRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISL 206
           DR VN+ NWDL+ YTR+FYSMDTEFQ+A VTKMLSYPITI SVLHQ+SPYSL P GPI+L
Sbjct: 144 DRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITL 203

Query: 207 EGLKSLAALRYTLYPMQNRLVIST-TKARPMRIFILGARAESQLPGHVWKQLQYLFPEQT 265
           EGLKS+AALRY+LYP Q++   S   K RPMRIFILGARAESQLPGHVWKQ QYLFP QT
Sbjct: 204 EGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQT 263

Query: 266 FEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYMD 325
           FEI FIGPE    ++    +     I + +D+T+ L+YH + FH +H+AQDFFPYDPY D
Sbjct: 264 FEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYND 322

Query: 326 VFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDI 385
           VFF+FHPGFAS E  E WM DT+K LLDTKCA+F TGF+K DL  D+ ++   YG +LD 
Sbjct: 323 VFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDT 382

Query: 386 LMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           LM P KN+FGSTKWELND+NPQEVYQFNMYI+ FRGKRY  I+
Sbjct: 383 LMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIE 425

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/416 (66%), Positives = 319/416 (76%), Gaps = 18/416 (4%)

Query: 27  TRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEI 86
            RH +GFV+NALG+           ENRFHPWDQSPSPDLRERAARIR LA+CPVTGKEI
Sbjct: 38  NRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEI 97

Query: 87  NYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQ 146
           NYTCPISGIPTHHS+EAWE D  YH +K Y++LKKVN++EHDLRSGR FPEF+FP+ Q  
Sbjct: 98  NYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDH 157

Query: 147 DRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISL 206
           D  V+M NWD+F YTR F SMD+EFQ+A VTKMLSYPITI S+LH++ PY+L+P GPI+L
Sbjct: 158 DCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITL 217

Query: 207 EGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTF 266
           EGLKS+AAL+Y+L   +      TTK RPMRIFILGARAESQLP H+WKQ  YLFP Q F
Sbjct: 218 EGLKSIAALKYSLRHNE----FETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNF 273

Query: 267 EIHFIGPESYYDKDKKKYIQLTTPITES--------------VDETLKLIYHTEYFHKLH 312
           EI+FIGPE     +        T  T S              +DE L L+YHT++FH LH
Sbjct: 274 EINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLH 333

Query: 313 EAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDI 372
            A+DFFPYD Y DVFF FHPGFAS E  + WM +TMK LLDTKCAIFTTGF K DLL+DI
Sbjct: 334 NARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDI 393

Query: 373 AVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
            +VQ+ YGKE+D+LMKPTKNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRY  +K
Sbjct: 394 DIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/401 (67%), Positives = 316/401 (78%), Gaps = 6/401 (1%)

Query: 28  RHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEIN 87
           R +MG+VRNA GL            NRFHPW++SP  DLR+RAARI+TLARCPVTGK IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 88  YTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQD 147
           YTCPISGIPTHHSR+AWE D +YH +K YE LKKVNIYEHDLRSGR FPEFDFP +QG+D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 148 RMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLE 207
           R VN+ NWDLFLYTR FYSMDTEF +A VTKMLSYPITI SVLH+FSPY LQP+GP++LE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 208 GLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTFE 267
           GLKS+AALRYTLYP   +  +S     PMRIFI+G RAESQLPGHVWKQLQYLF E+ FE
Sbjct: 209 GLKSIAALRYTLYPKLGKTSLSNNS--PMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266

Query: 268 IHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYMDVF 327
           IHFIGPE    + K      +TP+ + VD+TL LIYH +YFH+LH++ D FPY+PY DVF
Sbjct: 267 IHFIGPECQLKEPK----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322

Query: 328 FIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDILM 387
           FIFHPGFA  +  + W+ +T+  LL+TKCAIF TGF + D+  D+ ++   Y  E+D+LM
Sbjct: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382

Query: 388 KPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428
           KP KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRY  IK
Sbjct: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423

>KAFR0E03570 Chr5 (719253..720824) [1572 bp, 523 aa] {ON} Anc_5.487
           YOR149C
          Length = 523

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 377 DKYGKELDILMKPTKNVFGSTKWELNDMNPQEVY 410
           D++ + L+I+MK   +V G+T WE ++MN    Y
Sbjct: 44  DEHFQSLEIMMKKFMDVSGTTAWEFDNMNAARSY 77

>Smik_13.6 Chr13 complement(11595..13133) [1539 bp, 512 aa] {ON}
           YML128C (REAL)
          Length = 512

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 341 EHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWE 400
           E W KD +K  LD +   ++   T+N L E   +V+    ++L IL K  +  F ++ W 
Sbjct: 340 ESWPKDKLKMFLDARGIKYSILSTENQLRE---LVKKSRNEKLKILPKDYQKYFDNSNWS 396

Query: 401 LNDM 404
           L+D+
Sbjct: 397 LDDI 400

>Kwal_33.14788 s33 (817935..818825) [891 bp, 296 aa] {ON} [contig
           101] FULL
          Length = 296

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 299 LKLIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMK 345
           L L+   E+ H L+   D+F  +P  DV FI      S E  E W K
Sbjct: 200 LDLLQFKEFVHALNSGIDYFNKNPEEDVQFITENFGYSKEDAESWFK 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,365,511
Number of extensions: 2025756
Number of successful extensions: 4383
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4468
Number of HSP's successfully gapped: 31
Length of query: 429
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 317
Effective length of database: 40,638,807
Effective search space: 12882501819
Effective search space used: 12882501819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)